F415475

General Info

Members Datasets Scaffolds Average Seq Length
343 179 686 231

Family's Representative Sequence

Representative Sequence 3300005459|Ga0068867_100229510|Ga0068867_1002295101
Length 267
Sequence MKFTSCYFKCSRIQYPIPIATVPSGWQFGTNIQSSMISIKEIKDSLLHLWFPHTCAGCGSDVLNEQSSICMHCLSDLPDTGFHLRGENPVEKIFWGRLPLYSATAGYYFTKESLIQQLIHQFKYKGDKVLGLQLGRLLGKYLMQSGRFNADALVPLPLFPAKERKRGYNQATVLCEGISEIMQLPVWDNVVTRPQPTATQTKKGRVERWNNVEGKFLLQNETVLNDKHVILVDDVITTGATLEACGSALLKAHNVKLSMATLCIASY

Samples

Sample ID Description Type Environment
1 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
133 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
134 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
135 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
136 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
137 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
138 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
139 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
140 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
141 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
142 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
143 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
144 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
145 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
146 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
147 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
148 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
158 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
159 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
160 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
161 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
162 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
163 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
164 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
165 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
166 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
167 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
168 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
169 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
172 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
173 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
174 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
175 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
176 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
177 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
178 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
179 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.62
Nodule 0
Rhizoplane 1.46
Rhizosphere 94.46
Stem 0
Stem Tuber 0
Unclassified 14.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068867_100229510 3300005459 Unclassified 1500
2 rootH1_10086211 3300003316 Bacteria 2639
3 rootH2_10098856 3300003320 Bacteria 2241
4 rootL2_10294975 3300003322 Bacteria 1965
5 rootH1_10049086 3300003323 Bacteria 4781
6 rootH1_10157602 3300003323 Bacteria 1366
7 Ga0065712_10152974 3300005290 Unclassified 1355
8 Ga0065712_10290527 3300005290 Bacteria 878
9 Ga0070658_10096810 3300005327 Bacteria 2437
10 Ga0070676_10107024 3300005328 Bacteria 1736
11 Ga0070683_100038996 3300005329 Bacteria 4358
12 Ga0070683_100071415 3300005329 Bacteria 3239
13 Ga0070683_100584466 3300005329 Bacteria 1068
14 Ga0070690_100004530 3300005330 Bacteria 7724
15 Ga0070690_100020147 3300005330 Bacteria 4060
16 Ga0070690_100182420 3300005330 Bacteria 1451
17 Ga0070670_100015447 3300005331 Bacteria 6558
18 Ga0070670_100034643 3300005331 Bacteria 4344
