F415677

General Info

Members Datasets Scaffolds Average Seq Length
343 163 686 141

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_1076953|Ga0436364_1076953_146_649
Length 167
Sequence MTIEEIKDLIRVVQETGIAELEVHRGDNSVRIANTTSTRQEISLPTMIPVPIAPVAQMPVTNTTALPLSAPVAASPTPEVHPEEERDVVVKSPIVGTYFDSPAPGAPPFVKVGDQIHPKQVLCIIESMKLMNEIEAETAGTIIAKLVENGRPVEYGESLFTIRPSQA

Samples

Sample ID Description Type Environment
1 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
55 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
68 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
69 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
108 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
109 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
110 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
111 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
112 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
113 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
114 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
115 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
116 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
117 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
118 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
119 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
120 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
121 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
122 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
123 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
124 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
125 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
126 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
127 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
128 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
129 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
130 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
131 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
132 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
133 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
134 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
135 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
136 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
137 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
138 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
139 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
140 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
141 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
142 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
143 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
144 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
145 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
146 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
147 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
148 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
153 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
154 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
155 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
156 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
157 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
158 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
159 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
160 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
161 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
162 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
163 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.71
Metatranscriptomes 0.29
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.87
Rhizosphere 93.88
Stem 0
Stem Tuber 0
