F415512

General Info

Members Datasets Scaffolds Average Seq Length
343 203 686 202

Family's Representative Sequence

Representative Sequence 3300006051|Ga0075364_10112272|Ga0075364_101122722
Length 220
Sequence VVGAAEERGRGRLCGARAVNVRELAVPGAWEITPTLRDDSRGLFFEWFTESGFREFAGHDFSFAQANCSVSMAGVLRGLHFAEVPPSQAKYVTCVRGAVFDVAVDIRTGSPTFGRWDAVRLDDRTRKTIYLSEGLAHGFLALENNSTVMYLCSAPYNPTREHTILATDPALGIAWPGTVGVSLSERDAVAPRLADLQGRGILPTWRDSCDFVEELRTRVR

Samples

Sample ID Description Type Environment
1 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
2 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
46 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
47 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
48 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
51 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
52 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
53 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
54 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
80 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
81 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
115 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
119 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
120 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
121 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
122 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
123 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
124 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
125 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
126 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
127 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
128 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
129 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
130 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
131 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
132 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
133 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
134 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
135 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
136 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
137 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
138 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
139 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
140 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
141 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
142 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
143 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
144 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
145 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
146 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
147 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
148 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
149 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
150 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
151 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
152 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
153 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
154 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
155 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
156 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
157 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
158 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
159 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
160 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
161 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
162 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
163 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
164 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
165 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
166 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
167 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
168 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
