F415391

General Info

Members Datasets Scaffolds Average Seq Length
343 149 343 71

Family's Representative Sequence

Representative Sequence 3300001976|JGI24752J21851_1052315|JGI24752J21851_10523152
Length 72
Sequence VSYFVAIGIVAAVAGVVLLAIAIRRLQAQEPKHVAMLIGGMMLTAFGIVIAGFSLAYDWAEPIDFNSEGATR

Samples

Sample ID Description Type Environment
1 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
101 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
102 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
103 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
104 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
105 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
106 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
107 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
108 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
109 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
110 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
111 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
112 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
113 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
114 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
115 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
116 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
117 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
118 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
119 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
120 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
121 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
122 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
123 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
124 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
125 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
126 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
127 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
128 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
129 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
130 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
131 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
132 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
133 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
134 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
135 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
136 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
137 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
138 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
139 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
140 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
141 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
142 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
143 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
144 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
145 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
146 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
147 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
148 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
149 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 9.62
Rhizosphere 89.8
Stem 0
Stem Tuber 0
Unclassified 0.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1014758 3300001915 Bacteria 1300
2 JGI24752J21851_1052315 3300001976 Bacteria 556
3 JGI24737J22298_10244968 3300001990 Bacteria 529
4 JGI24743J22301_10160011 3300001991 Bacteria 508
5 Ga0065715_10367240 3300005293 Bacteria 920
6 Ga0070658_10213241 3300005327 Bacteria 1631
7 Ga0070658_10219551 3300005327 Bacteria 1607
8 Ga0070658_10744000 3300005327 Bacteria 851
9 Ga0070670_100151476 3300005331 Bacteria 2007
10 Ga0070670_100235872 3300005331 Bacteria 1592
11 Ga0070670_100365249 3300005331 Bacteria 1270
12 Ga0070670_100862118 3300005331 Bacteria 820
13 Ga0070677_10116932 3300005333 Bacteria 1199
14 Ga0068869_100555859 3300005334 Bacteria 965
15 Ga0070666_10553879 3300005335 Bacteria 836
16 Ga0070680_100479996 3300005336 Bacteria 1062
17 Ga0070680_100793955 3300005336 Bacteria 816
18 Ga0070682_100746665 3300005337 Bacteria 789
19 Ga0068868_101509336 3300005338 Unclassified 629
20 Ga0070660_100060432 3300005339 Bacteria 2941
21 Ga0070660_100357945 3300005339 Bacteria 1202
22 Ga0070660_100385700 3300005339 Bacteria 1157
23 Ga0070660_101296294 3300005339 Bacteria 618
24 Ga0070661_100100105 3300005344 Bacteria 2154
25 Ga0070661_100568719 3300005344 Bacteria 914
26 Ga0070661_100706630 3300005344 Bacteria 822
27 Ga0070661_100787330 3300005344 Bacteria 780
28 Ga0070692_10138312 3300005345 Bacteria 1376
29 Ga0070668_100957299 3300005347 Bacteria 768
30 Ga0070675_100213634 3300005354 Bacteria 1678
31 Ga0070671_100090294 3300005355 Bacteria 2565
32 Ga0070671_100179300 3300005355 Bacteria 1793
33 Ga0070671_100206393 3300005355 Bacteria 1666
34 Ga0070671_100326665 3300005355 Bacteria 1307
35 Ga0070673_100991279 3300005364 Bacteria 782
36 Ga0070659_100274011 3300005366 Bacteria 1403
37 Ga0070659_100405389 3300005366 Bacteria 1152
38 Ga0070659_102078033 3300005366 Bacteria 510
39 Ga0070667_100032051 3300005367 Bacteria 4382
40 Ga0070667_101880297 3300005367 Bacteria 563