19 Ga0070670_100102875 3300005331 Bacteria 2460
20 Ga0070670_100178871 3300005331 Bacteria 1841
21 Ga0070670_100614759 3300005331 Bacteria 973
22 Ga0070677_10012967 3300005333 Bacteria 2905
23 Ga0068869_100030794 3300005334 Bacteria 3770
24 Ga0070666_10014034 3300005335 Bacteria 5094
25 Ga0070666_10079926 3300005335 Bacteria 2233
26 Ga0070680_100109652 3300005336 Unclassified 2297
27 Ga0070682_100126368 3300005337 Unclassified 1724
28 Ga0068868_100020047 3300005338 Bacteria 5017
29 Ga0068868_100284099 3300005338 Bacteria 1401
30 Ga0068868_100679359 3300005338 Unclassified 919
31 Ga0070689_100218206 3300005340 Unclassified 1564
32 Ga0070687_100202046 3300005343 Bacteria 1205
33 Ga0070668_100019872 3300005347 Bacteria 5061
34 Ga0070669_100033740 3300005353 Bacteria 3703
35 Ga0070669_100128053 3300005353 Bacteria 1945
36 Ga0070669_100147376 3300005353 Unclassified 1819
37 Ga0070669_100168931 3300005353 Bacteria 1704
38 Ga0070675_100006148 3300005354 Bacteria 9201
39 Ga0070675_100036341 3300005354 Bacteria 4008
40 Ga0070675_100238549 3300005354 Bacteria 1588
41 Ga0070671_100082734 3300005355 Bacteria 2684
42 Ga0070671_100104053 3300005355 Bacteria 2382
43 Ga0070671_100105934 3300005355 Bacteria 2360
44 Ga0070673_100008010 3300005364 Bacteria 6999
45 Ga0070673_100064794 3300005364 Bacteria 2912
46 Ga0070673_100164412 3300005364 Bacteria 1889
47 Ga0070688_100069228 3300005365 Bacteria 2252
48 Ga0070667_100027498 3300005367 Bacteria 4733
49 Ga0070667_100056338 3300005367 Bacteria 3321
50 Ga0070667_100196320 3300005367 Bacteria 1789
51 Ga0070678_100043510 3300005456 Bacteria 3199
52 Ga0070678_100045381 3300005456 Bacteria 3144
53 Ga0070662_100025386 3300005457 Bacteria 4091
54 Ga0070662_100113084 3300005457 Bacteria 2071
55 Ga0070681_10382405 3300005458 Bacteria 1318
56 Ga0068867_100482866 3300005459 Unclassified 1062
57 Ga0068867_100604551 3300005459 Bacteria 957
58 Ga0070685_10337766 3300005466 Bacteria 1026
59 Ga0070679_100015029 3300005530 Bacteria 7439
60 Ga0070684_100066352 3300005535 Bacteria 3168
61 Ga0068853_100032215 3300005539 Bacteria 4439
62 Ga0068853_100194625 3300005539 Bacteria 1843
63 Ga0068853_100333062 3300005539 Bacteria 1409
64 Ga0068853_100379210 3300005539 Bacteria 1320
65 Ga0068853_100466564 3300005539 Bacteria 1189
66 Ga0070672_100101272 3300005543 Bacteria 2337
67 Ga0070672_100242528 3300005543 Unclassified 1516
68 Ga0070686_100050085 3300005544 Bacteria 2653
69 Ga0070665_100005261 3300005548 Bacteria 13375
70 Ga0070704_100550498 3300005549 Bacteria 1008
71 Ga0068855_100111231 3300005563 Bacteria 3144
72 Ga0068855_100249937 3300005563 Bacteria 1978
73 Ga0070664_100102265 3300005564 Bacteria 2493
74 Ga0070664_100389579 3300005564 Unclassified 1273
75 Ga0068857_100646320 3300005577 Bacteria 1002
76 Ga0068854_100016438 3300005578 Bacteria 4933
77 Ga0068854_100056174 3300005578 Bacteria 2837
78 Ga0068854_100314592 3300005578 Bacteria 1271
79 Ga0068856_100054948 3300005614 Bacteria 3929
80 Ga0070702_100059518 3300005615 Bacteria 2217
81 Ga0068852_100006440 3300005616 Bacteria 8484
82 Ga0068852_100024242 3300005616 Bacteria 4900
83 Ga0068852_100173813 3300005616 Bacteria 2021
84 Ga0068852_100421761 3300005616 Bacteria 1316
85 Ga0068859_100006972 3300005617 Bacteria 11470
86 Ga0068859_100025663 3300005617 Bacteria 5911
87 Ga0068859_100037336 3300005617 Bacteria 4875
88 Ga0068859_100072322 3300005617 Bacteria 3485
89 Ga0068859_100133608 3300005617 Bacteria 2553
90 Ga0068859_100229292 3300005617 Unclassified 1945
91 Ga0068864_100015422 3300005618 Bacteria 6353
92 Ga0068864_100042887 3300005618 Bacteria 3872
93 Ga0068864_100284669 3300005618 Unclassified 1544