169 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
170 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
171 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
172 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
175 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
176 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
178 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
179 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
180 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
181 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
182 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
183 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
184 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
185 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
186 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
187 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
188 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
189 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
190 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
191 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
192 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
193 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
194 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
195 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
196 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
197 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
198 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
199 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
200 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
201 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
202 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
203 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.67
Metatranscriptomes 0
Isolates 2.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 26.53
Nodule 0.29
Rhizoplane 6.41
Rhizosphere 59.18
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075364_10112272 3300006051 Bacteria 1820
2 Ga0055540_1005002 3300003792 Bacteria 5762
3 Ga0070683_100146827 3300005329 Bacteria 2235
4 Ga0068869_100199286 3300005334 Bacteria 1578
5 Ga0070682_100050117 3300005337 Bacteria 2606
6 Ga0068868_100045848 3300005338 Bacteria 3421
7 Ga0068868_100355518 3300005338 Bacteria 1255
8 Ga0068868_100809624 3300005338 Bacteria 846
9 Ga0070668_100030569 3300005347 Bacteria 4095
10 Ga0070668_100073133 3300005347 Bacteria 2672
11 Ga0070669_100132824 3300005353 Bacteria 1912
12 Ga0070671_100013556 3300005355 Bacteria 6572
13 Ga0070671_100076742 3300005355 Bacteria 2792
14 Ga0070671_100290768 3300005355 Bacteria 1391
15 Ga0070674_100235278 3300005356 Bacteria 1432
16 Ga0070688_100052846 3300005365 Bacteria 2540
17 Ga0070659_100261090 3300005366 Bacteria 1437
18 Ga0070667_100013480 3300005367 Bacteria 6755
19 Ga0070667_100032879 3300005367 Bacteria 4329
20 Ga0070667_100164542 3300005367 Bacteria 1956
21 Ga0070709_10010857 3300005434 Bacteria 5057
22 Ga0070714_100048135 3300005435 Bacteria 3625
23 Ga0070710_10027384 3300005437 Bacteria 3038
24 Ga0070701_10094856 3300005438 Bacteria 1642
25 Ga0070711_100025209 3300005439 Bacteria 3887
26 Ga0070705_100188035 3300005440 Bacteria 1405
27 Ga0070700_100248053 3300005441 Bacteria 1276
28 Ga0070694_100238615 3300005444 Bacteria 1370
29 Ga0070663_100024808 3300005455 Bacteria 4040
30 Ga0070678_100422295 3300005456 Bacteria 1162
31 Ga0070662_100072698 3300005457 Bacteria 2540
32 Ga0068867_100122581 3300005459 Bacteria 2010
33 Ga0070685_10102260 3300005466 Bacteria 1752
34 Ga0070679_100919218 3300005530 Bacteria 818
35 Ga0070684_100162933 3300005535 Bacteria 2024
36 Ga0070696_100240738 3300005546 Bacteria 1365
37 Ga0070665_100004155 3300005548 Bacteria 15236
38 Ga0070665_100013708 3300005548 Bacteria 8157
39 Ga0070704_100169984 3300005549 Bacteria 1732
40 Ga0070664_101235668 3300005564 Bacteria 705
41 Ga0068854_100064919 3300005578 Bacteria 2653
42 Ga0068854_100183587 3300005578 Bacteria 1635