41 Ga0070714_100997832 3300005435 Bacteria 815
42 Ga0070714_101176705 3300005435 Bacteria 748
43 Ga0070713_100017058 3300005436 Bacteria 5479
44 Ga0070663_100056417 3300005455 Bacteria 2814
45 Ga0070663_100358891 3300005455 Bacteria 1182
46 Ga0070662_100289988 3300005457 Bacteria 1327
47 Ga0070662_100862223 3300005457 Bacteria 771
48 Ga0070679_100004379 3300005530 Bacteria 13048
49 Ga0070684_100714304 3300005535 Bacteria 935
50 Ga0068853_100656405 3300005539 Bacteria 999
51 Ga0068853_101035423 3300005539 Bacteria 791
52 Ga0070672_100103650 3300005543 Bacteria 2310
53 Ga0070672_101020406 3300005543 Unclassified 734
54 Ga0070693_100730292 3300005547 Bacteria 728
55 Ga0070665_101556460 3300005548 Bacteria 669
56 Ga0068855_100003874 3300005563 Bacteria 18286
57 Ga0070664_100369469 3300005564 Bacteria 1307
58 Ga0070664_100851758 3300005564 Bacteria 854
59 Ga0068857_100023563 3300005577 Bacteria 5419
60 Ga0068856_100040561 3300005614 Bacteria 4573
61 Ga0068856_100753766 3300005614 Bacteria 993
62 Ga0068856_101330525 3300005614 Archaea 733
63 Ga0068852_100583796 3300005616 Bacteria 1121
64 Ga0068859_100329334 3300005617 Bacteria 1621
65 Ga0068864_100011801 3300005618 Bacteria 7215
66 Ga0068864_100021033 3300005618 Bacteria 5463
67 Ga0068851_10094240 3300005834 Bacteria 1581
68 Ga0068851_10266510 3300005834 Bacteria 976
69 Ga0068863_100013930 3300005841 Bacteria 7752
70 Ga0068863_100020604 3300005841 Bacteria 6302
71 Ga0068858_100413521 3300005842 Bacteria 1297
72 Ga0068862_100555724 3300005844 Bacteria 1096
73 Ga0081539_10033626 3300005985 Bacteria 3118
74 Ga0070717_10395436 3300006028 Bacteria 1241
75 Ga0070717_10543484 3300006028 Bacteria 1052
76 Ga0097621_100167750 3300006237 Bacteria 1891
77 Ga0097621_100686714 3300006237 Bacteria 942
78 Ga0068871_100374320 3300006358 Bacteria 1264
79 Ga0068871_100474371 3300006358 Bacteria 1124
80 Ga0075433_11231037 3300006852 Bacteria 649
81 Ga0068865_100487345 3300006881 Bacteria 1026
82 Ga0075436_100478636 3300006914 Bacteria 909
83 Ga0097620_100329337 3300006931 Bacteria 1621
84 Ga0105251_10036105 3300009011 Bacteria 2435
85 Ga0105241_11345901 3300009174 Bacteria 682
86 Ga0105248_10377944 3300009177 Bacteria 1595
87 Ga0105248_11872850 3300009177 Bacteria 681
88 Ga0105237_10318596 3300009545 Bacteria 1558
89 Ga0157373_10437773 3300013100 Bacteria 940
90 Ga0157373_11207290 3300013100 Unclassified 570
91 Ga0157370_10506793 3300013104 Bacteria 1108
92 Ga0157370_10566712 3300013104 Bacteria 1041
93 Ga0157369_10769631 3300013105 Bacteria 990
94 Ga0157369_11311196 3300013105 Bacteria 738
95 Ga0163162_11417065 3300013306 Unclassified 791
96 Ga0157372_11066219 3300013307 Bacteria 935
97 Ga0157375_11572372 3300013308 Unclassified 777
98 Ga0163163_11618531 3300014325 Bacteria 708
99 Ga0182008_10619897 3300014497 Bacteria 609
100 Ga0157379_10197073 3300014968 Bacteria 1820
101 Ga0157379_12305356 3300014968 Bacteria 536
102 Ga0207656_10096432 3300025321 Bacteria 1350
103 Ga0207656_10248355 3300025321 Bacteria 871
104 Ga0207713_1214582 3300025735 Bacteria 583
105 Ga0207680_10837193 3300025903 Bacteria 660
106 Ga0207647_10158335 3300025904 Bacteria 1321
107 Ga0207647_10469967 3300025904 Bacteria 703
108 Ga0207643_10993032 3300025908 Unclassified 543
109 Ga0207705_10044477 3300025909 Bacteria 3191
110 Ga0207705_10074383 3300025909 Bacteria 2466
111 Ga0207705_10362939 3300025909 Bacteria 1117
112 Ga0207705_10622904 3300025909 Unclassified 839
113 Ga0207657_10070461 3300025919 Bacteria 2963
114 Ga0207649_10676438 3300025920 Bacteria 799
115 Ga0207649_10761313 3300025920 Bacteria 754
116 Ga0207649_11225286 3300025920 Bacteria 593
117 Ga0207652_10007793 3300025921 Bacteria 8602
118 Ga0207652_10983630 3300025921 Bacteria 742
119 Ga0207650_10091948 3300025925 Bacteria 2320
120 Ga0207650_10208332 3300025925 Bacteria 1569
121 Ga0207650_10533112 3300025925 Bacteria 983
122 Ga0207650_10853850 3300025925 Bacteria 772
123 Ga0207700_10109315 3300025928 Bacteria 2221
124 Ga0207664_10847616 3300025929 Bacteria 821
125 Ga0207644_10000166 3300025931 Bacteria 47729
126 Ga0207644_10034465 3300025931 Bacteria 3542
127 Ga0207644_10399297 3300025931 Bacteria 1123
128 Ga0207644_10458106 3300025931 Bacteria 1048
129 Ga0207690_10416849 3300025932 Bacteria 1074
130 Ga0207690_10787752 3300025932 Bacteria 785
131 Ga0207690_11492694 3300025932 Bacteria 565
132 Ga0207706_10365383 3300025933 Bacteria 1254
133 Ga0207706_10394458 3300025933 Bacteria 1200
134 Ga0207665_10018666 3300025939 Bacteria 4556
135 Ga0207691_10307392 3300025940 Bacteria 1361
136 Ga0207691_10916477 3300025940 Bacteria 733
137 Ga0207691_11219900 3300025940 Bacteria 623
138 Ga0207711_10009884 3300025941 Bacteria 7933
139 Ga0207711_10177269 3300025941 Bacteria 1937
140 Ga0207689_11472557 3300025942 Bacteria 569
141 Ga0207661_10588455 3300025944 Bacteria 1021
142 Ga0207661_11563113 3300025944 Bacteria 604
143 Ga0207679_10301439 3300025945 Bacteria 1381
144 Ga0207679_10606040 3300025945 Bacteria 987
145 Ga0207667_10110153 3300025949 Bacteria 2840
146 Ga0207651_11021647 3300025960 Bacteria 739
147 Ga0207651_11300287 3300025960 Bacteria 654
148 Ga0207651_12107072 3300025960 Bacteria 506
149 Ga0207668_12118125 3300025972 Bacteria 506
150 Ga0207658_10110428 3300025986 Bacteria 2172