Unclassified 2.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436364_1076953 3300037853 Bacteria 5653
2 Ga0070658_10008677 3300005327 Bacteria 8166
3 Ga0070658_10453458 3300005327 Bacteria 1105
4 Ga0070683_100004859 3300005329 Bacteria 11132
5 Ga0070683_100038845 3300005329 Bacteria 4365
6 Ga0070683_100290454 3300005329 Bacteria 1555
7 Ga0070683_100910746 3300005329 Bacteria 844
8 Ga0070690_100147949 3300005330 Bacteria 1600
9 Ga0070666_10009946 3300005335 Bacteria 5936
10 Ga0070680_100008921 3300005336 Bacteria 7691
11 Ga0070660_100031705 3300005339 Bacteria 3971
12 Ga0070660_100032668 3300005339 Bacteria 3918
13 Ga0070660_100265294 3300005339 Bacteria 1403
14 Ga0070691_10003026 3300005341 Bacteria 7530
15 Ga0070691_10487795 3300005341 Bacteria 710
16 Ga0070661_100346945 3300005344 Bacteria 1164
17 Ga0070661_101103689 3300005344 Bacteria 661
18 Ga0070675_100746817 3300005354 Bacteria 893
19 Ga0070671_100040804 3300005355 Bacteria 3856
20 Ga0070673_100088183 3300005364 Bacteria 2530
21 Ga0070688_100111840 3300005365 Bacteria 1817
22 Ga0070667_100033283 3300005367 Bacteria 4307
23 Ga0070667_100401452 3300005367 Bacteria 1248
24 Ga0070714_100037925 3300005435 Bacteria 4052
25 Ga0070714_100071739 3300005435 Bacteria 2996
26 Ga0070711_100311083 3300005439 Bacteria 1256
27 Ga0070711_100505600 3300005439 Bacteria 997
28 Ga0070711_100852761 3300005439 Bacteria 775
29 Ga0070663_100571934 3300005455 Bacteria 947
30 Ga0070663_101287640 3300005455 Bacteria 645
31 Ga0070663_101769963 3300005455 Bacteria 553
32 Ga0070678_100135841 3300005456 Bacteria 1961
33 Ga0070678_100304595 3300005456 Bacteria 1355
34 Ga0070681_10001506 3300005458 Bacteria 20626
35 Ga0070681_10015459 3300005458 Bacteria 7600
36 Ga0070681_10138673 3300005458 Bacteria 2362
37 Ga0070679_100001103 3300005530 Bacteria 23607
38 Ga0070679_100657574 3300005530 Bacteria 991
39 Ga0070679_100682755 3300005530 Bacteria 970
40 Ga0070684_100040994 3300005535 Bacteria 3989
41 Ga0070684_101495917 3300005535 Bacteria 636
42 Ga0070684_101719285 3300005535 Bacteria 592
43 Ga0068853_100327490 3300005539 Bacteria 1421
44 Ga0068853_100856749 3300005539 Bacteria 872
45 Ga0070693_100487941 3300005547 Bacteria 872
46 Ga0070665_100023327 3300005548 Bacteria 6229
47 Ga0070665_100040041 3300005548 Bacteria 4711
48 Ga0070665_100118919 3300005548 Bacteria 2645
49 Ga0068855_100007824 3300005563 Bacteria 12912
50 Ga0068855_100037603 3300005563 Bacteria 5755
51 Ga0068855_100236524 3300005563 Bacteria 2043
52 Ga0068855_100673171 3300005563 Bacteria 1109
53 Ga0068855_101557334 3300005563 Bacteria 677
54 Ga0070664_100247991 3300005564 Bacteria 1600
55 Ga0070664_100620279 3300005564 Bacteria 1004
56 Ga0068857_100007592 3300005577 Bacteria 9336
57 Ga0068857_100027477 3300005577 Bacteria 5019
58 Ga0068857_101004954 3300005577 Unclassified 803
59 Ga0068856_100000584 3300005614 Bacteria 39905
60 Ga0068856_100072595 3300005614 Bacteria 3407
61 Ga0068856_100141073 3300005614 Bacteria 2417
62 Ga0068852_100011903 3300005616 Bacteria 6579
63 Ga0068859_100153756 3300005617 Bacteria 2377
64 Ga0068859_100605063 3300005617 Bacteria 1189
65 Ga0068864_100094474 3300005618 Bacteria 2643
66 Ga0068864_100605304 3300005618 Bacteria 1064
67 Ga0068851_10072240 3300005834 Bacteria 1787
68 Ga0068863_100014651 3300005841 Bacteria 7548
69 Ga0068863_100029491 3300005841 Bacteria 5237
70 Ga0068863_100160331 3300005841 Bacteria 2155
71 Ga0068858_100005542 3300005842 Bacteria 12357
72 Ga0068858_100038657 3300005842 Bacteria 4427
73 Ga0068858_100333977 3300005842 Bacteria 1450
74 Ga0068860_100009231 3300005843 Bacteria 9803
75 Ga0068860_102547385 3300005843 Bacteria 531
76 Ga0070712_100608069 3300006175 Bacteria 926
77 Ga0097621_100082631 3300006237 Bacteria 2675
78 Ga0097621_100142509 3300006237 Bacteria 2049