43 Ga0070702_100183669 3300005615 Bacteria 1370
44 Ga0068859_100251710 3300005617 Bacteria 1857
45 Ga0068859_100372588 3300005617 Bacteria 1523
46 Ga0068864_100382756 3300005618 Bacteria 1334
47 Ga0068864_100861818 3300005618 Bacteria 893
48 Ga0068866_10041309 3300005718 Bacteria 2287
49 Ga0068861_100106855 3300005719 Bacteria 2236
50 Ga0068861_100113194 3300005719 Bacteria 2177
51 Ga0068870_10053004 3300005840 Bacteria 2153
52 Ga0068863_100013407 3300005841 Bacteria 7903
53 Ga0068860_100070657 3300005843 Bacteria 3319
54 Ga0068860_100125073 3300005843 Bacteria 2464
55 Ga0068860_100532920 3300005843 Bacteria 1175
56 Ga0068862_100176125 3300005844 Bacteria 1917
57 Ga0068862_100584620 3300005844 Bacteria 1070
58 Ga0081455_10027434 3300005937 Bacteria 5218
59 Ga0081539_10083596 3300005985 Bacteria 1671
60 Ga0075365_10024411 3300006038 Bacteria 3814
61 Ga0075365_10051286 3300006038 Bacteria 2724
62 Ga0075365_10054146 3300006038 Bacteria 2660
63 Ga0075365_10301324 3300006038 Bacteria 1128
64 Ga0075368_10026506 3300006042 Bacteria 2230
65 Ga0075368_10120267 3300006042 Bacteria 1087
66 Ga0075363_100013779 3300006048 Bacteria 3933
67 Ga0075363_100025976 3300006048 Bacteria 2993
68 Ga0075363_100030946 3300006048 Bacteria 2772
69 Ga0075363_100053335 3300006048 Bacteria 2160
70 Ga0075363_100066845 3300006048 Bacteria 1946
71 Ga0075364_10000591 3300006051 Bacteria 18727
72 Ga0075364_10002965 3300006051 Bacteria 9584
73 Ga0075364_10005327 3300006051 Bacteria 7465
74 Ga0075364_10034837 3300006051 Bacteria 3251
75 Ga0075364_10045924 3300006051 Bacteria 2843
76 Ga0075364_10076025 3300006051 Bacteria 2216
77 Ga0075364_10245863 3300006051 Bacteria 1216
78 Ga0070716_100028807 3300006173 Bacteria 2995
79 Ga0070712_100084454 3300006175 Bacteria 2308
80 Ga0075362_10002595 3300006177 Bacteria 6111
81 Ga0075362_10003279 3300006177 Bacteria 5624
82 Ga0075362_10059163 3300006177 Bacteria 1730
83 Ga0075362_10068479 3300006177 Bacteria 1617
84 Ga0075367_10008467 3300006178 Bacteria 5330
85 Ga0075367_10142357 3300006178 Bacteria 1486
86 Ga0075369_10007550 3300006186 Bacteria 4150
87 Ga0075369_10011502 3300006186 Bacteria 3483
88 Ga0075369_10057826 3300006186 Bacteria 1687
89 Ga0075369_10074787 3300006186 Bacteria 1495
90 Ga0075369_10115936 3300006186 Bacteria 1210
91 Ga0075369_10141548 3300006186 Bacteria 1097
92 Ga0075369_10161783 3300006186 Bacteria 1026
93 Ga0075369_10193410 3300006186 Bacteria 938
94 Ga0075369_10197059 3300006186 Bacteria 929
95 Ga0075366_10153141 3300006195 Bacteria 1396
96 Ga0075370_10001625 3300006353 Bacteria 9907
97 Ga0075370_10002570 3300006353 Bacteria 8451
98 Ga0075370_10020090 3300006353 Bacteria 3646
99 Ga0075370_10041723 3300006353 Bacteria 2591
100 Ga0075370_10246400 3300006353 Bacteria 1058
101 Ga0075370_10311912 3300006353 Bacteria 936
102 Ga0068871_100221122 3300006358 Bacteria 1641
103 Ga0075431_100011747 3300006847 Bacteria 8836
104 Ga0075429_100545835 3300006880 Bacteria 1016
105 Ga0068865_100058300 3300006881 Bacteria 2696
106 Ga0068865_100102718 3300006881 Bacteria 2095
107 Ga0097620_100251690 3300006931 Bacteria 1857
108 Ga0097620_100372591 3300006931 Bacteria 1523
109 Ga0105245_10096732 3300009098 Bacteria 2725
110 Ga0105245_10309249 3300009098 Bacteria 1553
111 Ga0105247_10121954 3300009101 Bacteria 1690
112 Ga0114129_10033593 3300009147 Bacteria 7248
113 Ga0114129_10581863 3300009147 Bacteria 1453
114 Ga0105243_10394833 3300009148 Bacteria 1283
115 Ga0105242_10091993 3300009176 Bacteria 2555
116 Ga0105248_10366374 3300009177 Bacteria 1622
117 Ga0105237_10248316 3300009545 Bacteria 1781
118 Ga0105237_10984829 3300009545 Bacteria 850
119 Ga0105249_10035230 3300009553 Bacteria 4538
120 Ga0105249_10109725 3300009553 Bacteria 2606
121 Ga0105239_10176279 3300010375 Bacteria 2391
122 Ga0105246_10069354 3300011119 Bacteria 2476
123 Ga0157369_10065992 3300013105 Bacteria 3894
124 Ga0157374_10002636 3300013296 Bacteria 15116
125 Ga0157378_10094962 3300013297 Bacteria 2715
126 Ga0163162_10033801 3300013306 Bacteria 5083
127 Ga0163162_10550152 3300013306 Bacteria 1282