151 Ga0207658_10304573 3300025986 Bacteria 1374
152 Ga0207703_10106527 3300026035 Bacteria 2385
153 Ga0207703_11574336 3300026035 Bacteria 632
154 Ga0207639_11009082 3300026041 Bacteria 780
155 Ga0207678_10001078 3300026067 Bacteria 24989
156 Ga0207678_10672427 3300026067 Bacteria 910
157 Ga0207702_10018452 3300026078 Bacteria 5772
158 Ga0207702_10115857 3300026078 Bacteria 2390
159 Ga0207702_10430882 3300026078 Bacteria 1277
160 Ga0207641_10006502 3300026088 Bacteria 9839
161 Ga0207641_10617652 3300026088 Bacteria 1062
162 Ga0207676_10044583 3300026095 Bacteria 3422
163 Ga0207676_10059225 3300026095 Bacteria 3023
164 Ga0207674_10167010 3300026116 Bacteria 2155
165 Ga0268266_11236882 3300028379 Bacteria 722
166 Ga0268265_10244094 3300028380 Bacteria 1587
167 Ga0268264_11360370 3300028381 Bacteria 720
168 Ga0307408_102226951 3300031548 Bacteria 530
169 Ga0307410_10062489 3300031852 Bacteria 2552
170 Ga0307409_101045331 3300031995 Bacteria 836
171 Ga0307416_100265932 3300032002 Bacteria 1680
172 Ga0373951_0258688 3300035091 Unclassified 525
173 Ga0373961_0311222 3300035241 Bacteria 585
174 Ga0373947_0801578 3300035725 Bacteria 643
175 Ga0373937_0354610 3300036401 Bacteria 1390
176 Ga0395899_0000523 3300037312 Bacteria 42229
177 Ga0395899_0000632 3300037312 Bacteria 36585
178 Ga0395899_0015625 3300037312 Bacteria 5788
179 Ga0395899_0037692 3300037312 Bacteria 3624
180 Ga0395899_0101921 3300037312 Bacteria 2071
181 Ga0395899_0118940 3300037312 Bacteria 1894
182 Ga0395899_0164533 3300037312 Bacteria 1565
183 Ga0395899_0217920 3300037312 Bacteria 1323
184 Ga0395899_0235107 3300037312 Bacteria 1263
185 Ga0395899_0291250 3300037312 Bacteria 1107
186 Ga0395899_0402799 3300037312 Bacteria 905
187 Ga0395899_0427519 3300037312 Bacteria 871
188 Ga0395900_0000075 3300037418 Bacteria 183525
189 Ga0395900_0000289 3300037418 Bacteria 75525
190 Ga0395900_0025689 3300037418 Bacteria 6029
191 Ga0395900_0031044 3300037418 Bacteria 5488
192 Ga0395900_0038605 3300037418 Bacteria 4922
193 Ga0395900_0038913 3300037418 Bacteria 4902
194 Ga0395900_0079277 3300037418 Bacteria 3374
195 Ga0395900_0079558 3300037418 Bacteria 3368
196 Ga0395900_0150528 3300037418 Bacteria 2377
197 Ga0395900_0213594 3300037418 Bacteria 1947
198 Ga0395900_0218539 3300037418 Bacteria 1922
199 Ga0395900_0279243 3300037418 Bacteria 1663
200 Ga0395900_0316728 3300037418 Bacteria 1541
201 Ga0395900_0350610 3300037418 Bacteria 1449
202 Ga0395900_0459963 3300037418 Bacteria 1227
203 Ga0395900_0482081 3300037418 Bacteria 1192
204 Ga0395900_0663710 3300037418 Bacteria 978
205 Ga0395900_1167215 3300037418 Bacteria 686
206 Ga0395900_1173920 3300037418 Bacteria 683
207 Ga0395900_1322181 3300037418 Bacteria 634
208 Ga0395900_1512762 3300037418 Bacteria 583
209 Ga0395898_0000055 3300037466 Bacteria 278557
210 Ga0395898_0004447 3300037466 Bacteria 15324
211 Ga0395898_0008731 3300037466 Bacteria 10690
212 Ga0395898_0047427 3300037466 Bacteria 4216
213 Ga0395898_0054285 3300037466 Bacteria 3910
214 Ga0395898_0140535 3300037466 Bacteria 2312
215 Ga0395898_0234607 3300037466 Bacteria 1749
216 Ga0395898_0310803 3300037466 Bacteria 1503
217 Ga0395898_0362312 3300037466 Bacteria 1382
218 Ga0395898_0412458 3300037466 Bacteria 1287
219 Ga0395898_0418600 3300037466 Bacteria 1277
220 Ga0395898_0475855 3300037466 Bacteria 1188
221 Ga0395898_0478779 3300037466 Bacteria 1184
222 Ga0395898_0601244 3300037466 Bacteria 1042
223 Ga0395898_0833841 3300037466 Bacteria 862
224 Ga0395898_1169276 3300037466 Unclassified 701
225 Ga0395905_0000067 3300037471 Bacteria 181887
226 Ga0395905_0004958 3300037471 Bacteria 13720
227 Ga0395905_0006460 3300037471 Bacteria 11799
228 Ga0395905_0007413 3300037471 Bacteria 10907
229 Ga0395905_0009662 3300037471 Bacteria 9414
230 Ga0395905_0020501 3300037471 Bacteria 6262
231 Ga0395905_0021513 3300037471 Bacteria 6098
232 Ga0395905_0037705 3300037471 Bacteria 4536
233 Ga0395905_0063303 3300037471 Bacteria 3460
234 Ga0395905_0107176 3300037471 Bacteria 2623
235 Ga0395905_0201565 3300037471 Bacteria 1865
236 Ga0395905_0334552 3300037471 Bacteria 1405
237 Ga0395905_0368616 3300037471 Bacteria 1329
238 Ga0395905_0371021 3300037471 Bacteria 1324
239 Ga0395905_0382346 3300037471 Bacteria 1301
240 Ga0395905_0393386 3300037471 Bacteria 1280
241 Ga0395905_0412757 3300037471 Bacteria 1245
242 Ga0395905_0451530 3300037471 Bacteria 1183
243 Ga0395905_0471339 3300037471 Bacteria 1154
244 Ga0395905_0751428 3300037471 Bacteria 877
245 Ga0395905_0754414 3300037471 Bacteria 876
246 Ga0395905_0999575 3300037471 Bacteria 739
247 Ga0395905_1288286 3300037471 Bacteria 634
248 Ga0395905_1580183 3300037471 Bacteria 560
249 Ga0395905_1719686 3300037471 Bacteria 532
250 Ga0395901_0000957 3300038443 Bacteria 31439
251 Ga0395901_0004390 3300038443 Bacteria 14226
252 Ga0395901_0039447 3300038443 Bacteria 4886
253 Ga0395901_0054635 3300038443 Bacteria 4151
254 Ga0395901_0059071 3300038443 Bacteria 3989
255 Ga0395901_0075970 3300038443 Bacteria 3504
256 Ga0395901_0087856 3300038443 Bacteria 3250
257 Ga0395901_0155534 3300038443 Bacteria 2401
258 Ga0395901_0198412 3300038443 Bacteria 2104
259 Ga0395901_0235344 3300038443 Bacteria 1911
260 Ga0395901_0247165 3300038443 Bacteria 1859
261 Ga0395901_0297546 3300038443 Bacteria 1673
262 Ga0395901_0376589 3300038443 Bacteria 1461