94 Ga0068864_100937091 3300005618 Bacteria 856
95 Ga0068866_10026660 3300005718 Bacteria 2732
96 Ga0068866_10210865 3300005718 Bacteria 1166
97 Ga0068861_100010649 3300005719 Bacteria 6386
98 Ga0068851_10042823 3300005834 Bacteria 2280
99 Ga0068870_10015524 3300005840 Bacteria 3615
100 Ga0068870_10022139 3300005840 Bacteria 3120
101 Ga0068870_10050804 3300005840 Bacteria 2192
102 Ga0068863_100811278 3300005841 Bacteria 933
103 Ga0068858_100078630 3300005842 Bacteria 3065
104 Ga0068860_100001891 3300005843 Bacteria 22247
105 Ga0068860_100070161 3300005843 Bacteria 3331
106 Ga0068862_100003639 3300005844 Bacteria 13186
107 Ga0068862_100224450 3300005844 Bacteria 1702
108 Ga0081539_10005521 3300005985 Bacteria 12829
109 Ga0075366_10001753 3300006195 Bacteria 10923
110 Ga0075366_10247583 3300006195 Bacteria 1087
111 Ga0097621_100000199 3300006237 Bacteria 38904
112 Ga0097621_100005571 3300006237 Bacteria 8877
113 Ga0068871_100001681 3300006358 Bacteria 14868
114 Ga0068871_100069554 3300006358 Unclassified 2891
115 Ga0068871_100150220 3300006358 Bacteria 1986
116 Ga0075429_100295455 3300006880 Unclassified 1418
117 Ga0068865_100145728 3300006881 Unclassified 1791
118 Ga0075436_100361788 3300006914 Bacteria 1047
119 Ga0097620_100006972 3300006931 Bacteria 11470
120 Ga0097620_100025663 3300006931 Bacteria 5911
121 Ga0097620_100037337 3300006931 Bacteria 4875
122 Ga0097620_100072326 3300006931 Bacteria 3485
123 Ga0097620_100133610 3300006931 Bacteria 2553
124 Ga0097620_100229302 3300006931 Unclassified 1945
125 Ga0105240_10255302 3300009093 Bacteria 2025
126 Ga0105240_10810600 3300009093 Bacteria 1013
127 Ga0105247_10000312 3300009101 Bacteria 43730
128 Ga0105241_10018258 3300009174 Bacteria 5158
129 Ga0105241_10263587 3300009174 Bacteria 1465
130 Ga0105241_10913637 3300009174 Unclassified 816
131 Ga0105242_10004624 3300009176 Bacteria 10672
132 Ga0105242_10009440 3300009176 Bacteria 7477
133 Ga0105242_10286723 3300009176 Bacteria 1498
134 Ga0105248_10007724 3300009177 Bacteria 11811
135 Ga0105248_10499312 3300009177 Bacteria 1372
136 Ga0105237_10090264 3300009545 Bacteria 3054
137 Ga0105237_10119025 3300009545 Bacteria 2635
138 Ga0105249_10004672 3300009553 Bacteria 11825
139 Ga0105249_10006038 3300009553 Bacteria 10497
140 Ga0105249_10093650 3300009553 Bacteria 2815
141 Ga0105249_10373486 3300009553 Bacteria 1450
142 Ga0105239_10015209 3300010375 Bacteria 8528
143 Ga0105239_10040734 3300010375 Bacteria 5090
144 Ga0105239_10716807 3300010375 Bacteria 1144
145 Ga0105246_10017566 3300011119 Bacteria 4549
146 Ga0105246_10586342 3300011119 Bacteria 961
147 Ga0157373_10023481 3300013100 Bacteria 4469
148 Ga0157373_10039903 3300013100 Bacteria 3360
149 Ga0157373_10219058 3300013100 Unclassified 1342
150 Ga0157371_10031443 3300013102 Bacteria 3824
151 Ga0157371_10076134 3300013102 Bacteria 2376
152 Ga0157370_10054172 3300013104 Bacteria 3824
153 Ga0157369_10327964 3300013105 Unclassified 1591
154 Ga0157374_10009633 3300013296 Bacteria 8297
155 Ga0157374_10063989 3300013296 Bacteria 3450
156 Ga0157374_10287396 3300013296 Bacteria 1624
157 Ga0157374_10321466 3300013296 Bacteria 1533
158 Ga0157378_10003708 3300013297 Bacteria 13536
159 Ga0157378_10035199 3300013297 Bacteria 4428
160 Ga0157378_10069245 3300013297 Bacteria 3165
161 Ga0157378_10206554 3300013297 Bacteria 1860
162 Ga0163162_10000764 3300013306 Bacteria 29915
163 Ga0163162_10000811 3300013306 Bacteria 29020
164 Ga0163162_10181312 3300013306 Bacteria 2232
165 Ga0163162_10264330 3300013306 Unclassified 1852
166 Ga0163162_10498323 3300013306 Bacteria 1348
167 Ga0157372_10083001 3300013307 Bacteria 3629