128 Ga0163162_10650670 3300013306 Bacteria 1178
129 Ga0163162_10754662 3300013306 Bacteria 1092
130 Ga0157372_10039875 3300013307 Bacteria 5185
131 Ga0157372_10680502 3300013307 Bacteria 1197
132 Ga0157375_10194080 3300013308 Bacteria 2186
133 Ga0157375_10573922 3300013308 Bacteria 1288
134 Ga0163163_10087771 3300014325 Bacteria 3121
135 Ga0157376_10629404 3300014969 Bacteria 1071
136 Ga0157376_10756722 3300014969 Bacteria 981
137 Ga0163161_10108184 3300017792 Bacteria 2076
138 Ga0213876_10089505 3300021384 Bacteria 1630
139 Ga0213875_10003455 3300021388 Bacteria 8997
140 Ga0213875_10029965 3300021388 Bacteria 2579
141 Ga0209673_1021149 3300025273 Bacteria 2284
142 Ga0209051_1001135 3300025303 Bacteria 24362
143 Ga0209051_1006297 3300025303 Bacteria 6724
144 Ga0209051_1044432 3300025303 Bacteria 1547
145 Ga0207692_10066975 3300025898 Bacteria 1878
146 Ga0207642_10112438 3300025899 Bacteria 1389
147 Ga0207710_10085793 3300025900 Bacteria 1467
148 Ga0207688_10016095 3300025901 Bacteria 4055
149 Ga0207647_10070641 3300025904 Bacteria 2108
150 Ga0207693_10003009 3300025915 Bacteria 14576
151 Ga0207663_10068107 3300025916 Bacteria 2285
152 Ga0207652_10818706 3300025921 Bacteria 826
153 Ga0207659_10495809 3300025926 Bacteria 1033
154 Ga0207687_10043164 3300025927 Bacteria 3106
155 Ga0207687_10283672 3300025927 Bacteria 1328
156 Ga0207644_10001838 3300025931 Bacteria 13801
157 Ga0207690_10190384 3300025932 Bacteria 1551
158 Ga0207706_10059976 3300025933 Bacteria 3351
159 Ga0207686_10096097 3300025934 Bacteria 1967
160 Ga0207669_10165837 3300025937 Bacteria 1566
161 Ga0207704_10079720 3300025938 Bacteria 2111
162 Ga0207665_10001542 3300025939 Bacteria 15494
163 Ga0207711_10278285 3300025941 Bacteria 1541
164 Ga0207712_10486430 3300025961 Bacteria 1053
165 Ga0207668_10001508 3300025972 Bacteria 13600
166 Ga0207640_10301514 3300025981 Bacteria 1268
167 Ga0207640_10472714 3300025981 Bacteria 1038
168 Ga0207658_10041355 3300025986 Bacteria 3337
169 Ga0207658_10086276 3300025986 Bacteria 2420
170 Ga0207677_10037231 3300026023 Bacteria 3178
171 Ga0207677_10097626 3300026023 Bacteria 2153
172 Ga0207677_10389945 3300026023 Bacteria 1178
173 Ga0207703_10011948 3300026035 Bacteria 6764
174 Ga0207639_10910753 3300026041 Bacteria 822
175 Ga0207708_10074548 3300026075 Bacteria 2601
176 Ga0207641_10006236 3300026088 Bacteria 10086
177 Ga0207641_10066853 3300026088 Bacteria 3078
178 Ga0207648_10137079 3300026089 Bacteria 2156
179 Ga0207676_11199382 3300026095 Bacteria 752
180 Ga0207675_100046599 3300026118 Bacteria 4050
181 Ga0207675_100100945 3300026118 Bacteria 2718
182 Ga0207683_10016601 3300026121 Bacteria 6266
183 Ga0207683_10607781 3300026121 Bacteria 1012
184 Ga0209813_10012200 3300027866 Bacteria 2264
185 Ga0209813_10120537 3300027866 Bacteria 912
186 Ga0268266_10016193 3300028379 Bacteria 6376
187 Ga0268266_10112209 3300028379 Bacteria 2416
188 Ga0268265_10177199 3300028380 Bacteria 1828
189 Ga0268265_10193900 3300028380 Bacteria 1757
190 Ga0268264_10241089 3300028381 Bacteria 1675
191 Ga0268264_10984467 3300028381 Bacteria 849
192 Ga0307408_100618698 3300031548 Bacteria 964
193 Ga0316578_10022903 3300031728 Bacteria 3490
194 Ga0307413_10236340 3300031824 Bacteria 1346
195 Ga0307413_10660864 3300031824 Bacteria 863
196 Ga0307410_10066246 3300031852 Bacteria 2487
197 Ga0307407_10397782 3300031903 Bacteria 987
198 Ga0307416_100223457 3300032002 Bacteria 1808
199 Ga0307411_10035175 3300032005 Bacteria 3125
200 Ga0307415_100161881 3300032126 Bacteria 1735
201 Ga0373931_0034142 3300035691 Bacteria 2639
202 Ga0316584_0052634 3300036712 Bacteria 3045
203 Ga0436364_0121134 3300037853 Bacteria 9818
204 Ga0436364_0219236 3300037853 Bacteria 901
205 Ga0436364_1511774 3300037853 Bacteria 37433
206 Ga0436365_0187067 3300039437 Bacteria 3622
207 Ga0436365_0484364 3300039437 Bacteria 53953
208 Ga0436365_1412017 3300039437 Bacteria 2110
209 Ga0436365_1584184 3300039437 Bacteria 7271
210 Ga0436363_1473318 3300039450 Bacteria 1635
211 Ga0439461_0000555 3300041410 Bacteria 5418
