F415192

General Info

Members Datasets Scaffolds Average Seq Length
342 247 341 123

Family's Representative Sequence

Representative Sequence 3300025960|Ga0207651_10920454|Ga0207651_109204542
Length 148
Sequence VLFNLSVDDVGQGVLVFNPMVEQRTGVAEDRLSRMFAALADPTRRDMVTRLAAGDATVGELAEPYDVSIQAVSKHIKVLTDAGLVSQSRDAQRRPCHLEAEVFDLMTKWIERYRREAEQRYRRLDAVLAEMQGKRPARSGRRNEGAAS

Samples

Sample ID Description Type Environment
1 2088090001 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB Metagenome Rhizosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
4 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
5 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
10 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
11 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
12 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
13 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
25 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
31 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
32 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
33 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
34 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
35 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
36 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
51 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
61 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
62 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
95 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
96 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
97 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
98 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
99 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
100 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
101 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
102 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
103 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
104 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
105 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
106 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
107 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
108 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
109 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
110 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
111 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
113 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
114 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
115 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
116 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
117 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
118 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
119 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
120 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
121 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
122 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
123 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
124 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
125 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
126 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
127 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
128 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
129 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
130 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
131 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
132 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
133 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
134 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
135 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
136 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
137 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
138 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
139 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
140 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
141 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
142 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
143 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
144 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
145 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
146 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
147 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
148 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
149 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
150 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
151 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
152 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
153 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
154 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
155 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
156 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
157 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
158 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
159 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
160 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
161 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
162 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
163 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
164 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
165 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
166 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
167 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
168 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
169 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