263 Ga0395901_0495218 3300038443 Bacteria 1245
264 Ga0395901_0530073 3300038443 Bacteria 1195
265 Ga0395901_0540121 3300038443 Bacteria 1182
266 Ga0395901_0614578 3300038443 Bacteria 1094
267 Ga0395901_0760072 3300038443 Bacteria 961
268 Ga0395901_0887341 3300038443 Bacteria 874
269 Ga0395901_0924740 3300038443 Bacteria 852
270 Ga0395901_0926488 3300038443 Bacteria 851
271 Ga0395901_1746002 3300038443 Bacteria 572
272 Ga0395901_1837175 3300038443 Bacteria 554
273 Ga0395901_1924799 3300038443 Bacteria 538
274 Ga0395901_2044732 3300038443 Bacteria 518
275 Ga0436365_0636410 3300039437 Bacteria 1127
276 Ga0451841_0525233 3300041498 Bacteria 563
277 Ga0466969_0023331 3300044656 Bacteria 3189
278 Ga0466972_0223040 3300044658 Bacteria 882
279 Ga0466972_0266399 3300044658 Bacteria 801
280 Ga0466972_0449340 3300044658 Bacteria 605
281 Ga0466972_0525410 3300044658 Bacteria 558
282 Ga0466965_0102977 3300044683 Unclassified 1461
283 Ga0466966_0072697 3300044684 Bacteria 2152
284 Ga0466961_0036778 3300044693 Bacteria 3142
285 Ga0466963_0371582 3300044694 Unclassified 1007
286 Ga0466970_0177440 3300044765 Bacteria 1182
287 Ga0466970_0273216 3300044765 Bacteria 950
288 Ga0466960_0680567 3300044901 Bacteria 616
289 Ga0466960_0691675 3300044901 Bacteria 611
290 Ga0466958_0142736 3300045836 Bacteria 1508
291 Ga0466967_0207070 3300045976 Bacteria 1859
292 Ga0466967_0481219 3300045976 Bacteria 1216
293 Ga0466967_0706903 3300045976 Bacteria 998
294 Ga0466967_1058811 3300045976 Unclassified 808
295 Ga0495639_0379217 3300046475 Bacteria 713
296 Ga0495585_0126558 3300046492 Bacteria 1348
297 Ga0495598_0017202 3300046537 Bacteria 1860
298 Ga0495621_0000088 3300046539 Bacteria 18635
299 Ga0495633_0097295 3300046558 Bacteria 1367
300 Ga0495633_0457560 3300046558 Bacteria 576
301 Ga0495668_0071170 3300046616 Bacteria 1912
302 Ga0495659_0188592 3300046664 Bacteria 842
303 Ga0495661_0399005 3300046665 Bacteria 669
304 Ga0495647_0068077 3300046681 Bacteria 1420
305 Ga0495669_0123834 3300046684 Bacteria 1213
306 Ga0495669_0326651 3300046684 Bacteria 740
307 Ga0495670_0001242 3300046691 Bacteria 12444
308 Ga0495687_200676 3300047443 Unclassified 634
309 Ga0495677_0130888 3300047445 Bacteria 960
310 Ga0496101_0303011 3300048904 Bacteria 1252
311 Ga0496101_0355547 3300048904 Bacteria 1151
312 Ga0496102_0375309 3300048905 Bacteria 1338
313 Ga0496102_0628848 3300048905 Bacteria 997
314 Ga0496102_0788238 3300048905 Bacteria 873
315 Ga0496104_0117370 3300048907 Bacteria 2554
316 Ga0496104_0637207 3300048907 Bacteria 975
317 Ga0496104_0740610 3300048907 Unclassified 890
318 Ga0496106_0857701 3300048909 Bacteria 718
319 Ga0496107_0049428 3300048910 Bacteria 3030
320 Ga0496107_0184846 3300048910 Bacteria 1548
321 Ga0496107_0740215 3300048910 Bacteria 722
322 Ga0496108_0006821 3300048911 Bacteria 9239
323 Ga0496108_0047202 3300048911 Bacteria 3600
324 Ga0496108_0396744 3300048911 Bacteria 1205
325 Ga0496109_0039281 3300048912 Bacteria 4283
326 Ga0496109_0048955 3300048912 Bacteria 3846
327 Ga0496110_0138829 3300048913 Bacteria 2197
328 Ga0496110_0176910 3300048913 Bacteria 1937
329 Ga0496110_0570786 3300048913 Unclassified 1027
330 Ga0496110_1007352 3300048913 Bacteria 740
331 Ga0496110_1820049 3300048913 Bacteria 519
332 Ga0496111_0034246 3300048914 Bacteria 3625
333 Ga0496111_0053579 3300048914 Bacteria 2915
334 Ga0496111_0216670 3300048914 Bacteria 1422
335 Ga0496111_0221453 3300048914 Bacteria 1406
336 Ga0496111_0472046 3300048914 Bacteria 925
337 Ga0496112_0014720 3300048915 Bacteria 7273
338 Ga0496112_0194956 3300048915 Bacteria 1986
339 Ga0496112_1023738 3300048915 Unclassified 745
340 Ga0496113_0217979 3300048916 Bacteria 1520
341 Ga0496113_0234881 3300048916 Bacteria 1462
342 Ga0496113_0952830 3300048916 Unclassified 677
343 nmdc:mga08x19_668242_c1 3300050514 Bacteria 737

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300001991 JGI24743J22301_10160011 JGI24743J22301_101600112 60
2 3300005335 Ga0070666_10553879 Ga0070666_105538793 60
3 3300005543 Ga0070672_101020406 Ga0070672_1010204061 60
4 3300006881 Ga0068865_100487345 Ga0068865_1004873453 60
5 3300009177 Ga0105248_10377944 Ga0105248_103779443 60
6 3300013308 Ga0157375_11572372 Ga0157375_115723723 60
7 3300014968 Ga0157379_12305356 Ga0157379_123053562 60
8 3300025903 Ga0207680_10837193 Ga0207680_108371932 60
9 3300025940 Ga0207691_10916477 Ga0207691_109164772 60
10 3300025941 Ga0207711_10177269 Ga0207711_101772693 60
11 3300025960 Ga0207651_11300287 Ga0207651_113002872 60
12 3300041498 Ga0451841_0525233 Ga0451841_0525233_96_314 61
13 3300046492 Ga0495585_0126558 Ga0495585_0126558_473_688 62
14 3300046537 Ga0495598_0017202 Ga0495598_0017202_516_731 62
15 3300046539 Ga0495621_0000088 Ga0495621_0000088_5526_5741 62
16 3300046558 Ga0495633_0457560 Ga0495633_0457560_314_529 62
17 3300046664 Ga0495659_0188592 Ga0495659_0188592_267_482 62
18 3300046665 Ga0495661_0399005 Ga0495661_0399005_128_343 62
19 3300046684 Ga0495669_0123834 Ga0495669_0123834_782_997 62
20 3300046691 Ga0495670_0001242 Ga0495670_0001242_1024_1239 62
21 3300039437 Ga0436365_0636410 Ga0436365_0636410_473_688 65
22 3300046616 Ga0495668_0071170 Ga0495668_0071170_1240_1455 65
23 3300005331 Ga0070670_100862118 Ga0070670_1008621182 70