168 Ga0157372_10355686 3300013307 Bacteria 1706
169 Ga0157372_10404508 3300013307 Bacteria 1591
170 Ga0157372_10552176 3300013307 Unclassified 1343
171 Ga0157372_10560060 3300013307 Bacteria 1332
172 Ga0157372_11046021 3300013307 Bacteria 945
173 Ga0157375_10000500 3300013308 Bacteria 35438
174 Ga0157375_10064510 3300013308 Unclassified 3647
175 Ga0157375_10073691 3300013308 Bacteria 3434
176 Ga0163163_10000368 3300014325 Bacteria 43257
177 Ga0163163_10034709 3300014325 Bacteria 4887
178 Ga0163163_10058359 3300014325 Bacteria 3815
179 Ga0163163_11122920 3300014325 Unclassified 849
180 Ga0157377_10054496 3300014745 Bacteria 2264
181 Ga0157377_10263981 3300014745 Bacteria 1121
182 Ga0157379_10043875 3300014968 Bacteria 3992
183 Ga0157376_10000264 3300014969 Bacteria 35812
184 Ga0157376_10054810 3300014969 Unclassified 3326
185 Ga0157376_10213821 3300014969 Bacteria 1782
186 Ga0157376_10298082 3300014969 Bacteria 1525
187 Ga0163161_10012537 3300017792 Bacteria 5886
188 Ga0163161_10022887 3300017792 Unclassified 4402
189 Ga0163161_10163697 3300017792 Bacteria 1697
190 Ga0207697_10031544 3300025315 Unclassified 2168
191 Ga0207642_10026443 3300025899 Bacteria 2362
192 Ga0207710_10000279 3300025900 Bacteria 41660
193 Ga0207688_10090810 3300025901 Unclassified 1754
194 Ga0207680_10047488 3300025903 Bacteria 2544
195 Ga0207645_10003582 3300025907 Bacteria 11749
196 Ga0207645_10025851 3300025907 Unclassified 3797
197 Ga0207645_10188368 3300025907 Bacteria 1355
198 Ga0207643_10027907 3300025908 Bacteria 3133
199 Ga0207705_10008582 3300025909 Bacteria 7450
200 Ga0207654_10204844 3300025911 Unclassified 1301
201 Ga0207707_10329177 3300025912 Bacteria 1318
202 Ga0207695_10008379 3300025913 Bacteria 12950
203 Ga0207671_10463627 3300025914 Bacteria 1009
204 Ga0207652_10004269 3300025921 Bacteria 11660
205 Ga0207681_10014412 3300025923 Bacteria 4913
206 Ga0207681_10060215 3300025923 Bacteria 2605
207 Ga0207681_10106525 3300025923 Bacteria 2032
208 Ga0207650_10001942 3300025925 Bacteria 14567
209 Ga0207650_10008381 3300025925 Bacteria 7055
210 Ga0207650_10011770 3300025925 Bacteria 6033
211 Ga0207650_10140829 3300025925 Bacteria 1896
212 Ga0207650_10241554 3300025925 Unclassified 1460
213 Ga0207650_10282618 3300025925 Bacteria 1352
214 Ga0207659_10019040 3300025926 Bacteria 4509
215 Ga0207659_10561117 3300025926 Bacteria 971
216 Ga0207644_10007690 3300025931 Bacteria 7031
217 Ga0207644_10491062 3300025931 Bacteria 1012
218 Ga0207706_10009129 3300025933 Bacteria 9116
219 Ga0207706_10014328 3300025933 Bacteria 7186
220 Ga0207706_10047418 3300025933 Bacteria 3801
221 Ga0207686_10161106 3300025934 Bacteria 1572
222 Ga0207704_10043371 3300025938 Bacteria 2656
223 Ga0207704_10240583 3300025938 Bacteria 1352
224 Ga0207691_10052358 3300025940 Bacteria 3728
225 Ga0207691_10153164 3300025940 Unclassified 2026
226 Ga0207691_10227651 3300025940 Bacteria 1615
227 Ga0207711_10606321 3300025941 Unclassified 1021
228 Ga0207689_10002686 3300025942 Bacteria 16446
229 Ga0207689_10004997 3300025942 Bacteria 11946
230 Ga0207689_10006100 3300025942 Bacteria 10659
231 Ga0207689_10035889 3300025942 Bacteria 4115
232 Ga0207689_10298980 3300025942 Bacteria 1334
233 Ga0207667_10063506 3300025949 Bacteria 3858
234 Ga0207667_10495618 3300025949 Unclassified 1239
235 Ga0207651_10039814 3300025960 Bacteria 3103
236 Ga0207651_10135088 3300025960 Unclassified 1896
237 Ga0207712_10003015 3300025961 Bacteria 10751
238 Ga0207712_10007015 3300025961 Bacteria 7105
239 Ga0207712_10116060 3300025961 Bacteria 2017
240 Ga0207712_10398427 3300025961 Bacteria 1156
241 Ga0207668_10149100 3300025972 Bacteria 1808