79 Ga0097621_100194325 3300006237 Bacteria 1759
80 Ga0068871_100039051 3300006358 Bacteria 3796
81 Ga0068871_100059701 3300006358 Bacteria 3108
82 Ga0068871_100064028 3300006358 Bacteria 3009
83 Ga0068871_100066452 3300006358 Bacteria 2956
84 Ga0068871_100115761 3300006358 Bacteria 2260
85 Ga0075430_100151612 3300006846 Unclassified 1930
86 Ga0068865_100490188 3300006881 Bacteria 1023
87 Ga0097620_100153756 3300006931 Bacteria 2377
88 Ga0097620_100605050 3300006931 Bacteria 1189
89 Ga0105240_10000734 3300009093 Bacteria 59913
90 Ga0105240_10019003 3300009093 Bacteria 9200
91 Ga0105240_10088921 3300009093 Bacteria 3779
92 Ga0105240_10254989 3300009093 Bacteria 2027
93 Ga0105240_10313497 3300009093 Bacteria 1790
94 Ga0105240_10359554 3300009093 Bacteria 1649
95 Ga0105240_10529955 3300009093 Bacteria 1306
96 Ga0105240_11181219 3300009093 Bacteria 811
97 Ga0105245_10002124 3300009098 Bacteria 17956
98 Ga0105245_10066184 3300009098 Bacteria 3270
99 Ga0105245_10082251 3300009098 Bacteria 2946
100 Ga0105245_10332154 3300009098 Bacteria 1501
101 Ga0105245_10388857 3300009098 Bacteria 1391
102 Ga0105245_11091671 3300009098 Bacteria 844
103 Ga0105245_11858163 3300009098 Bacteria 655
104 Ga0105247_10351032 3300009101 Unclassified 1037
105 Ga0105243_10141811 3300009148 Bacteria 2051
106 Ga0105243_10306805 3300009148 Bacteria 1441
107 Ga0105243_10346011 3300009148 Bacteria 1363
108 Ga0105241_10002589 3300009174 Bacteria 13562
109 Ga0105241_10020178 3300009174 Bacteria 4923
110 Ga0105241_10082715 3300009174 Bacteria 2517
111 Ga0105241_10269411 3300009174 Bacteria 1450
112 Ga0105241_10627525 3300009174 Bacteria 974
113 Ga0105242_10026785 3300009176 Bacteria 4571
114 Ga0105242_10102166 3300009176 Bacteria 2431
115 Ga0105242_10153931 3300009176 Bacteria 2007
116 Ga0105242_10263228 3300009176 Bacteria 1559
117 Ga0105242_10745090 3300009176 Bacteria 964
118 Ga0105242_11495979 3300009176 Unclassified 706
119 Ga0105248_10010250 3300009177 Bacteria 10317
120 Ga0105248_10016364 3300009177 Bacteria 8162
121 Ga0105248_11521417 3300009177 Bacteria 758
122 Ga0105248_12009286 3300009177 Bacteria 657
123 Ga0105237_10414464 3300009545 Bacteria 1352
124 Ga0105237_10587780 3300009545 Bacteria 1120
125 Ga0105238_10002582 3300009551 Bacteria 18044
126 Ga0105238_10022969 3300009551 Bacteria 6358
127 Ga0105238_10053937 3300009551 Bacteria 4039
128 Ga0105238_10085649 3300009551 Bacteria 3139
129 Ga0105238_10450807 3300009551 Bacteria 1283
130 Ga0105249_10019021 3300009553 Bacteria 6126
131 Ga0105239_10003659 3300010375 Bacteria 18789
132 Ga0105239_10007301 3300010375 Bacteria 12690
133 Ga0105239_10037728 3300010375 Bacteria 5295
134 Ga0105239_10206125 3300010375 Bacteria 2203
135 Ga0105239_10741625 3300010375 Bacteria 1124
136 Ga0105239_11276573 3300010375 Bacteria 847
137 Ga0105239_12366940 3300010375 Bacteria 618
138 Ga0105246_10243901 3300011119 Bacteria 1422
139 Ga0105246_10344015 3300011119 Bacteria 1220
140 Ga0105246_11622962 3300011119 Bacteria 612
141 Ga0157373_10283735 3300013100 Bacteria 1174
142 Ga0157373_10397917 3300013100 Bacteria 987
143 Ga0157371_10029816 3300013102 Bacteria 3941
144 Ga0157370_10000734 3300013104 Bacteria 41162
145 Ga0157370_10002417 3300013104 Bacteria 22509
146 Ga0157370_10048247 3300013104 Bacteria 4079
147 Ga0157370_10327096 3300013104 Bacteria 1413
148 Ga0157370_10823587 3300013104 Bacteria 844
149 Ga0157369_10001499 3300013105 Bacteria 28639
150 Ga0157369_10026327 3300013105 Bacteria 6453
151 Ga0157369_10172083 3300013105 Bacteria 2282
152 Ga0157369_11402735 3300013105 Bacteria 711
153 Ga0157374_10196440 3300013296 Bacteria 1974
154 Ga0157374_11936534 3300013296 Bacteria 615
155 Ga0157378_10025654 3300013297 Bacteria 5189
156 Ga0157378_10153599 3300013297 Bacteria 2146