24 3300025925 Ga0207650_10533112 Ga0207650_105331123 70
25 3300031548 Ga0307408_102226951 Ga0307408_1022269512 70
26 3300031852 Ga0307410_10062489 Ga0307410_100624893 70
27 3300031995 Ga0307409_101045331 Ga0307409_1010453313 70
28 3300032002 Ga0307416_100265932 Ga0307416_1002659324 70
29 3300001976 JGI24752J21851_1052315 JGI24752J21851_10523152 71
30 3300005293 Ga0065715_10367240 Ga0065715_103672401 71
31 3300005327 Ga0070658_10213241 Ga0070658_102132413 71
32 3300005327 Ga0070658_10744000 Ga0070658_107440002 71
33 3300005331 Ga0070670_100151476 Ga0070670_1001514763 71
34 3300005331 Ga0070670_100235872 Ga0070670_1002358724 71
35 3300005331 Ga0070670_100365249 Ga0070670_1003652492 71
36 3300005333 Ga0070677_10116932 Ga0070677_101169322 71
37 3300005334 Ga0068869_100555859 Ga0068869_1005558594 71
38 3300005337 Ga0070682_100746665 Ga0070682_1007466651 71
39 3300005338 Ga0068868_101509336 Ga0068868_1015093361 71
40 3300005339 Ga0070660_100357945 Ga0070660_1003579453 71
41 3300005339 Ga0070660_100385700 Ga0070660_1003857003 71
42 3300005339 Ga0070660_101296294 Ga0070660_1012962942 71
43 3300005344 Ga0070661_100568719 Ga0070661_1005687193 71
44 3300005344 Ga0070661_100787330 Ga0070661_1007873302 71
45 3300005347 Ga0070668_100957299 Ga0070668_1009572992 71
46 3300005354 Ga0070675_100213634 Ga0070675_1002136343 71
47 3300005355 Ga0070671_100090294 Ga0070671_1000902943 71
48 3300005355 Ga0070671_100179300 Ga0070671_1001793004 71
49 3300005355 Ga0070671_100206393 Ga0070671_1002063931 71
50 3300005364 Ga0070673_100991279 Ga0070673_1009912791 71
51 3300005366 Ga0070659_100274011 Ga0070659_1002740113 71
52 3300005366 Ga0070659_100405389 Ga0070659_1004053891 71
53 3300005366 Ga0070659_102078033 Ga0070659_1020780332 71
54 3300005367 Ga0070667_100032051 Ga0070667_1000320512 71
55 3300005367 Ga0070667_101880297 Ga0070667_1018802971 71
56 3300005435 Ga0070714_100997832 Ga0070714_1009978323 71
57 3300005435 Ga0070714_101176705 Ga0070714_1011767052 71
58 3300005436 Ga0070713_100017058 Ga0070713_1000170586 71
59 3300005455 Ga0070663_100358891 Ga0070663_1003588911 71
60 3300005457 Ga0070662_100289988 Ga0070662_1002899883 71
61 3300005457 Ga0070662_100862223 Ga0070662_1008622232 71
62 3300005539 Ga0068853_100656405 Ga0068853_1006564053 71
63 3300005539 Ga0068853_101035423 Ga0068853_1010354232 71
64 3300005543 Ga0070672_100103650 Ga0070672_1001036504 71
65 3300005547 Ga0070693_100730292 Ga0070693_1007302922 71
66 3300005548 Ga0070665_101556460 Ga0070665_1015564602 71
67 3300005564 Ga0070664_100369469 Ga0070664_1003694692 71
68 3300005564 Ga0070664_100851758 Ga0070664_1008517582 71
69 3300005577 Ga0068857_100023563 Ga0068857_1000235636 71
70 3300005614 Ga0068856_100040561 Ga0068856_1000405616 71
71 3300005614 Ga0068856_101330525 Ga0068856_1013305252 71
72 3300005616 Ga0068852_100583796 Ga0068852_1005837963 71
73 3300005617 Ga0068859_100329334 Ga0068859_1003293342 71
74 3300005618 Ga0068864_100011801 Ga0068864_1000118014 71
75 3300005618 Ga0068864_100021033 Ga0068864_1000210336 71
76 3300005834 Ga0068851_10094240 Ga0068851_100942402 71
77 3300005834 Ga0068851_10266510 Ga0068851_102665102 71
78 3300005841 Ga0068863_100013930 Ga0068863_1000139302 71
79 3300005841 Ga0068863_100020604 Ga0068863_1000206044 71
80 3300005842 Ga0068858_100413521 Ga0068858_1004135212 71
81 3300005844 Ga0068862_100555724 Ga0068862_1005557243 71
82 3300005985 Ga0081539_10033626 Ga0081539_100336264 71
83 3300006028 Ga0070717_10395436 Ga0070717_103954363 71
84 3300006028 Ga0070717_10543484 Ga0070717_105434844 71
85 3300006237 Ga0097621_100167750 Ga0097621_1001677504 71
86 3300006358 Ga0068871_100474371 Ga0068871_1004743711 71
87 3300006852 Ga0075433_11231037 Ga0075433_112310372 71
88 3300006914 Ga0075436_100478636 Ga0075436_1004786363 71
89 3300006931 Ga0097620_100329337 Ga0097620_1003293372 71
90 3300009011 Ga0105251_10036105 Ga0105251_100361052 71
91 3300009174 Ga0105241_11345901 Ga0105241_113459012 71
92 3300009177 Ga0105248_11872850 Ga0105248_118728502 71
93 3300009545 Ga0105237_10318596 Ga0105237_103185962 71
94 3300013100 Ga0157373_10437773 Ga0157373_104377732 71
95 3300013100 Ga0157373_11207290 Ga0157373_112072902 71
96 3300013104 Ga0157370_10566712 Ga0157370_105667122 71
97 3300013105 Ga0157369_11311196 Ga0157369_113111963 71
98 3300013306 Ga0163162_11417065 Ga0163162_114170652 71
99 3300013307 Ga0157372_11066219 Ga0157372_110662194 71
100 3300014325 Ga0163163_11618531 Ga0163163_116185312 71
101 3300014497 Ga0182008_10619897 Ga0182008_106198972 71
102 3300014968 Ga0157379_10197073 Ga0157379_101970733 71
103 3300025321 Ga0207656_10096432 Ga0207656_100964322 71
104 3300025321 Ga0207656_10248355 Ga0207656_102483553 71
105 3300025735 Ga0207713_1214582 Ga0207713_12145821 71
106 3300025904 Ga0207647_10469967 Ga0207647_104699672 71
107 3300025908 Ga0207643_10993032 Ga0207643_109930321 71
108 3300025909 Ga0207705_10074383 Ga0207705_100743833 71
109 3300025909 Ga0207705_10362939 Ga0207705_103629393 71
110 3300025909 Ga0207705_10622904 Ga0207705_106229042 71
111 3300025920 Ga0207649_11225286 Ga0207649_112252862 71
112 3300025921 Ga0207652_10983630 Ga0207652_109836302 71
113 3300025925 Ga0207650_10091948 Ga0207650_100919482 71
114 3300025925 Ga0207650_10208332 Ga0207650_102083323 71
115 3300025925 Ga0207650_10853850 Ga0207650_108538501 71