242 Ga0207668_10206680 3300025972 Bacteria 1567
243 Ga0207668_10876649 3300025972 Unclassified 798
244 Ga0207640_10034490 3300025981 Bacteria 3158
245 Ga0207640_10094605 3300025981 Bacteria 2078
246 Ga0207640_10353391 3300025981 Bacteria 1181
247 Ga0207658_10099365 3300025986 Bacteria 2276
248 Ga0207658_10101748 3300025986 Bacteria 2252
249 Ga0207677_10022408 3300026023 Bacteria 3881
250 Ga0207677_10141208 3300026023 Bacteria 1844
251 Ga0207677_10167926 3300026023 Bacteria 1712
252 Ga0207639_10151237 3300026041 Bacteria 1944
253 Ga0207708_10058054 3300026075 Bacteria 2953
254 Ga0207702_10289029 3300026078 Unclassified 1552
255 Ga0207641_10217686 3300026088 Bacteria 1769
256 Ga0207641_10332325 3300026088 Bacteria 1444
257 Ga0207648_10004124 3300026089 Bacteria 15029
258 Ga0207648_10024107 3300026089 Bacteria 5436
259 Ga0207648_10040094 3300026089 Bacteria 4115
260 Ga0207648_10044280 3300026089 Bacteria 3904
261 Ga0207648_10075267 3300026089 Bacteria 2943
262 Ga0207676_10002971 3300026095 Bacteria 12099
263 Ga0207676_10441842 3300026095 Unclassified 1224
264 Ga0207676_11006128 3300026095 Bacteria 821
265 Ga0207674_10002788 3300026116 Bacteria 21761
266 Ga0207674_10276938 3300026116 Bacteria 1625
267 Ga0207674_10647387 3300026116 Unclassified 1021
268 Ga0207675_100029153 3300026118 Bacteria 5144
269 Ga0207675_100192236 3300026118 Bacteria 1958
270 Ga0207683_10016572 3300026121 Bacteria 6274
271 Ga0207683_10157863 3300026121 Bacteria 2049
272 Ga0207683_10547111 3300026121 Bacteria 1070
273 Ga0207698_10012487 3300026142 Bacteria 5561
274 Ga0207698_10051337 3300026142 Bacteria 3152
275 Ga0207698_10694051 3300026142 Bacteria 1012
276 Ga0209995_1007554 3300027471 Bacteria 1752
277 Ga0209968_1004065 3300027526 Bacteria 2197
278 Ga0207428_10094144 3300027907 Bacteria 2323
279 Ga0268266_10027235 3300028379 Bacteria 4862
280 Ga0268265_10011472 3300028380 Bacteria 5991
281 Ga0268264_10013671 3300028381 Bacteria 6681
282 Ga0268264_10326593 3300028381 Bacteria 1453
283 Ga0268264_10665277 3300028381 Unclassified 1032
284 Ga0265313_10133825 3300031595 Bacteria 1072
285 Ga0307413_10249052 3300031824 Bacteria 1317
286 Ga0307410_10025862 3300031852 Bacteria 3688
287 Ga0451789_0021637 3300041443 Bacteria 1064
288 Ga0451798_0813116 3300041458 Unclassified 1022
289 Ga0451577_0834420 3300042876 Bacteria 832
290 Ga0453683_0108238 3300044673 Bacteria 1747
291 Ga0453684_0044569 3300044712 Bacteria 5932
292 Ga0453684_0455199 3300044712 Unclassified 1424
293 Ga0466959_0112457 3300045049 Bacteria 1942
294 Ga0495580_0181658 3300046472 Bacteria 1452
295 Ga0495643_0028113 3300046522 Bacteria 3156
296 Ga0495672_0042906 3300047320 Bacteria 2724
297 Ga0495672_0068634 3300047320 Unclassified 2015
298 Ga0495672_0107446 3300047320 Unclassified 1503
299 Ga0495686_0314208 3300047472 Unclassified 861
300 Ga0496100_0354476 3300048903 Bacteria 1109
301 Ga0496101_0045935 3300048904 Bacteria 3130
302 Ga0496114_0066699 3300048917 Bacteria 3018
303 Ga0501034_0000007 3300049571 Bacteria 357805
304 Ga0501034_0016828 3300049571 Bacteria 7497
305 Ga0501036_0032755 3300049572 Bacteria 4393
306 Ga0501037_0012454 3300049573 Bacteria 6266
307 Ga0501038_0016176 3300049574 Bacteria 6767
308 Ga0501038_0021779 3300049574 Bacteria 5752
309 Ga0501039_0038001 3300049575 Bacteria 3718
310 Ga0501039_0401428 3300049575 Bacteria 1076
311 Ga0501043_0023000 3300049579 Unclassified 4887
312 Ga0501043_0036593 3300049579 Bacteria 3862
313 Ga0501046_0024776 3300049580 Bacteria 4918
314 Ga0501046_0029782 3300049580 Bacteria 4436
315 Ga0501047_0010937 3300049581 Bacteria 8585
316 Ga0501048_0004339 3300049582 Bacteria 10801
317 Ga0501068_0031606 3300049584 Bacteria 3144