157 Ga0163162_10008426 3300013306 Bacteria 10053
158 Ga0163162_10040214 3300013306 Bacteria 4675
159 Ga0163162_11278040 3300013306 Bacteria 834
160 Ga0157372_10059613 3300013307 Bacteria 4269
161 Ga0157372_10062128 3300013307 Bacteria 4184
162 Ga0157372_10404576 3300013307 Bacteria 1590
163 Ga0157375_10021039 3300013308 Bacteria 5973
164 Ga0157375_10052216 3300013308 Bacteria 4018
165 Ga0163163_10006017 3300014325 Bacteria 10555
166 Ga0163163_10013161 3300014325 Bacteria 7560
167 Ga0163163_10198270 3300014325 Bacteria 2056
168 Ga0163163_10556647 3300014325 Bacteria 1209
169 Ga0163163_11660745 3300014325 Bacteria 700
170 Ga0157379_10117625 3300014968 Bacteria 2391
171 Ga0157379_10176718 3300014968 Bacteria 1928
172 Ga0157379_11102747 3300014968 Bacteria 760
173 Ga0157376_10015853 3300014969 Bacteria 5704
174 Ga0157376_10578408 3300014969 Bacteria 1115
175 Ga0157376_10772601 3300014969 Bacteria 971
176 Ga0157376_11173066 3300014969 Bacteria 795
177 Ga0206349_1925748 3300020075 Bacteria 745
178 Ga0213876_10011203 3300021384 Bacteria 4793
179 Ga0213876_10503624 3300021384 Unclassified 644
180 Ga0213875_10000027 3300021388 Bacteria 190420
181 Ga0213875_10034572 3300021388 Bacteria 2387
182 Ga0213875_10049303 3300021388 Bacteria 1974
183 Ga0213875_10148130 3300021388 Bacteria 1100
184 Ga0207656_10087168 3300025321 Bacteria 1412
185 Ga0207680_10012941 3300025903 Bacteria 4265
186 Ga0207699_10522443 3300025906 Bacteria 859
187 Ga0207705_10037561 3300025909 Bacteria 3466
188 Ga0207705_10409636 3300025909 Bacteria 1049
189 Ga0207654_10034457 3300025911 Bacteria 2813
190 Ga0207654_10053464 3300025911 Bacteria 2331
191 Ga0207654_10114503 3300025911 Bacteria 1683
192 Ga0207654_10337451 3300025911 Bacteria 1034
193 Ga0207654_10378250 3300025911 Bacteria 980
194 Ga0207654_10451665 3300025911 Bacteria 901
195 Ga0207707_10000224 3300025912 Bacteria 60855
196 Ga0207707_10412071 3300025912 Bacteria 1159
197 Ga0207695_10000533 3300025913 Bacteria 79615
198 Ga0207695_10001664 3300025913 Bacteria 35786
199 Ga0207695_10007790 3300025913 Bacteria 13563
200 Ga0207695_10030792 3300025913 Bacteria 5903
201 Ga0207695_10399094 3300025913 Bacteria 1260
202 Ga0207671_10029556 3300025914 Bacteria 4092
203 Ga0207663_10490615 3300025916 Bacteria 953
204 Ga0207660_10006567 3300025917 Bacteria 7549
205 Ga0207657_10002686 3300025919 Bacteria 19167
206 Ga0207657_10042976 3300025919 Bacteria 3984
207 Ga0207657_10124943 3300025919 Bacteria 2114
208 Ga0207649_10087140 3300025920 Bacteria 2036
209 Ga0207652_10288957 3300025921 Bacteria 1479
210 Ga0207652_10304971 3300025921 Bacteria 1437
211 Ga0207652_10653092 3300025921 Bacteria 940
212 Ga0207694_10008456 3300025924 Bacteria 7770
213 Ga0207694_10009046 3300025924 Bacteria 7517
214 Ga0207694_10023503 3300025924 Bacteria 4679
215 Ga0207694_10068560 3300025924 Bacteria 2770
216 Ga0207694_10597192 3300025924 Bacteria 928
217 Ga0207659_10560072 3300025926 Bacteria 972
218 Ga0207687_10012979 3300025927 Bacteria 5444
219 Ga0207687_10042298 3300025927 Bacteria 3133
220 Ga0207687_10094110 3300025927 Bacteria 2192
221 Ga0207687_10113665 3300025927 Bacteria 2014
222 Ga0207687_10115703 3300025927 Bacteria 1998
223 Ga0207664_10166893 3300025929 Bacteria 1881
224 Ga0207664_10838283 3300025929 Bacteria 826
225 Ga0207644_10064200 3300025931 Bacteria 2668
226 Ga0207686_10095816 3300025934 Bacteria 1970
227 Ga0207686_10098123 3300025934 Bacteria 1950
228 Ga0207686_10443289 3300025934 Bacteria 997
229 Ga0207704_11935451 3300025938 Bacteria 507
230 Ga0207711_10012697 3300025941 Bacteria 6996
231 Ga0207711_10436322 3300025941 Bacteria 1219
232 Ga0207711_10832852 3300025941 Bacteria 859
233 Ga0207711_11396233 3300025941 Bacteria 643
234 Ga0207661_10008034 3300025944 Bacteria 7522
235 Ga0207661_10162617 3300025944 Bacteria 1938