116 3300025928 Ga0207700_10109315 Ga0207700_101093152 71
117 3300025929 Ga0207664_10847616 Ga0207664_108476161 71
118 3300025931 Ga0207644_10000166 Ga0207644_1000016652 71
119 3300025931 Ga0207644_10399297 Ga0207644_103992973 71
120 3300025931 Ga0207644_10458106 Ga0207644_104581064 71
121 3300025932 Ga0207690_10416849 Ga0207690_104168492 71
122 3300025932 Ga0207690_10787752 Ga0207690_107877523 71
123 3300025932 Ga0207690_11492694 Ga0207690_114926942 71
124 3300025933 Ga0207706_10365383 Ga0207706_103653834 71
125 3300025933 Ga0207706_10394458 Ga0207706_103944582 71
126 3300025939 Ga0207665_10018666 Ga0207665_100186666 71
127 3300025940 Ga0207691_10307392 Ga0207691_103073922 71
128 3300025940 Ga0207691_11219900 Ga0207691_112199002 71
129 3300025941 Ga0207711_10009884 Ga0207711_100098843 71
130 3300025942 Ga0207689_11472557 Ga0207689_114725572 71
131 3300025944 Ga0207661_11563113 Ga0207661_115631132 71
132 3300025945 Ga0207679_10301439 Ga0207679_103014391 71
133 3300025945 Ga0207679_10606040 Ga0207679_106060403 71
134 3300025960 Ga0207651_12107072 Ga0207651_121070721 71
135 3300025972 Ga0207668_12118125 Ga0207668_121181252 71
136 3300025986 Ga0207658_10110428 Ga0207658_101104284 71
137 3300025986 Ga0207658_10304573 Ga0207658_103045735 71
138 3300026035 Ga0207703_10106527 Ga0207703_101065272 71
139 3300026035 Ga0207703_11574336 Ga0207703_115743362 71
140 3300026041 Ga0207639_11009082 Ga0207639_110090823 71
141 3300026067 Ga0207678_10672427 Ga0207678_106724271 71
142 3300026078 Ga0207702_10018452 Ga0207702_100184526 71
143 3300026088 Ga0207641_10006502 Ga0207641_100065028 71
144 3300026088 Ga0207641_10617652 Ga0207641_106176522 71
145 3300026095 Ga0207676_10044583 Ga0207676_100445834 71
146 3300026095 Ga0207676_10059225 Ga0207676_100592255 71
147 3300026116 Ga0207674_10167010 Ga0207674_101670104 71
148 3300028379 Ga0268266_11236882 Ga0268266_112368822 71
149 3300028380 Ga0268265_10244094 Ga0268265_102440942 71
150 3300028381 Ga0268264_11360370 Ga0268264_113603702 71
151 3300035241 Ga0373961_0311222 Ga0373961_0311222_45_263 71
152 3300035725 Ga0373947_0801578 Ga0373947_0801578_141_359 71
153 3300037312 Ga0395899_0015625 Ga0395899_0015625_864_1082 71
154 3300037312 Ga0395899_0101921 Ga0395899_0101921_694_912 71
155 3300037312 Ga0395899_0118940 Ga0395899_0118940_1484_1699 71
156 3300037312 Ga0395899_0164533 Ga0395899_0164533_265_480 71
157 3300037312 Ga0395899_0217920 Ga0395899_0217920_307_525 71
158 3300037312 Ga0395899_0291250 Ga0395899_0291250_58_273 71
159 3300037312 Ga0395899_0402799 Ga0395899_0402799_48_266 71
160 3300037418 Ga0395900_0031044 Ga0395900_0031044_3746_3964 71
161 3300037418 Ga0395900_0038913 Ga0395900_0038913_842_1060 71
162 3300037418 Ga0395900_0079277 Ga0395900_0079277_2662_2880 71
163 3300037418 Ga0395900_0079558 Ga0395900_0079558_53_268 71
164 3300037418 Ga0395900_0150528 Ga0395900_0150528_1269_1487 71
165 3300037418 Ga0395900_0213594 Ga0395900_0213594_890_1108 71
166 3300037418 Ga0395900_0218539 Ga0395900_0218539_325_543 71
167 3300037418 Ga0395900_0316728 Ga0395900_0316728_365_580 71
168 3300037418 Ga0395900_0482081 Ga0395900_0482081_835_1050 71
169 3300037418 Ga0395900_1167215 Ga0395900_1167215_94_309 71
170 3300037418 Ga0395900_1322181 Ga0395900_1322181_328_543 71
171 3300037466 Ga0395898_0008731 Ga0395898_0008731_9345_9563 71
172 3300037466 Ga0395898_0047427 Ga0395898_0047427_3519_3737 71
173 3300037466 Ga0395898_0140535 Ga0395898_0140535_866_1084 71
174 3300037466 Ga0395898_0412458 Ga0395898_0412458_962_1177 71
175 3300037466 Ga0395898_0478779 Ga0395898_0478779_242_460 71
176 3300037466 Ga0395898_0601244 Ga0395898_0601244_608_823 71
177 3300037466 Ga0395898_0833841 Ga0395898_0833841_423_641 71
178 3300037471 Ga0395905_0006460 Ga0395905_0006460_10636_10854 71
179 3300037471 Ga0395905_0007413 Ga0395905_0007413_3465_3683 71
180 3300037471 Ga0395905_0009662 Ga0395905_0009662_4456_4674 71
181 3300037471 Ga0395905_0020501 Ga0395905_0020501_3644_3859 71
182 3300037471 Ga0395905_0063303 Ga0395905_0063303_2057_2272 71
183 3300037471 Ga0395905_0107176 Ga0395905_0107176_522_737 71
184 3300037471 Ga0395905_0334552 Ga0395905_0334552_460_678 71
185 3300037471 Ga0395905_0382346 Ga0395905_0382346_561_779 71
186 3300037471 Ga0395905_0412757 Ga0395905_0412757_532_747 71
187 3300037471 Ga0395905_0451530 Ga0395905_0451530_852_1070 71
188 3300037471 Ga0395905_0471339 Ga0395905_0471339_518_733 71
189 3300037471 Ga0395905_1580183 Ga0395905_1580183_326_541 71
190 3300038443 Ga0395901_0039447 Ga0395901_0039447_931_1149 71
191 3300038443 Ga0395901_0054635 Ga0395901_0054635_3245_3463 71
192 3300038443 Ga0395901_0087856 Ga0395901_0087856_873_1091 71
193 3300038443 Ga0395901_0198412 Ga0395901_0198412_1051_1269 71
194 3300038443 Ga0395901_0235344 Ga0395901_0235344_632_850 71
195 3300038443 Ga0395901_0247165 Ga0395901_0247165_311_526 71
196 3300038443 Ga0395901_0297546 Ga0395901_0297546_521_739 71
197 3300038443 Ga0395901_0376589 Ga0395901_0376589_412_627 71
198 3300038443 Ga0395901_0530073 Ga0395901_0530073_838_1053 71
199 3300038443 Ga0395901_0614578 Ga0395901_0614578_87_302 71
200 3300038443 Ga0395901_0926488 Ga0395901_0926488_422_637 71
201 3300038443 Ga0395901_1837175 Ga0395901_1837175_79_294 71