318 Ga0501070_0088598 3300049586 Bacteria 2561
319 Ga0501073_0012038 3300049589 Bacteria 6316
320 Ga0501074_0008354 3300049590 Bacteria 7505
321 Ga0501217_063079 3300049661 Bacteria 994
322 Ga0501240_063335 3300049673 Unclassified 657
323 Ga0501243_012922 3300049675 Bacteria 1322
324 Ga0501079_0041088 3300049741 Bacteria 3569
325 Ga0501080_0038962 3300049742 Bacteria 4436
326 Ga0501080_0069039 3300049742 Unclassified 3287
327 Ga0501083_0007840 3300049744 Bacteria 7565
328 Ga0501272_004625 3300049769 Bacteria 1434
329 Ga0501274_000509 3300049771 Bacteria 2777
330 Ga0501035_0001596 3300049822 Bacteria 22944
331 Ga0501035_0027365 3300049822 Bacteria 5212
332 Ga0501044_0033821 3300049823 Bacteria 5367
333 Ga0501044_0114097 3300049823 Unclassified 2708
334 Ga0501045_0041102 3300049824 Bacteria 3364
335 nmdc:mga0k408_24177_c1 3300050493 Bacteria 3433
336 nmdc:mga0k408_7141_c1 3300050493 Bacteria 5967
337 Ga0500644_0012886 3300053088 Bacteria 2323
338 Ga0500641_0060346 3300053096 Bacteria 1578
339 Ga0500568_0058962 3300053139 Bacteria 1490
340 Ga0500622_0013388 3300053156 Bacteria 4424
341 Ga0500611_067525 3300053727 Bacteria 863
342 Ga0501084_0428403 3300054114 Unclassified 1118
343 Ga0501082_0052268 3300060353 Bacteria 3522
344 Ga0068867_100229510
345 rootH1_10086211
346 rootH2_10098856
347 rootL2_10294975
348 rootH1_10049086
349 rootH1_10157602
350 Ga0065712_10152974
351 Ga0065712_10290527
352 Ga0070658_10096810
353 Ga0070676_10107024
354 Ga0070683_100038996
355 Ga0070683_100071415
356 Ga0070683_100584466
357 Ga0070690_100004530
358 Ga0070690_100020147
359 Ga0070690_100182420
360 Ga0070670_100015447
361 Ga0070670_100034643
362 Ga0070670_100102875
363 Ga0070670_100178871
364 Ga0070670_100614759
365 Ga0070677_10012967
366 Ga0068869_100030794
367 Ga0070666_10014034
368 Ga0070666_10079926
369 Ga0070680_100109652
370 Ga0070682_100126368
371 Ga0068868_100020047
372 Ga0068868_100284099
373 Ga0068868_100679359
374 Ga0070689_100218206
375 Ga0070687_100202046
376 Ga0070668_100019872
377 Ga0070669_100033740
378 Ga0070669_100128053
379 Ga0070669_100147376
380 Ga0070669_100168931
381 Ga0070675_100006148
382 Ga0070675_100036341
383 Ga0070675_100238549
384 Ga0070671_100082734
385 Ga0070671_100104053
386 Ga0070671_100105934
387 Ga0070673_100008010
388 Ga0070673_100064794
389 Ga0070673_100164412
390 Ga0070688_100069228
391 Ga0070667_100027498
392 Ga0070667_100056338
393 Ga0070667_100196320
394 Ga0070678_100043510
395 Ga0070678_100045381
396 Ga0070662_100025386
397 Ga0070662_100113084
398 Ga0070681_10382405
399 Ga0068867_100482866
400 Ga0068867_100604551
401 Ga0070685_10337766
402 Ga0070679_100015029
403 Ga0070684_100066352
404 Ga0068853_100032215
405 Ga0068853_100194625
406 Ga0068853_100333062
407 Ga0068853_100379210
408 Ga0068853_100466564
409 Ga0070672_100101272
410 Ga0070672_100242528
411 Ga0070686_100050085
412 Ga0070665_100005261
413 Ga0070704_100550498
414 Ga0068855_100111231
415 Ga0068855_100249937
416 Ga0070664_100102265
417 Ga0070664_100389579
418 Ga0068857_100646320
419 Ga0068854_100016438
420 Ga0068854_100056174
421 Ga0068854_100314592
422 Ga0068856_100054948
423 Ga0070702_100059518
424 Ga0068852_100006440
425 Ga0068852_100024242
426 Ga0068852_100173813
427 Ga0068852_100421761
428 Ga0068859_100006972
429 Ga0068859_100025663
430 Ga0068859_100037336
431 Ga0068859_100072322
432 Ga0068859_100133608
433 Ga0068859_100229292
434 Ga0068864_100015422
435 Ga0068864_100042887
436 Ga0068864_100284669
437 Ga0068864_100937091
438 Ga0068866_10026660
439 Ga0068866_10210865
440 Ga0068861_100010649
441 Ga0068851_10042823
442 Ga0068870_10015524
443 Ga0068870_10022139