236 Ga0207661_10244562 3300025944 Bacteria 1593
237 Ga0207661_11814361 3300025944 Bacteria 555
238 Ga0207679_10151769 3300025945 Bacteria 1887
239 Ga0207679_10530545 3300025945 Bacteria 1054
240 Ga0207667_10000322 3300025949 Bacteria 66404
241 Ga0207667_10022026 3300025949 Bacteria 7050
242 Ga0207667_10138066 3300025949 Bacteria 2510
243 Ga0207667_10151458 3300025949 Bacteria 2387
244 Ga0207667_11724280 3300025949 Bacteria 592
245 Ga0207712_10013058 3300025961 Bacteria 5321
246 Ga0207658_10024179 3300025986 Bacteria 4248
247 Ga0207677_10251975 3300026023 Bacteria 1434
248 Ga0207703_10022096 3300026035 Bacteria 4986
249 Ga0207703_11211469 3300026035 Bacteria 726
250 Ga0207639_10016678 3300026041 Bacteria 5202
251 Ga0207639_10162802 3300026041 Bacteria 1882
252 Ga0207639_11142832 3300026041 Bacteria 731
253 Ga0207678_10033086 3300026067 Bacteria 4505
254 Ga0207702_10001895 3300026078 Bacteria 20447
255 Ga0207702_10171042 3300026078 Bacteria 1992
256 Ga0207702_10344843 3300026078 Bacteria 1424
257 Ga0207641_10008507 3300026088 Bacteria 8480
258 Ga0207641_10012931 3300026088 Bacteria 6849
259 Ga0207641_10075437 3300026088 Bacteria 2912
260 Ga0207676_10079298 3300026095 Bacteria 2662
261 Ga0207674_10000350 3300026116 Bacteria 59446
262 Ga0207674_10001993 3300026116 Bacteria 25884
263 Ga0207674_10010062 3300026116 Bacteria 10756
264 Ga0207683_10235048 3300026121 Bacteria 1671
265 Ga0207683_10843318 3300026121 Bacteria 851
266 Ga0207698_10010938 3300026142 Bacteria 5861
267 Ga0207698_10239771 3300026142 Bacteria 1652
268 Ga0268266_10015616 3300028379 Bacteria 6508
269 Ga0268266_10150135 3300028379 Bacteria 2099
270 Ga0268266_11207317 3300028379 Bacteria 731
271 Ga0268264_10010662 3300028381 Bacteria 7595
272 Ga0268264_10519813 3300028381 Bacteria 1163
273 Ga0265338_10169609 3300028800 Bacteria 1676
274 Ga0265338_10196003 3300028800 Bacteria 1527
275 Ga0265316_10390897 3300031344 Bacteria 1003
276 Ga0265316_11196032 3300031344 Bacteria 526
277 Ga0307509_10302411 3300031507 Bacteria 1347
278 Ga0307408_100272092 3300031548 Bacteria 1407
279 Ga0265314_10000345 3300031711 Bacteria 64760
280 Ga0373949_0104719 3300035090 Bacteria 779
281 Ga0373953_0015268 3300035117 Bacteria 2779
282 Ga0373954_0032647 3300035118 Bacteria 2407
283 Ga0373956_0185770 3300035119 Bacteria 983
284 Ga0373957_0047698 3300035120 Bacteria 1630
285 Ga0373943_0656743 3300035170 Bacteria 620
286 Ga0373955_0016011 3300035172 Bacteria 3683
287 Ga0373961_0286528 3300035241 Unclassified 606
288 Ga0373935_0181052 3300035692 Bacteria 1447
289 Ga0373935_0389076 3300035692 Bacteria 1000
290 Ga0373947_0246969 3300035725 Bacteria 1179
291 Ga0373937_0011421 3300036401 Bacteria 7793
292 Ga0395898_1643573 3300037466 Bacteria 566
293 Ga0436364_0446012 3300037853 Bacteria 193523
294 Ga0436364_0625477 3300037853 Bacteria 15566
295 Ga0436364_0812453 3300037853 Bacteria 4647
296 Ga0436364_0896323 3300037853 Bacteria 3868
297 Ga0436364_1344986 3300037853 Bacteria 1690
298 Ga0436364_1526149 3300037853 Bacteria 2279
299 Ga0436365_0172285 3300039437 Bacteria 2401
300 Ga0436365_0769456 3300039437 Bacteria 11319
301 Ga0436365_1490456 3300039437 Unclassified 594
302 Ga0436363_1495316 3300039450 Bacteria 842
303 Ga0436362_1110328 3300039453 Bacteria 695
304 Ga0466960_0111600 3300044901 Bacteria 1421
305 Ga0466959_0162594 3300045049 Bacteria 1569
306 Ga0466959_0179203 3300045049 Bacteria 1483
307 Ga0451576_1603925 3300045051 Bacteria 675
308 Ga0466958_0156502 3300045836 Bacteria 1438
309 Ga0495617_150702 3300046452 Bacteria 740
310 Ga0495603_0541242 3300046455 Bacteria 667
311 Ga0495580_0058287 3300046472 Bacteria 2716
312 Ga0495585_0215801 3300046492 Bacteria 970
313 Ga0495594_0071377 3300046499 Bacteria 1931
314 Ga0495608_0225286 3300046511 Bacteria 1175