202 3300038443 Ga0395901_1924799 Ga0395901_1924799_64_279 71
203 3300044658 Ga0466972_0223040 Ga0466972_0223040_10_225 71
204 3300044658 Ga0466972_0449340 Ga0466972_0449340_219_434 71
205 3300044683 Ga0466965_0102977 Ga0466965_0102977_930_1148 71
206 3300044765 Ga0466970_0177440 Ga0466970_0177440_490_705 71
207 3300044901 Ga0466960_0691675 Ga0466960_0691675_205_423 71
208 3300045976 Ga0466967_0207070 Ga0466967_0207070_392_607 71
209 3300046684 Ga0495669_0326651 Ga0495669_0326651_352_573 71
210 3300047443 Ga0495687_200676 Ga0495687_200676_62_280 71
211 3300047445 Ga0495677_0130888 Ga0495677_0130888_120_335 71
212 3300048904 Ga0496101_0303011 Ga0496101_0303011_393_611 71
213 3300048905 Ga0496102_0375309 Ga0496102_0375309_758_976 71
214 3300048905 Ga0496102_0628848 Ga0496102_0628848_325_540 71
215 3300048907 Ga0496104_0637207 Ga0496104_0637207_569_787 71
216 3300048907 Ga0496104_0740610 Ga0496104_0740610_625_840 71
217 3300048909 Ga0496106_0857701 Ga0496106_0857701_353_571 71
218 3300048910 Ga0496107_0049428 Ga0496107_0049428_334_552 71
219 3300048910 Ga0496107_0184846 Ga0496107_0184846_638_853 71
220 3300048910 Ga0496107_0740215 Ga0496107_0740215_253_468 71
221 3300048911 Ga0496108_0006821 Ga0496108_0006821_60_278 71
222 3300048911 Ga0496108_0047202 Ga0496108_0047202_2770_2985 71
223 3300048911 Ga0496108_0396744 Ga0496108_0396744_321_536 71
224 3300048912 Ga0496109_0039281 Ga0496109_0039281_1153_1371 71
225 3300048912 Ga0496109_0048955 Ga0496109_0048955_591_806 71
226 3300048913 Ga0496110_0176910 Ga0496110_0176910_1343_1558 71
227 3300048913 Ga0496110_0570786 Ga0496110_0570786_626_841 71
228 3300048913 Ga0496110_1007352 Ga0496110_1007352_70_288 71
229 3300048913 Ga0496110_1820049 Ga0496110_1820049_90_305 71
230 3300048914 Ga0496111_0034246 Ga0496111_0034246_2900_3118 71
231 3300048914 Ga0496111_0216670 Ga0496111_0216670_545_760 71
232 3300048914 Ga0496111_0221453 Ga0496111_0221453_1077_1292 71
233 3300048914 Ga0496111_0472046 Ga0496111_0472046_141_356 71
234 3300048915 Ga0496112_0014720 Ga0496112_0014720_668_883 71
235 3300048915 Ga0496112_0194956 Ga0496112_0194956_745_963 71
236 3300048915 Ga0496112_1023738 Ga0496112_1023738_405_623 71
237 3300048916 Ga0496113_0217979 Ga0496113_0217979_1094_1312 71
238 3300048916 Ga0496113_0234881 Ga0496113_0234881_618_833 71
239 3300048916 Ga0496113_0952830 Ga0496113_0952830_423_641 71
240 3300050514 nmdc:mga08x19_668242_c1 nmdc:mga08x19_668242_c1_109_327 71
241 3300001915 JGI24741J21665_1014758 JGI24741J21665_10147583 72
242 3300001990 JGI24737J22298_10244968 JGI24737J22298_102449682 72
243 3300005327 Ga0070658_10219551 Ga0070658_102195513 72
244 3300005336 Ga0070680_100479996 Ga0070680_1004799961 72
245 3300005336 Ga0070680_100793955 Ga0070680_1007939552 72
246 3300005339 Ga0070660_100060432 Ga0070660_1000604323 72
247 3300005344 Ga0070661_100100105 Ga0070661_1001001052 72
248 3300005344 Ga0070661_100706630 Ga0070661_1007066301 72
249 3300005345 Ga0070692_10138312 Ga0070692_101383124 72
250 3300005355 Ga0070671_100326665 Ga0070671_1003266654 72
251 3300005455 Ga0070663_100056417 Ga0070663_1000564174 72
252 3300005530 Ga0070679_100004379 Ga0070679_1000043793 72
253 3300005535 Ga0070684_100714304 Ga0070684_1007143044 72
254 3300005563 Ga0068855_100003874 Ga0068855_1000038743 72
255 3300005614 Ga0068856_100753766 Ga0068856_1007537663 72
256 3300006237 Ga0097621_100686714 Ga0097621_1006867144 72
257 3300006358 Ga0068871_100374320 Ga0068871_1003743202 72
258 3300013104 Ga0157370_10506793 Ga0157370_105067932 72
259 3300013105 Ga0157369_10769631 Ga0157369_107696312 72
260 3300025904 Ga0207647_10158335 Ga0207647_101583354 72
261 3300025909 Ga0207705_10044477 Ga0207705_100444773 72
262 3300025919 Ga0207657_10070461 Ga0207657_100704614 72
263 3300025920 Ga0207649_10676438 Ga0207649_106764384 72
264 3300025920 Ga0207649_10761313 Ga0207649_107613133 72
265 3300025921 Ga0207652_10007793 Ga0207652_100077934 72
266 3300025931 Ga0207644_10034465 Ga0207644_100344654 72
267 3300025944 Ga0207661_10588455 Ga0207661_105884554 72
268 3300025949 Ga0207667_10110153 Ga0207667_101101531 72
269 3300025960 Ga0207651_11021647 Ga0207651_110216472 72
270 3300026067 Ga0207678_10001078 Ga0207678_1000107827 72
271 3300026078 Ga0207702_10115857 Ga0207702_101158572 72
272 3300026078 Ga0207702_10430882 Ga0207702_104308823 72
273 3300035091 Ga0373951_0258688 Ga0373951_0258688_173_391 72
274 3300036401 Ga0373937_0354610 Ga0373937_0354610_227_445 72
275 3300037312 Ga0395899_0000523 Ga0395899_0000523_31080_31298 72
276 3300037312 Ga0395899_0000632 Ga0395899_0000632_33554_33772 72
277 3300037312 Ga0395899_0037692 Ga0395899_0037692_3028_3246 72
278 3300037312 Ga0395899_0235107 Ga0395899_0235107_573_791 72
279 3300037312 Ga0395899_0427519 Ga0395899_0427519_293_511 72
280 3300037418 Ga0395900_0000075 Ga0395900_0000075_74038_74256 72
281 3300037418 Ga0395900_0000289 Ga0395900_0000289_73112_73330 72
282 3300037418 Ga0395900_0025689 Ga0395900_0025689_5619_5837 72
283 3300037418 Ga0395900_0038605 Ga0395900_0038605_353_571 72
284 3300037418 Ga0395900_0279243 Ga0395900_0279243_441_659 72
285 3300037418 Ga0395900_0350610 Ga0395900_0350610_303_521 72
286 3300037418 Ga0395900_0459963 Ga0395900_0459963_661_879 72
287 3300037418 Ga0395900_0663710 Ga0395900_0663710_497_715 72