444 Ga0068870_10050804
445 Ga0068863_100811278
446 Ga0068858_100078630
447 Ga0068860_100001891
448 Ga0068860_100070161
449 Ga0068862_100003639
450 Ga0068862_100224450
451 Ga0081539_10005521
452 Ga0075366_10001753
453 Ga0075366_10247583
454 Ga0097621_100000199
455 Ga0097621_100005571
456 Ga0068871_100001681
457 Ga0068871_100069554
458 Ga0068871_100150220
459 Ga0075429_100295455
460 Ga0068865_100145728
461 Ga0075436_100361788
462 Ga0097620_100006972
463 Ga0097620_100025663
464 Ga0097620_100037337
465 Ga0097620_100072326
466 Ga0097620_100133610
467 Ga0097620_100229302
468 Ga0105240_10255302
469 Ga0105240_10810600
470 Ga0105247_10000312
471 Ga0105241_10018258
472 Ga0105241_10263587
473 Ga0105241_10913637
474 Ga0105242_10004624
475 Ga0105242_10009440
476 Ga0105242_10286723
477 Ga0105248_10007724
478 Ga0105248_10499312
479 Ga0105237_10090264
480 Ga0105237_10119025
481 Ga0105249_10004672
482 Ga0105249_10006038
483 Ga0105249_10093650
484 Ga0105249_10373486
485 Ga0105239_10015209
486 Ga0105239_10040734
487 Ga0105239_10716807
488 Ga0105246_10017566
489 Ga0105246_10586342
490 Ga0157373_10023481
491 Ga0157373_10039903
492 Ga0157373_10219058
493 Ga0157371_10031443
494 Ga0157371_10076134
495 Ga0157370_10054172
496 Ga0157369_10327964
497 Ga0157374_10009633
498 Ga0157374_10063989
499 Ga0157374_10287396
500 Ga0157374_10321466
501 Ga0157378_10003708
502 Ga0157378_10035199
503 Ga0157378_10069245
504 Ga0157378_10206554
505 Ga0163162_10000764
506 Ga0163162_10000811
507 Ga0163162_10181312
508 Ga0163162_10264330
509 Ga0163162_10498323
510 Ga0157372_10083001
511 Ga0157372_10355686
512 Ga0157372_10404508
513 Ga0157372_10552176
514 Ga0157372_10560060
515 Ga0157372_11046021
516 Ga0157375_10000500
517 Ga0157375_10064510
518 Ga0157375_10073691
519 Ga0163163_10000368
520 Ga0163163_10034709
521 Ga0163163_10058359
522 Ga0163163_11122920
523 Ga0157377_10054496
524 Ga0157377_10263981
525 Ga0157379_10043875
526 Ga0157376_10000264
527 Ga0157376_10054810
528 Ga0157376_10213821
529 Ga0157376_10298082
530 Ga0163161_10012537
531 Ga0163161_10022887
532 Ga0163161_10163697
533 Ga0207697_10031544
534 Ga0207642_10026443
535 Ga0207710_10000279
536 Ga0207688_10090810
537 Ga0207680_10047488
538 Ga0207645_10003582
539 Ga0207645_10025851
540 Ga0207645_10188368
541 Ga0207643_10027907
542 Ga0207705_10008582
543 Ga0207654_10204844
544 Ga0207707_10329177
545 Ga0207695_10008379
546 Ga0207671_10463627
547 Ga0207652_10004269
548 Ga0207681_10014412
549 Ga0207681_10060215
550 Ga0207681_10106525
551 Ga0207650_10001942
552 Ga0207650_10008381
553 Ga0207650_10011770
554 Ga0207650_10140829
555 Ga0207650_10241554
556 Ga0207650_10282618
557 Ga0207659_10019040
558 Ga0207659_10561117
559 Ga0207644_10007690
560 Ga0207644_10491062
561 Ga0207706_10009129
562 Ga0207706_10014328
563 Ga0207706_10047418
564 Ga0207686_10161106
565 Ga0207704_10043371
566 Ga0207704_10240583
567 Ga0207691_10052358
568 Ga0207691_10153164
569 Ga0207691_10227651
570 Ga0207711_10606321
571 Ga0207689_10002686
572 Ga0207689_10004997
573 Ga0207689_10006100
574 Ga0207689_10035889
575 Ga0207689_10298980
576 Ga0207667_10063506
577 Ga0207667_10495618
578 Ga0207651_10039814
579 Ga0207651_10135088
580 Ga0207712_10003015
581 Ga0207712_10007015
582 Ga0207712_10116060
583 Ga0207712_10398427
584 Ga0207668_10149100
585 Ga0207668_10206680
586 Ga0207668_10876649
587 Ga0207640_10034490
588 Ga0207640_10094605
589 Ga0207640_10353391
590 Ga0207658_10099365
591 Ga0207658_10101748
592 Ga0207677_10022408
593 Ga0207677_10141208
594 Ga0207677_10167926
595 Ga0207639_10151237
596 Ga0207708_10058054
597 Ga0207702_10289029
598 Ga0207641_10217686
599 Ga0207641_10332325
600 Ga0207648_10004124