315 Ga0495652_0069858 3300046529 Bacteria 2938
316 Ga0495587_0062075 3300046536 Bacteria 2189
317 Ga0495621_0213105 3300046539 Bacteria 780
318 Ga0495635_0199855 3300046663 Bacteria 1356
319 Ga0495588_0172631 3300046674 Bacteria 1143
320 Ga0495599_0000343 3300046678 Bacteria 27587
321 Ga0495613_0209549 3300046689 Bacteria 1371
322 Ga0495684_0002760 3300047471 Bacteria 13871
323 Ga0496104_0476859 3300048907 Bacteria 1159
324 Ga0496110_0957658 3300048913 Bacteria 763
325 Ga0496112_0445580 3300048915 Bacteria 1233
326 Ga0501037_0169842 3300049573 Bacteria 1551
327 Ga0501039_0205086 3300049575 Bacteria 1550
328 Ga0501040_0119077 3300049576 Bacteria 1852
329 Ga0501042_0266905 3300049578 Bacteria 1236
330 Ga0501042_0863816 3300049578 Bacteria 659
331 Ga0501068_0188356 3300049584 Bacteria 1306
332 Ga0501071_0166955 3300049587 Bacteria 1647
333 Ga0501072_0097974 3300049588 Bacteria 2331
334 Ga0501075_0032281 3300049591 Bacteria 3890
335 Ga0501076_0102848 3300049592 Bacteria 2304
336 Ga0501076_0587982 3300049592 Unclassified 918
337 Ga0501249_152911 3300049679 Unclassified 582
338 Ga0501225_0211863 3300049705 Bacteria 620
339 Ga0501083_0709615 3300049744 Bacteria 654
340 Ga0501045_0640547 3300049824 Bacteria 786
341 Ga0495612_0396290 3300053078 Unclassified 627
342 Ga0501082_0158601 3300060353 Bacteria 1966
343 Ga0530510_0224657 3300061734 Bacteria 1396
344 Ga0436364_1076953
345 Ga0070658_10008677
346 Ga0070658_10453458
347 Ga0070683_100004859
348 Ga0070683_100038845
349 Ga0070683_100290454
350 Ga0070683_100910746
351 Ga0070690_100147949
352 Ga0070666_10009946
353 Ga0070680_100008921
354 Ga0070660_100031705
355 Ga0070660_100032668
356 Ga0070660_100265294
357 Ga0070691_10003026
358 Ga0070691_10487795
359 Ga0070661_100346945
360 Ga0070661_101103689
361 Ga0070675_100746817
362 Ga0070671_100040804
363 Ga0070673_100088183
364 Ga0070688_100111840
365 Ga0070667_100033283
366 Ga0070667_100401452
367 Ga0070714_100037925
368 Ga0070714_100071739
369 Ga0070711_100311083
370 Ga0070711_100505600
371 Ga0070711_100852761
372 Ga0070663_100571934
373 Ga0070663_101287640
374 Ga0070663_101769963
375 Ga0070678_100135841
376 Ga0070678_100304595
377 Ga0070681_10001506
378 Ga0070681_10015459
379 Ga0070681_10138673
380 Ga0070679_100001103
381 Ga0070679_100657574
382 Ga0070679_100682755
383 Ga0070684_100040994
384 Ga0070684_101495917
385 Ga0070684_101719285
386 Ga0068853_100327490
387 Ga0068853_100856749
388 Ga0070693_100487941
389 Ga0070665_100023327
390 Ga0070665_100040041
391 Ga0070665_100118919
392 Ga0068855_100007824
393 Ga0068855_100037603
394 Ga0068855_100236524
395 Ga0068855_100673171
396 Ga0068855_101557334
397 Ga0070664_100247991
398 Ga0070664_100620279
399 Ga0068857_100007592
400 Ga0068857_100027477
401 Ga0068857_101004954
402 Ga0068856_100000584
403 Ga0068856_100072595
404 Ga0068856_100141073
405 Ga0068852_100011903
406 Ga0068859_100153756
407 Ga0068859_100605063
408 Ga0068864_100094474
409 Ga0068864_100605304
410 Ga0068851_10072240
411 Ga0068863_100014651
412 Ga0068863_100029491
413 Ga0068863_100160331
414 Ga0068858_100005542
415 Ga0068858_100038657
416 Ga0068858_100333977
417 Ga0068860_100009231
418 Ga0068860_102547385
419 Ga0070712_100608069
420 Ga0097621_100082631
421 Ga0097621_100142509
422 Ga0097621_100194325
423 Ga0068871_100039051
424 Ga0068871_100059701
425 Ga0068871_100064028
426 Ga0068871_100066452
427 Ga0068871_100115761
428 Ga0075430_100151612
429 Ga0068865_100490188
430 Ga0097620_100153756
431 Ga0097620_100605050
432 Ga0105240_10000734
433 Ga0105240_10019003
434 Ga0105240_10088921
435 Ga0105240_10254989
436 Ga0105240_10313497
437 Ga0105240_10359554
438 Ga0105240_10529955
439 Ga0105240_11181219
440 Ga0105245_10002124
441 Ga0105245_10066184
442 Ga0105245_10082251
443 Ga0105245_10332154
444 Ga0105245_10388857
445 Ga0105245_11091671