288 3300037418 Ga0395900_1173920 Ga0395900_1173920_349_567 72
289 3300037418 Ga0395900_1512762 Ga0395900_1512762_300_518 72
290 3300037466 Ga0395898_0000055 Ga0395898_0000055_112582_112800 72
291 3300037466 Ga0395898_0004447 Ga0395898_0004447_9133_9351 72
292 3300037466 Ga0395898_0054285 Ga0395898_0054285_3196_3414 72
293 3300037466 Ga0395898_0234607 Ga0395898_0234607_956_1174 72
294 3300037466 Ga0395898_0310803 Ga0395898_0310803_497_715 72
295 3300037466 Ga0395898_0362312 Ga0395898_0362312_1021_1239 72
296 3300037466 Ga0395898_0418600 Ga0395898_0418600_672_890 72
297 3300037466 Ga0395898_0475855 Ga0395898_0475855_362_580 72
298 3300037466 Ga0395898_1169276 Ga0395898_1169276_447_665 72
299 3300037471 Ga0395905_0000067 Ga0395905_0000067_165758_165976 72
300 3300037471 Ga0395905_0004958 Ga0395905_0004958_9645_9863 72
301 3300037471 Ga0395905_0021513 Ga0395905_0021513_434_652 72
302 3300037471 Ga0395905_0037705 Ga0395905_0037705_663_881 72
303 3300037471 Ga0395905_0201565 Ga0395905_0201565_702_920 72
304 3300037471 Ga0395905_0368616 Ga0395905_0368616_638_856 72
305 3300037471 Ga0395905_0371021 Ga0395905_0371021_889_1107 72
306 3300037471 Ga0395905_0393386 Ga0395905_0393386_573_791 72
307 3300037471 Ga0395905_0751428 Ga0395905_0751428_57_275 72
308 3300037471 Ga0395905_0754414 Ga0395905_0754414_219_437 72
309 3300037471 Ga0395905_0999575 Ga0395905_0999575_434_652 72
310 3300037471 Ga0395905_1288286 Ga0395905_1288286_381_599 72
311 3300037471 Ga0395905_1719686 Ga0395905_1719686_203_421 72
312 3300038443 Ga0395901_0000957 Ga0395901_0000957_20185_20403 72
313 3300038443 Ga0395901_0004390 Ga0395901_0004390_10120_10338 72
314 3300038443 Ga0395901_0059071 Ga0395901_0059071_576_794 72
315 3300038443 Ga0395901_0075970 Ga0395901_0075970_246_464 72
316 3300038443 Ga0395901_0155534 Ga0395901_0155534_1109_1327 72
317 3300038443 Ga0395901_0495218 Ga0395901_0495218_649_867 72
318 3300038443 Ga0395901_0540121 Ga0395901_0540121_617_835 72
319 3300038443 Ga0395901_0760072 Ga0395901_0760072_33_251 72
320 3300038443 Ga0395901_0887341 Ga0395901_0887341_616_834 72
321 3300038443 Ga0395901_0924740 Ga0395901_0924740_610_828 72
322 3300038443 Ga0395901_1746002 Ga0395901_1746002_239_457 72
323 3300038443 Ga0395901_2044732 Ga0395901_2044732_37_255 72
324 3300044656 Ga0466969_0023331 Ga0466969_0023331_645_863 72
325 3300044658 Ga0466972_0266399 Ga0466972_0266399_356_574 72
326 3300044658 Ga0466972_0525410 Ga0466972_0525410_158_376 72
327 3300044684 Ga0466966_0072697 Ga0466966_0072697_1511_1729 72
328 3300044693 Ga0466961_0036778 Ga0466961_0036778_175_393 72
329 3300044694 Ga0466963_0371582 Ga0466963_0371582_719_937 72
330 3300044765 Ga0466970_0273216 Ga0466970_0273216_306_524 72
331 3300044901 Ga0466960_0680567 Ga0466960_0680567_236_454 72
332 3300045836 Ga0466958_0142736 Ga0466958_0142736_596_814 72
333 3300045976 Ga0466967_0481219 Ga0466967_0481219_314_532 72
334 3300045976 Ga0466967_0706903 Ga0466967_0706903_230_448 72
335 3300045976 Ga0466967_1058811 Ga0466967_1058811_554_772 72
336 3300046475 Ga0495639_0379217 Ga0495639_0379217_336_554 72
337 3300046558 Ga0495633_0097295 Ga0495633_0097295_960_1178 72
338 3300046681 Ga0495647_0068077 Ga0495647_0068077_672_890 72
339 3300048904 Ga0496101_0355547 Ga0496101_0355547_245_463 72
340 3300048905 Ga0496102_0788238 Ga0496102_0788238_21_239 72
341 3300048907 Ga0496104_0117370 Ga0496104_0117370_418_636 72
342 3300048913 Ga0496110_0138829 Ga0496110_0138829_703_921 72
343 3300048914 Ga0496111_0053579 Ga0496111_0053579_838_1056 72

Structural Annotation

Top 5 Hits

ID Description Score Start End
6h2f-assembly1.cif.gz_D structure of the pre-pore ahlb of the tripartite alpha-pore forming toxin, ahl, from aeromonas hydrophila. 0.8827 2 60
6s1k-assembly1.cif.gz_E e. coli core signaling unit, carrying qqqq receptor mutation 0.8309 2 60
7sat-assembly1.cif.gz_D structure of porlm, the proton-powered motor that drives type ix protein secretion 0.8233 8 54
4j9u-assembly2.cif.gz_D crystal structure of the trkh/trka potassium transport complex 0.7998 5 52
6s1k-assembly1.cif.gz_I e. coli core signaling unit, carrying qqqq receptor mutation 0.7953 2 60
ID Description Score Start End Superfamily
af_Q2FXX6_1_89_1.20.58.400 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;t-snare proteins 0.8909 2 60 1.20.58.400
af_O60635_1_114_1.20.5.780 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;Single helix bin 0.8824 2 60 1.20.5.780
2ch7A00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Methyl-accepting chemotaxis protein 0.8765 2 60 1.10.287.950
af_Q9VB99_8_210_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.8555 1 60 1.20.140.150
4gunL01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Fe,Mn superoxide dismutase (SOD) domain 0.8506 5 63 1.10.287.990
ID Description Score Start End GO Terms
AF-A0A1E3ZQ63-F1-model_v4 Uncharacterized protein 0.9637 5 60 GO:0016020
AF-A0A7S4AZZ1-F1-model_v4 CHAT domain-containing protein 0.9628 2 60 GO:0016020
AF-A0A7J2WRA1-F1-model_v4 Uncharacterized protein 0.9492 2 58 GO:0016020
AF-A0A1D1V4R6-F1-model_v4 Uncharacterized protein 0.9491 2 60 GO:0016020
AF-A0A846Q992-F1-model_v4 Uncharacterized protein 0.9459 2 53 GO:0016020

Feature Viewer

pLDDT pTM Quality
85.48 0.67 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map