601 Ga0207648_10024107
602 Ga0207648_10040094
603 Ga0207648_10044280
604 Ga0207648_10075267
605 Ga0207676_10002971
606 Ga0207676_10441842
607 Ga0207676_11006128
608 Ga0207674_10002788
609 Ga0207674_10276938
610 Ga0207674_10647387
611 Ga0207675_100029153
612 Ga0207675_100192236
613 Ga0207683_10016572
614 Ga0207683_10157863
615 Ga0207683_10547111
616 Ga0207698_10012487
617 Ga0207698_10051337
618 Ga0207698_10694051
619 Ga0209995_1007554
620 Ga0209968_1004065
621 Ga0207428_10094144
622 Ga0268266_10027235
623 Ga0268265_10011472
624 Ga0268264_10013671
625 Ga0268264_10326593
626 Ga0268264_10665277
627 Ga0265313_10133825
628 Ga0307413_10249052
629 Ga0307410_10025862
630 Ga0451789_0021637
631 Ga0451798_0813116
632 Ga0451577_0834420
633 Ga0453683_0108238
634 Ga0453684_0044569
635 Ga0453684_0455199
636 Ga0466959_0112457
637 Ga0495580_0181658
638 Ga0495643_0028113
639 Ga0495672_0042906
640 Ga0495672_0068634
641 Ga0495672_0107446
642 Ga0495686_0314208
643 Ga0496100_0354476
644 Ga0496101_0045935
645 Ga0496114_0066699
646 Ga0501034_0000007
647 Ga0501034_0016828
648 Ga0501036_0032755
649 Ga0501037_0012454
650 Ga0501038_0016176
651 Ga0501038_0021779
652 Ga0501039_0038001
653 Ga0501039_0401428
654 Ga0501043_0023000
655 Ga0501043_0036593
656 Ga0501046_0024776
657 Ga0501046_0029782
658 Ga0501047_0010937
659 Ga0501048_0004339
660 Ga0501068_0031606
661 Ga0501070_0088598
662 Ga0501073_0012038
663 Ga0501074_0008354
664 Ga0501217_063079
665 Ga0501240_063335
666 Ga0501243_012922
667 Ga0501079_0041088
668 Ga0501080_0038962
669 Ga0501080_0069039
670 Ga0501083_0007840
671 Ga0501272_004625
672 Ga0501274_000509
673 Ga0501035_0001596
674 Ga0501035_0027365
675 Ga0501044_0033821
676 Ga0501044_0114097
677 Ga0501045_0041102
678 nmdc:mga0k408_24177_c1
679 nmdc:mga0k408_7141_c1
680 Ga0500644_0012886
681 Ga0500641_0060346
682 Ga0500568_0058962
683 Ga0500622_0013388
684 Ga0500611_067525
685 Ga0501084_0428403
686 Ga0501082_0052268

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00156

Pribosyltran

Phosphoribosyl transferase domain

165

266

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
5mp7-assembly1.cif.gz_A crystal structure of phosphoribosylpyrophosphate synthetase from mycobacterium smegmatis 0.7875 99 228
1ecb-assembly2.cif.gz_D escherichia coli glutamine phosphoribosylpyrophosphate (prpp) amidotransferase complexed with 2 gmp, 1 mg per subunit 0.7655 82 223
2c4k-assembly6.cif.gz_F crystal structure of human phosphoribosylpyrophosphate synthetase- associated protein 39 (pap39) 0.7644 102 228
1u9y-assembly1.cif.gz_A crystal structure of phosphoribosyl diphosphate synthase from methanocaldococcus jannaschii 0.7569 102 225
8w7d-assembly1.cif.gz_B crystal structure of ecppat-fr901483 complex 0.7562 82 223
ID Description Score Start End Superfamily
af_A4HTJ9_703_814_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9496 188 228 3.40.50.2020
af_P38620_200_307_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9487 188 228 3.40.50.2020
af_Q75JN8_207_322_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.945 188 228 3.40.50.2020
af_P46846_104_226_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9427 116 228 3.40.50.2020
af_P0A717_198_307_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9379 188 228 3.40.50.2020
ID Description Score Start End GO Terms
AF-A0A7C6UQH9-F1-model_v4 ComF family protein 0.9408 67 230
AF-A0A2U1RMT2-F1-model_v4 ComF family protein 0.9389 66 230
AF-A0A2U1RMT2-F1-model_v4 ComF family protein 0.9334 66 230
AF-A0A1F4RD51-F1-model_v4 Phosphoribosyltransferase domain-containing protein 0.933 63 230
AF-A0A7V2Q8V9-F1-model_v4 ComF family protein 0.9328 63 230

Map