212 Ga0439466_0005080 3300041411 Bacteria 5046
213 Ga0439466_0008577 3300041411 Bacteria 3851
214 Ga0439466_0092726 3300041411 Bacteria 946
215 Ga0439465_0005389 3300041413 Bacteria 4080
216 Ga0439465_0007629 3300041413 Bacteria 3432
217 Ga0439465_0025125 3300041413 Bacteria 1879
218 Ga0451791_0412458 3300041451 Bacteria 961
219 Ga0451797_1186175 3300041453 Bacteria 1082
220 Ga0451841_0930097 3300041498 Bacteria 1027
221 Ga0451853_2802165 3300041512 Bacteria 683
222 Ga0439431_0005933 3300041997 Bacteria 2697
223 Ga0439431_0146459 3300041997 Bacteria 669
224 Ga0439442_094788 3300042002 Bacteria 643
225 Ga0439445_0012056 3300042004 Bacteria 2070
226 Ga0439445_0015283 3300042004 Bacteria 1878
227 Ga0439434_0007403 3300042435 Bacteria 3217
228 Ga0439434_0030198 3300042435 Bacteria 1645
229 Ga0466965_0152737 3300044683 Bacteria 1207
230 Ga0466965_0293946 3300044683 Bacteria 880
231 Ga0466966_0001197 3300044684 Bacteria 16665
232 Ga0466966_0052056 3300044684 Bacteria 2602
233 Ga0466966_0857232 3300044684 Bacteria 548
234 Ga0466961_0002647 3300044693 Bacteria 11114
235 Ga0466961_0021027 3300044693 Bacteria 4199
236 Ga0466961_0086008 3300044693 Bacteria 1988
237 Ga0466963_0032872 3300044694 Bacteria 3363
238 Ga0466963_0120378 3300044694 Bacteria 1806
239 Ga0466971_0133291 3300044719 Bacteria 1154
240 Ga0466968_0032849 3300044735 Bacteria 2160
241 Ga0466957_0006906 3300044842 Bacteria 6416
242 Ga0466957_0008207 3300044842 Bacteria 5930
243 Ga0466957_0083495 3300044842 Bacteria 1993
244 Ga0466959_0008310 3300045049 Bacteria 7331
245 Ga0466959_0120841 3300045049 Bacteria 1862
246 Ga0466958_0113604 3300045836 Bacteria 1691
247 Ga0466958_0160142 3300045836 Bacteria 1422
248 Ga0466967_0142698 3300045976 Bacteria 2232
249 Ga0495671_0268421 3300046692 Bacteria 823
250 Ga0495686_0000579 3300047472 Bacteria 51834
251 Ga0496100_0064982 3300048903 Bacteria 2416
252 Ga0496101_0254724 3300048904 Bacteria 1368
253 Ga0496101_0324867 3300048904 Bacteria 1207
254 Ga0496102_0011742 3300048905 Bacteria 7559
255 Ga0496102_0115254 3300048905 Bacteria 2507
256 Ga0496102_0203441 3300048905 Bacteria 1866
257 Ga0496102_0232699 3300048905 Bacteria 1737
258 Ga0496103_0070431 3300048906 Bacteria 2188
259 Ga0496103_0162740 3300048906 Bacteria 1431
260 Ga0496103_0222780 3300048906 Bacteria 1213
261 Ga0496104_0651479 3300048907 Bacteria 962
262 Ga0496104_0708036 3300048907 Bacteria 915
263 Ga0496107_0650556 3300048910 Bacteria 777
264 Ga0496108_0000189 3300048911 Bacteria 57428
265 Ga0496109_0004189 3300048912 Bacteria 12033
266 Ga0496109_0318569 3300048912 Bacteria 1467
267 Ga0496111_0001237 3300048914 Bacteria 14284
268 Ga0496111_0314022 3300048914 Bacteria 1161
269 Ga0496112_0004720 3300048915 Bacteria 11613
270 Ga0496113_0034330 3300048916 Bacteria 3701
271 Ga0496117_0261666 3300048920 Bacteria 937
272 Ga0496118_0038245 3300048921 Bacteria 3849
273 Ga0496122_0035353 3300048925 Bacteria 4067
274 Ga0496123_0000142 3300048926 Bacteria 146932
275 Ga0496124_0000420 3300048927 Bacteria 75761
276 Ga0496125_0000857 3300048928 Bacteria 48805
277 Ga0496126_0002802 3300048929 Bacteria 22925
278 Ga0496126_0030128 3300048929 Bacteria 5146
279 Ga0501047_0038323 3300049581 Bacteria 4638
280 Ga0501047_0063011 3300049581 Bacteria 3577
281 Ga0501047_0475126 3300049581 Bacteria 1078
282 Ga0501048_0564388 3300049582 Bacteria 817
283 Ga0501072_0381749 3300049588 Bacteria 1118
284 Ga0501080_0065592 3300049742 Bacteria 3377
285 Ga0501035_0006472 3300049822 Bacteria 11004
286 Ga0501035_0327342 3300049822 Bacteria 1286
287 Ga0501044_0000425 3300049823 Bacteria 52201
288 Ga0501044_0170965 3300049823 Bacteria 2145
289 nmdc:mga03683_66285_c1 3300050489 Bacteria 1535
290 nmdc:mga03683_83908_c1 3300050489 Bacteria 1380
291 nmdc:mga03n38_152358_c1 3300050490 Bacteria 1164
292 nmdc:mga03n38_2055_c1 3300050490 Bacteria 6075
293 nmdc:mga03n38_254302_c1 3300050490 Bacteria 929
294 nmdc:mga03n38_25719_c1 3300050490 Bacteria 2422
295 nmdc:mga03n38_3813_c1 3300050490 Bacteria 4900
296 nmdc:mga00v17_211638_c1 3300050491 Bacteria 1254
297 nmdc:mga00v17_22850_c1 3300050491 Bacteria 3613