170 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
171 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
172 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
173 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
174 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
175 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
176 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
177 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
178 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
179 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
180 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
181 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
182 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
183 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
184 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
185 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
186 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
187 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
188 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
189 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
190 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
191 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
192 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
193 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
194 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
195 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
196 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
197 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
198 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
199 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
200 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
201 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
202 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
217 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
218 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
219 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
220 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
221 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
222 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
223 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
224 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
225 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
226 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
227 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
228 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
229 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
232 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
233 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
234 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
235 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
236 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
237 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
238 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
239 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
240 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
241 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
242 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
243 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
244 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
245 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
246 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
247 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.42
Metatranscriptomes 0.29
Isolates 0.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.51
Nodule 0
Rhizoplane 6.43
Rhizosphere 87.72
Stem 0
Stem Tuber 0
Unclassified 2.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNB_F6ESG4R02FWBCL 2088090001 Bacteria 502
2 JGI25405J52794_10050139 3300003911 Bacteria 894
3 Ga0070689_101025418 3300005340 Bacteria 735
4 Ga0070673_101146568 3300005364 Bacteria 727
5 Ga0070667_101640083 3300005367 Bacteria 605
6 Ga0070709_10529672 3300005434 Bacteria 899
7 Ga0070714_100782062 3300005435 Bacteria 924
8 Ga0070711_101183044 3300005439 Bacteria 661
9 Ga0070705_100226823 3300005440 Bacteria 1297
10 Ga0070700_101157874 3300005441 Bacteria 644
11 Ga0070694_100143682 3300005444 Bacteria 1736
12 Ga0070662_100725278 3300005457 Bacteria 842
13 Ga0068867_100624382 3300005459 Bacteria 943
14 Ga0070698_100425762 3300005471 Bacteria 1262
15 Ga0070679_101765769 3300005530 Bacteria 567
16 Ga0070684_100778202 3300005535 Bacteria 894
17 Ga0070684_101375615 3300005535 Bacteria 665
18 Ga0068853_100126977 3300005539 Bacteria 2279
19 Ga0070696_100823065 3300005546 Bacteria 766
20 Ga0070665_100817714 3300005548 Bacteria 945
21 Ga0070704_100053388 3300005549 Bacteria 2856
22 Ga0070664_101062498 3300005564 Bacteria 762
23 Ga0070664_102042561 3300005564 Bacteria 544
24 Ga0068854_100498254 3300005578 Bacteria 1025
25 Ga0068856_101770013 3300005614 Bacteria 630
26 Ga0070702_100580781 3300005615 Bacteria 837
27 Ga0070702_100893932 3300005615 Bacteria 695
28 Ga0068870_10929294 3300005840 Bacteria 616
29 Ga0068863_100752001 3300005841 Unclassified 971
30 Ga0068860_100578793 3300005843 Bacteria 1127
31 Ga0068862_101747349 3300005844 Bacteria 631
32 Ga0068862_102523953 3300005844 Bacteria 526
33 Ga0081455_10018565 3300005937 Bacteria 6616
34 Ga0081538_10113557 3300005981 Bacteria 1322
35 Ga0075365_10023716 3300006038 Bacteria 3862
36 Ga0075365_10523945 3300006038 Bacteria 838
37 Ga0075365_10825648 3300006038 Bacteria 654
38 Ga0075368_10343364 3300006042 Bacteria 649
39 Ga0075368_10544733 3300006042 Bacteria 521
40 Ga0075363_100130948 3300006048 Bacteria 1407