446 Ga0105245_11858163
447 Ga0105247_10351032
448 Ga0105243_10141811
449 Ga0105243_10306805
450 Ga0105243_10346011
451 Ga0105241_10002589
452 Ga0105241_10020178
453 Ga0105241_10082715
454 Ga0105241_10269411
455 Ga0105241_10627525
456 Ga0105242_10026785
457 Ga0105242_10102166
458 Ga0105242_10153931
459 Ga0105242_10263228
460 Ga0105242_10745090
461 Ga0105242_11495979
462 Ga0105248_10010250
463 Ga0105248_10016364
464 Ga0105248_11521417
465 Ga0105248_12009286
466 Ga0105237_10414464
467 Ga0105237_10587780
468 Ga0105238_10002582
469 Ga0105238_10022969
470 Ga0105238_10053937
471 Ga0105238_10085649
472 Ga0105238_10450807
473 Ga0105249_10019021
474 Ga0105239_10003659
475 Ga0105239_10007301
476 Ga0105239_10037728
477 Ga0105239_10206125
478 Ga0105239_10741625
479 Ga0105239_11276573
480 Ga0105239_12366940
481 Ga0105246_10243901
482 Ga0105246_10344015
483 Ga0105246_11622962
484 Ga0157373_10283735
485 Ga0157373_10397917
486 Ga0157371_10029816
487 Ga0157370_10000734
488 Ga0157370_10002417
489 Ga0157370_10048247
490 Ga0157370_10327096
491 Ga0157370_10823587
492 Ga0157369_10001499
493 Ga0157369_10026327
494 Ga0157369_10172083
495 Ga0157369_11402735
496 Ga0157374_10196440
497 Ga0157374_11936534
498 Ga0157378_10025654
499 Ga0157378_10153599
500 Ga0163162_10008426
501 Ga0163162_10040214
502 Ga0163162_11278040
503 Ga0157372_10059613
504 Ga0157372_10062128
505 Ga0157372_10404576
506 Ga0157375_10021039
507 Ga0157375_10052216
508 Ga0163163_10006017
509 Ga0163163_10013161
510 Ga0163163_10198270
511 Ga0163163_10556647
512 Ga0163163_11660745
513 Ga0157379_10117625
514 Ga0157379_10176718
515 Ga0157379_11102747
516 Ga0157376_10015853
517 Ga0157376_10578408
518 Ga0157376_10772601
519 Ga0157376_11173066
520 Ga0206349_1925748
521 Ga0213876_10011203
522 Ga0213876_10503624
523 Ga0213875_10000027
524 Ga0213875_10034572
525 Ga0213875_10049303
526 Ga0213875_10148130
527 Ga0207656_10087168
528 Ga0207680_10012941
529 Ga0207699_10522443
530 Ga0207705_10037561
531 Ga0207705_10409636
532 Ga0207654_10034457
533 Ga0207654_10053464
534 Ga0207654_10114503
535 Ga0207654_10337451
536 Ga0207654_10378250
537 Ga0207654_10451665
538 Ga0207707_10000224
539 Ga0207707_10412071
540 Ga0207695_10000533
541 Ga0207695_10001664
542 Ga0207695_10007790
543 Ga0207695_10030792
544 Ga0207695_10399094
545 Ga0207671_10029556
546 Ga0207663_10490615
547 Ga0207660_10006567
548 Ga0207657_10002686
549 Ga0207657_10042976
550 Ga0207657_10124943
551 Ga0207649_10087140
552 Ga0207652_10288957
553 Ga0207652_10304971
554 Ga0207652_10653092
555 Ga0207694_10008456
556 Ga0207694_10009046
557 Ga0207694_10023503
558 Ga0207694_10068560
559 Ga0207694_10597192
560 Ga0207659_10560072
561 Ga0207687_10012979
562 Ga0207687_10042298
563 Ga0207687_10094110
564 Ga0207687_10113665
565 Ga0207687_10115703
566 Ga0207664_10166893
567 Ga0207664_10838283
568 Ga0207644_10064200
569 Ga0207686_10095816
570 Ga0207686_10098123
571 Ga0207686_10443289
572 Ga0207704_11935451
573 Ga0207711_10012697
574 Ga0207711_10436322
575 Ga0207711_10832852
576 Ga0207711_11396233
577 Ga0207661_10008034
578 Ga0207661_10162617
579 Ga0207661_10244562
580 Ga0207661_11814361
581 Ga0207679_10151769
582 Ga0207679_10530545
583 Ga0207667_10000322
584 Ga0207667_10022026
585 Ga0207667_10138066
586 Ga0207667_10151458
587 Ga0207667_11724280
588 Ga0207712_10013058
589 Ga0207658_10024179
590 Ga0207677_10251975
591 Ga0207703_10022096
592 Ga0207703_11211469
593 Ga0207639_10016678
594 Ga0207639_10162802
595 Ga0207639_11142832
596 Ga0207678_10033086
597 Ga0207702_10001895
598 Ga0207702_10171042
599 Ga0207702_10344843
600 Ga0207641_10008507
601 Ga0207641_10012931
602 Ga0207641_10075437
603 Ga0207676_10079298
604 Ga0207674_10000350
605 Ga0207674_10001993
606 Ga0207674_10010062
607 Ga0207683_10235048
608 Ga0207683_10843318
609 Ga0207698_10010938