298 nmdc:mga00v17_24083_c1 3300050491 Bacteria 3527
299 nmdc:mga00v17_4868_c1 3300050491 Bacteria 7037
300 nmdc:mga00v17_58998_c1 3300050491 Bacteria 2353
301 nmdc:mga00v17_62671_c1 3300050491 Bacteria 2288
302 nmdc:mga00v17_7505_c1 3300050491 Bacteria 5822
303 nmdc:mga0yw44_139901_c1 3300050492 Bacteria 1572
304 nmdc:mga0yw44_21535_c1 3300050492 Bacteria 3598
305 nmdc:mga0yw44_312578_c1 3300050492 Bacteria 1054
306 nmdc:mga0yw44_64237_c1 3300050492 Bacteria 2258
307 nmdc:mga0yw44_71194_c1 3300050492 Bacteria 2158
308 nmdc:mga0k408_122443_c1 3300050493 Bacteria 1541
309 nmdc:mga0k408_33111_c1 3300050493 Bacteria 2954
310 nmdc:mga06z11_102409_c1 3300050494 Bacteria 1573
311 nmdc:mga06z11_15096_c1 3300050494 Bacteria 3439
312 nmdc:mga04h51_2189_c2 3300050495 Bacteria 2348
313 nmdc:mga04h51_87744_c1 3300050495 Bacteria 1114
314 nmdc:mga07m45_12410_c2 3300050496 Bacteria 2762
315 nmdc:mga07m45_12820_c1 3300050496 Bacteria 4435
316 nmdc:mga07m45_134174_c1 3300050496 Bacteria 1433
317 nmdc:mga07m45_171624_c1 3300050496 Bacteria 1260
318 nmdc:mga07m45_23722_c1 3300050496 Bacteria 3356
319 nmdc:mga07m45_499524_c1 3300050496 Bacteria 704
320 nmdc:mga05p37_1478997_c1 3300050507 Bacteria 678
321 nmdc:mga05p37_60225_c1 3300050507 Bacteria 4675
322 nmdc:mga06r32_12134_c1 3300050510 Bacteria 7772
323 nmdc:mga0sz30_1356_c1 3300050516 Bacteria 8744
324 nmdc:mga0sz30_187511_c1 3300050516 Bacteria 918
325 nmdc:mga0sz30_203014_c1 3300050516 Bacteria 880
326 nmdc:mga0sz30_55413_c1 3300050516 Bacteria 1687
327 nmdc:mga0sz30_59193_c1 3300050516 Bacteria 1634
328 nmdc:mga0sz30_9657_c1 3300050516 Bacteria 3677
329 Ga0500610_0027778 3300053079 Bacteria 2845
330 Ga0500635_0256476 3300053080 Bacteria 686
331 Ga0500556_0075823 3300053104 Bacteria 1263
332 Ga0500642_0229177 3300053130 Bacteria 859
333 Ga0500652_000895 3300053131 Bacteria 9819
334 Ga0500616_0005594 3300053153 Bacteria 8487
335 Ga0466962_0046998 3300061719 Bacteria 2062
336 2644490045 2643221687 Bacteria 6500351
337 2644634405 2643221715 Bacteria 6671032
338 2832007932 2832004796 Bacteria 6538017
339 2837269313 2837268691 Bacteria 7850704
340 2842136812 2842134933 Bacteria 5847019
341 2902813665 2902810491 Bacteria 6794147
342 2902841677 2902837492 Bacteria 6697721
343 2939589079 2939582691 Bacteria 7088898
344 Ga0075364_10112272
345 Ga0055540_1005002
346 Ga0070683_100146827
347 Ga0068869_100199286
348 Ga0070682_100050117
349 Ga0068868_100045848
350 Ga0068868_100355518
351 Ga0068868_100809624
352 Ga0070668_100030569
353 Ga0070668_100073133
354 Ga0070669_100132824
355 Ga0070671_100013556
356 Ga0070671_100076742
357 Ga0070671_100290768
358 Ga0070674_100235278
359 Ga0070688_100052846
360 Ga0070659_100261090
361 Ga0070667_100013480
362 Ga0070667_100032879
363 Ga0070667_100164542
364 Ga0070709_10010857
365 Ga0070714_100048135
366 Ga0070710_10027384
367 Ga0070701_10094856
368 Ga0070711_100025209
369 Ga0070705_100188035
370 Ga0070700_100248053
371 Ga0070694_100238615
372 Ga0070663_100024808
373 Ga0070678_100422295
374 Ga0070662_100072698
375 Ga0068867_100122581
376 Ga0070685_10102260
377 Ga0070679_100919218
378 Ga0070684_100162933
379 Ga0070696_100240738
380 Ga0070665_100004155
381 Ga0070665_100013708
382 Ga0070704_100169984
383 Ga0070664_101235668
384 Ga0068854_100064919
385 Ga0068854_100183587
386 Ga0070702_100183669
387 Ga0068859_100251710
388 Ga0068859_100372588
389 Ga0068864_100382756
390 Ga0068864_100861818
391 Ga0068866_10041309
392 Ga0068861_100106855
393 Ga0068861_100113194
394 Ga0068870_10053004
395 Ga0068863_100013407
396 Ga0068860_100070657
397 Ga0068860_100125073
398 Ga0068860_100532920
399 Ga0068862_100176125
400 Ga0068862_100584620
401 Ga0081455_10027434
402 Ga0081539_10083596
403 Ga0075365_10024411
404 Ga0075365_10051286
405 Ga0075365_10054146
406 Ga0075365_10301324
407 Ga0075368_10026506
408 Ga0075368_10120267
409 Ga0075363_100013779
410 Ga0075363_100025976
411 Ga0075363_100030946
412 Ga0075363_100053335
413 Ga0075363_100066845
414 Ga0075364_10000591
415 Ga0075364_10002965
416 Ga0075364_10005327
417 Ga0075364_10034837
418 Ga0075364_10045924
419 Ga0075364_10076025
420 Ga0075364_10245863
421 Ga0070716_100028807
422 Ga0070712_100084454
423 Ga0075362_10002595
424 Ga0075362_10003279
425 Ga0075362_10059163
426 Ga0075362_10068479
427 Ga0075367_10008467
428 Ga0075367_10142357
429 Ga0075369_10007550
430 Ga0075369_10011502
431 Ga0075369_10057826
432 Ga0075369_10074787
433 Ga0075369_10115936
434 Ga0075369_10141548
435 Ga0075369_10161783
436 Ga0075369_10193410
437 Ga0075369_10197059
438 Ga0075366_10153141
439 Ga0075370_10001625
440 Ga0075370_10002570
441 Ga0075370_10020090
442 Ga0075370_10041723
443 Ga0075370_10246400
444 Ga0075370_10311912
445 Ga0068871_100221122
446 Ga0075431_100011747
447 Ga0075429_100545835
448 Ga0068865_100058300
449 Ga0068865_100102718
450 Ga0097620_100251690
451 Ga0097620_100372591
452 Ga0105245_10096732
453 Ga0105245_10309249
454 Ga0105247_10121954
455 Ga0114129_10033593
456 Ga0114129_10581863
457 Ga0105243_10394833
458 Ga0105242_10091993
459 Ga0105248_10366374
460 Ga0105237_10248316
461 Ga0105237_10984829
462 Ga0105249_10035230
463 Ga0105249_10109725
464 Ga0105239_10176279
465 Ga0105246_10069354
466 Ga0157369_10065992
467 Ga0157374_10002636
468 Ga0157378_10094962
469 Ga0163162_10033801
470 Ga0163162_10550152
471 Ga0163162_10650670
472 Ga0163162_10754662
473 Ga0157372_10039875
474 Ga0157372_10680502
475 Ga0157375_10194080
476 Ga0157375_10573922
477 Ga0163163_10087771
478 Ga0157376_10629404
479 Ga0157376_10756722
480 Ga0163161_10108184
481 Ga0213876_10089505
482 Ga0213875_10003455
483 Ga0213875_10029965
484 Ga0209673_1021149
485 Ga0209051_1001135
486 Ga0209051_1006297
487 Ga0209051_1044432
488 Ga0207692_10066975
489 Ga0207642_10112438
490 Ga0207710_10085793
491 Ga0207688_10016095
492 Ga0207647_10070641
493 Ga0207693_10003009
494 Ga0207663_10068107
495 Ga0207652_10818706
496 Ga0207659_10495809
497 Ga0207687_10043164
498 Ga0207687_10283672
499 Ga0207644_10001838
500 Ga0207690_10190384
501 Ga0207706_10059976
502 Ga0207686_10096097
503 Ga0207669_10165837
504 Ga0207704_10079720
505 Ga0207665_10001542
506 Ga0207711_10278285
507 Ga0207712_10486430
508 Ga0207668_10001508
509 Ga0207640_10301514
510 Ga0207640_10472714
511 Ga0207658_10041355
512 Ga0207658_10086276
513 Ga0207677_10037231
514 Ga0207677_10097626
515 Ga0207677_10389945
516 Ga0207703_10011948
517 Ga0207639_10910753
518 Ga0207708_10074548
519 Ga0207641_10006236
520 Ga0207641_10066853
521 Ga0207648_10137079
522 Ga0207676_11199382
523 Ga0207675_100046599
524 Ga0207675_100100945
525 Ga0207683_10016601
526 Ga0207683_10607781
527 Ga0209813_10012200
528 Ga0209813_10120537
529 Ga0268266_10016193
530 Ga0268266_10112209
531 Ga0268265_10177199
532 Ga0268265_10193900
533 Ga0268264_10241089
534 Ga0268264_10984467
535 Ga0307408_100618698
536 Ga0316578_10022903
537 Ga0307413_10236340
538 Ga0307413_10660864
539 Ga0307410_10066246
540 Ga0307407_10397782
541 Ga0307416_100223457
542 Ga0307411_10035175
543 Ga0307415_100161881
544 Ga0373931_0034142
545 Ga0316584_0052634
546 Ga0436364_0121134
547 Ga0436364_0219236
548 Ga0436364_1511774
549 Ga0436365_0187067
550 Ga0436365_0484364
551 Ga0436365_1412017
552 Ga0436365_1584184
553 Ga0436363_1473318
554 Ga0439461_0000555
555 Ga0439466_0005080
556 Ga0439466_0008577
557 Ga0439466_0092726
558 Ga0439465_0005389
559 Ga0439465_0007629
560 Ga0439465_0025125
561 Ga0451791_0412458
562 Ga0451797_1186175
563 Ga0451841_0930097
564 Ga0451853_2802165
565 Ga0439431_0005933
566 Ga0439431_0146459
567 Ga0439442_094788
568 Ga0439445_0012056
569 Ga0439445_0015283
570 Ga0439434_0007403
571 Ga0439434_0030198
572 Ga0466965_0152737
573 Ga0466965_0293946
574 Ga0466966_0001197
575 Ga0466966_0052056
576 Ga0466966_0857232
577 Ga0466961_0002647
578 Ga0466961_0021027
579 Ga0466961_0086008
580 Ga0466963_0032872
581 Ga0466963_0120378
582 Ga0466971_0133291
583 Ga0466968_0032849
584 Ga0466957_0006906
585 Ga0466957_0008207
586 Ga0466957_0083495
587 Ga0466959_0008310
588 Ga0466959_0120841
589 Ga0466958_0113604
590 Ga0466958_0160142
591 Ga0466967_0142698
592 Ga0495671_0268421
593 Ga0495686_0000579
594 Ga0496100_0064982
595 Ga0496101_0254724