610 Ga0207698_10239771
611 Ga0268266_10015616
612 Ga0268266_10150135
613 Ga0268266_11207317
614 Ga0268264_10010662
615 Ga0268264_10519813
616 Ga0265338_10169609
617 Ga0265338_10196003
618 Ga0265316_10390897
619 Ga0265316_11196032
620 Ga0307509_10302411
621 Ga0307408_100272092
622 Ga0265314_10000345
623 Ga0373949_0104719
624 Ga0373953_0015268
625 Ga0373954_0032647
626 Ga0373956_0185770
627 Ga0373957_0047698
628 Ga0373943_0656743
629 Ga0373955_0016011
630 Ga0373961_0286528
631 Ga0373935_0181052
632 Ga0373935_0389076
633 Ga0373947_0246969
634 Ga0373937_0011421
635 Ga0395898_1643573
636 Ga0436364_0446012
637 Ga0436364_0625477
638 Ga0436364_0812453
639 Ga0436364_0896323
640 Ga0436364_1344986
641 Ga0436364_1526149
642 Ga0436365_0172285
643 Ga0436365_0769456
644 Ga0436365_1490456
645 Ga0436363_1495316
646 Ga0436362_1110328
647 Ga0466960_0111600
648 Ga0466959_0162594
649 Ga0466959_0179203
650 Ga0451576_1603925
651 Ga0466958_0156502
652 Ga0495617_150702
653 Ga0495603_0541242
654 Ga0495580_0058287
655 Ga0495585_0215801
656 Ga0495594_0071377
657 Ga0495608_0225286
658 Ga0495652_0069858
659 Ga0495587_0062075
660 Ga0495621_0213105
661 Ga0495635_0199855
662 Ga0495588_0172631
663 Ga0495599_0000343
664 Ga0495613_0209549
665 Ga0495684_0002760
666 Ga0496104_0476859
667 Ga0496110_0957658
668 Ga0496112_0445580
669 Ga0501037_0169842
670 Ga0501039_0205086
671 Ga0501040_0119077
672 Ga0501042_0266905
673 Ga0501042_0863816
674 Ga0501068_0188356
675 Ga0501071_0166955
676 Ga0501072_0097974
677 Ga0501075_0032281
678 Ga0501076_0102848
679 Ga0501076_0587982
680 Ga0501249_152911
681 Ga0501225_0211863
682 Ga0501083_0709615
683 Ga0501045_0640547
684 Ga0495612_0396290
685 Ga0501082_0158601
686 Ga0530510_0224657

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00364

Biotin_lipoyl

Biotin-requiring enzyme

88

162

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hr7-assembly1.cif.gz_B crystal structure of biotin carboxyl carrier protein-biotin carboxylase complex from e.coli 0.9604 53 131
5gu9-assembly1.cif.gz_A structure of biotin carboxyl carrier protein from pyrococcus horikoshi ot3 (delta n79) a138i mutant 0.9558 58 131
2d5d-assembly1.cif.gz_A structure of biotin carboxyl carrier protein (74val start) from pyrococcus horikoshi ot3 ligand free form ii 0.945 58 131
5gua-assembly1.cif.gz_A structure of biotin carboxyl carrier protein from pyrococcus horikoshi ot3 (delta n79) a138y mutant 0.945 56 131
4hr7-assembly1.cif.gz_B crystal structure of biotin carboxyl carrier protein-biotin carboxylase complex from e.coli 0.937 53 131
ID Description Score Start End Superfamily
af_I1LWR8_198_274_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9683 55 131 2.40.50.100
2d5dB00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9574 58 131 2.40.50.100
af_I1LWR8_198_274_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9561 55 131 2.40.50.100
af_Q93W03_192_271_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9477 56 131 2.40.50.100
af_Q2FXX0_70_148_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9448 56 131 2.40.50.100
ID Description Score Start End GO Terms
AF-A0A3M1WIJ3-F1-model_v4 Biotin carboxyl carrier protein of acetyl-CoA carboxylase 0.9928 56 134 GO:0003989
GO:0006633
GO:0009317
AF-A0A7V1ICW5-F1-model_v4 Biotin carboxyl carrier protein of acetyl-CoA carboxylase 0.9919 56 133 GO:0003989
GO:0006633
GO:0009317
AF-A0A2V9FF22-F1-model_v4 Biotin carboxyl carrier protein of acetyl-CoA carboxylase 0.9892 56 134 GO:0003989
GO:0006633
GO:0009317
AF-A0A6J4LLE9-F1-model_v4 Biotin carboxyl carrier protein of acetyl-CoA carboxylase 0.9864 56 134 GO:0003989
GO:0006633
GO:0009317
AF-A0A060AE34-F1-model_v4 Biotin carboxyl carrier protein of acetyl-CoA carboxylase 0.9853 56 133 GO:0003989
GO:0006633
GO:0009317
GO:0009507

Map