596 Ga0496101_0324867
597 Ga0496102_0011742
598 Ga0496102_0115254
599 Ga0496102_0203441
600 Ga0496102_0232699
601 Ga0496103_0070431
602 Ga0496103_0162740
603 Ga0496103_0222780
604 Ga0496104_0651479
605 Ga0496104_0708036
606 Ga0496107_0650556
607 Ga0496108_0000189
608 Ga0496109_0004189
609 Ga0496109_0318569
610 Ga0496111_0001237
611 Ga0496111_0314022
612 Ga0496112_0004720
613 Ga0496113_0034330
614 Ga0496117_0261666
615 Ga0496118_0038245
616 Ga0496122_0035353
617 Ga0496123_0000142
618 Ga0496124_0000420
619 Ga0496125_0000857
620 Ga0496126_0002802
621 Ga0496126_0030128
622 Ga0501047_0038323
623 Ga0501047_0063011
624 Ga0501047_0475126
625 Ga0501048_0564388
626 Ga0501072_0381749
627 Ga0501080_0065592
628 Ga0501035_0006472
629 Ga0501035_0327342
630 Ga0501044_0000425
631 Ga0501044_0170965
632 nmdc:mga03683_66285_c1
633 nmdc:mga03683_83908_c1
634 nmdc:mga03n38_152358_c1
635 nmdc:mga03n38_2055_c1
636 nmdc:mga03n38_254302_c1
637 nmdc:mga03n38_25719_c1
638 nmdc:mga03n38_3813_c1
639 nmdc:mga00v17_211638_c1
640 nmdc:mga00v17_22850_c1
641 nmdc:mga00v17_24083_c1
642 nmdc:mga00v17_4868_c1
643 nmdc:mga00v17_58998_c1
644 nmdc:mga00v17_62671_c1
645 nmdc:mga00v17_7505_c1
646 nmdc:mga0yw44_139901_c1
647 nmdc:mga0yw44_21535_c1
648 nmdc:mga0yw44_312578_c1
649 nmdc:mga0yw44_64237_c1
650 nmdc:mga0yw44_71194_c1
651 nmdc:mga0k408_122443_c1
652 nmdc:mga0k408_33111_c1
653 nmdc:mga06z11_102409_c1
654 nmdc:mga06z11_15096_c1
655 nmdc:mga04h51_2189_c2
656 nmdc:mga04h51_87744_c1
657 nmdc:mga07m45_12410_c2
658 nmdc:mga07m45_12820_c1
659 nmdc:mga07m45_134174_c1
660 nmdc:mga07m45_171624_c1
661 nmdc:mga07m45_23722_c1
662 nmdc:mga07m45_499524_c1
663 nmdc:mga05p37_1478997_c1
664 nmdc:mga05p37_60225_c1
665 nmdc:mga06r32_12134_c1
666 nmdc:mga0sz30_1356_c1
667 nmdc:mga0sz30_187511_c1
668 nmdc:mga0sz30_203014_c1
669 nmdc:mga0sz30_55413_c1
670 nmdc:mga0sz30_59193_c1
671 nmdc:mga0sz30_9657_c1
672 Ga0500610_0027778
673 Ga0500635_0256476
674 Ga0500556_0075823
675 Ga0500642_0229177
676 Ga0500652_000895
677 Ga0500616_0005594
678 Ga0466962_0046998
679 2644490045
680 2644634405
681 2832007932
682 2837269313
683 2842136812
684 2902813665
685 2902841677
686 2939589079

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00908

dTDP_sugar_isom

dTDP-4-dehydrorhamnose 3,5-epimerase

23

195

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1upi-assembly1.cif.gz_A mycobacterium tuberculosis rmlc epimerase (rv3465) 0.9876 1 197
1upi-assembly1.cif.gz_A mycobacterium tuberculosis rmlc epimerase (rv3465) 0.9729 1 197
2c0z-assembly1.cif.gz_A-2 the 1.6 a resolution crystal structure of novw: a 4-keto-6-deoxy sugar epimerase from the novobiocin biosynthetic gene cluster of streptomyces spheroides 0.9689 2 190
7pwh-assembly1.cif.gz_AAA structure of the dtdp-sugar epimerase strm 0.9559 2 199
4hn0-assembly1.cif.gz_B crystal structure of chmj, a 3'-monoepimerase apoenzyme from streptomyces bikiniensis 0.9494 5 198
ID Description Score Start End Superfamily
2ixcB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9833 1 195 2.60.120.10
2c0zA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9691 1 190 2.60.120.10
2ixcB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9638 1 195 2.60.120.10
2c0zA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9591 1 190 2.60.120.10
5buvB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9479 2 174 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A655JSX2-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) 0.997 48 198 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A1A3KCL6-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9857 1 172 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A1E5MJ77-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase 0.9793 40 199 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A0U1D272-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase 0.9776 1 198 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A839Q2K2-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) 0.9771 1 198 GO:0005829
GO:0008830
GO:0019305
GO:0045226

Map