41 Ga0070716_100024596 3300006173 Bacteria 3207
42 Ga0070712_100268860 3300006175 Bacteria 1369
43 Ga0075367_10110221 3300006178 Bacteria 1689
44 Ga0068871_100750260 3300006358 Bacteria 897
45 Ga0068871_100791045 3300006358 Bacteria 874
46 Ga0075428_100388493 3300006844 Bacteria 1496
47 Ga0075428_102017160 3300006844 Bacteria 598
48 Ga0075433_10377402 3300006852 Bacteria 1252
49 Ga0068865_101422692 3300006881 Bacteria 619
50 Ga0075435_100486756 3300007076 Bacteria 1066
51 Ga0075435_100762512 3300007076 Bacteria 842
52 Ga0111539_10229249 3300009094 Bacteria 2163
53 Ga0111539_10618525 3300009094 Bacteria 1261
54 Ga0111539_12170306 3300009094 Bacteria 644
55 Ga0105245_11166116 3300009098 Bacteria 818
56 Ga0105243_10366610 3300009148 Bacteria 1328
57 Ga0105243_10891354 3300009148 Bacteria 884
58 Ga0105243_11716045 3300009148 Bacteria 657
59 Ga0105241_11025600 3300009174 Bacteria 773
60 Ga0105242_10842600 3300009176 Bacteria 912
61 Ga0105248_11082457 3300009177 Bacteria 906
62 Ga0105028_111239 3300009993 Unclassified 942
63 Ga0105239_10179479 3300010375 Bacteria 2369
64 Ga0105239_10700725 3300010375 Bacteria 1158
65 Ga0105239_10858715 3300010375 Bacteria 1041
66 Ga0105239_11318166 3300010375 Bacteria 833
67 Ga0105246_10970387 3300011119 Bacteria 767
68 Ga0157373_10746962 3300013100 Bacteria 719
69 Ga0157374_11528172 3300013296 Bacteria 691
70 Ga0157374_12225472 3300013296 Bacteria 575
71 Ga0157378_11234266 3300013297 Bacteria 788
72 Ga0163162_11277005 3300013306 Bacteria 834
73 Ga0157375_11602960 3300013308 Bacteria 770
74 Ga0157375_12414311 3300013308 Bacteria 627
75 Ga0157375_12576457 3300013308 Bacteria 608
76 Ga0163163_10553685 3300014325 Bacteria 1213
77 Ga0163163_12468997 3300014325 Bacteria 578
78 Ga0157377_10951890 3300014745 Bacteria 646
79 Ga0157379_10444307 3300014968 Bacteria 1196
80 Ga0157376_10910364 3300014969 Bacteria 898
81 Ga0157376_11418600 3300014969 Bacteria 726
82 Ga0213873_10004803 3300021358 Bacteria 2549
83 Ga0213876_10028141 3300021384 Bacteria 2963
84 Ga0207713_1034358 3300025735 Bacteria 2203
85 Ga0207692_10462064 3300025898 Bacteria 801
86 Ga0207685_10107366 3300025905 Bacteria 1204
87 Ga0207699_10068495 3300025906 Bacteria 2161
88 Ga0207693_10082127 3300025915 Bacteria 2523
89 Ga0207663_11669972 3300025916 Bacteria 512
90 Ga0207681_10336901 3300025923 Bacteria 1204
91 Ga0207687_11199309 3300025927 Bacteria 652
92 Ga0207687_11233906 3300025927 Bacteria 643
93 Ga0207687_11450864 3300025927 Bacteria 590
94 Ga0207700_10133003 3300025928 Bacteria 2034
95 Ga0207706_11552682 3300025933 Bacteria 538
96 Ga0207686_10548416 3300025934 Bacteria 903
97 Ga0207686_11492554 3300025934 Bacteria 557
98 Ga0207709_10240631 3300025935 Bacteria 1316
99 Ga0207709_11181320 3300025935 Bacteria 630
100 Ga0207670_10798474 3300025936 Bacteria 786
101 Ga0207711_11348626 3300025941 Bacteria 656
102 Ga0207679_10884901 3300025945 Bacteria 816
103 Ga0207679_11914212 3300025945 Bacteria 541
104 Ga0207651_10920454 3300025960 Bacteria 779
105 Ga0207712_10378943 3300025961 Bacteria 1183
106 Ga0207668_10588857 3300025972 Bacteria 968
107 Ga0207658_11053187 3300025986 Bacteria 743
108 Ga0207677_11650854 3300026023 Bacteria 594
109 Ga0207703_10017685 3300026035 Bacteria 5566
110 Ga0207639_10118168 3300026041 Bacteria 2174
111 Ga0207639_12184674 3300026041 Bacteria 515
112 Ga0207678_10539674 3300026067 Bacteria 1019
113 Ga0207708_10174413 3300026075 Unclassified 1704
114 Ga0207708_10744742 3300026075 Bacteria 841
115 Ga0207641_10908932 3300026088 Bacteria 874
116 Ga0207648_10172712 3300026089 Bacteria 1911
117 Ga0207648_11954145 3300026089 Bacteria 548
118 Ga0207676_10491413 3300026095 Bacteria 1164
119 Ga0207675_100756910 3300026118 Bacteria 983
120 Ga0207683_11460820 3300026121 Bacteria 632
121 Ga0268266_10594588 3300028379 Bacteria 1063
122 Ga0268266_10825159 3300028379 Bacteria 896
123 Ga0268265_10848125 3300028380 Bacteria 894
124 Ga0268265_11102497 3300028380 Bacteria 788
125 Ga0268264_10412272 3300028381 Bacteria 1301
126 Ga0265327_10010059 3300031251 Bacteria 6713
127 Ga0265327_10014684 3300031251 Bacteria 5109
128 Ga0265313_10110704 3300031595 Bacteria 1208
129 Ga0307508_10172561 3300031616 Bacteria 1766
130 Ga0307413_11934397 3300031824 Bacteria 530
131 Ga0307518_10061739 3300031838 Bacteria 2721
132 Ga0373948_0090442 3300034817 Bacteria 710
133 Ga0373934_0255447 3300035086 Bacteria 725
134 Ga0373940_0222670 3300035088 Bacteria 627
135 Ga0373945_0022545 3300035116 Bacteria 2170
136 Ga0373953_0151124 3300035117 Bacteria 996
137 Ga0373954_0240092 3300035118 Bacteria 892
138 Ga0373943_0102004 3300035170 Bacteria 1502
139 Ga0373931_0000080 3300035691 Bacteria 44704
140 Ga0373935_0154441 3300035692 Bacteria 1560
141 Ga0373927_0901097 3300035695 Bacteria 584
142 Ga0373933_0192247 3300035724 Bacteria 1304
143 Ga0373947_0300609 3300035725 Bacteria 1070
144 Ga0373937_0106582 3300036401 Bacteria 2605
145 Ga0373925_0829547 3300037068 Bacteria 762
146 Ga0395898_0008507 3300037466 Bacteria 10843
147 Ga0395901_0473794 3300038443 Bacteria 1278
148 Ga0436365_0306872 3300039437 Bacteria 1092
149 Ga0436365_1425313 3300039437 Bacteria 14692
150 Ga0436362_0513590 3300039453 Bacteria 5545
151 Ga0436362_0798996 3300039453 Bacteria 520
152 Ga0451791_1835344 3300041451 Bacteria 555
153 Ga0451797_0791348 3300041453 Bacteria 3428
154 Ga0451807_2260731 3300041486 Bacteria 557
155 Ga0451835_0010128 3300041492 Bacteria 603
156 Ga0451839_0215989 3300041496 Bacteria 613
157 Ga0450918_120627 3300042531 Bacteria 524
158 Ga0439440_0228146 3300042993 Bacteria 561
159 Ga0466972_0565139 3300044658 Bacteria 537
160 Ga0466966_0154640 3300044684 Bacteria 1398
161 Ga0466961_0239067 3300044693 Bacteria 1116
162 Ga0466963_0211607 3300044694 Bacteria 1357
163 Ga0466964_0198564 3300044706 Bacteria 961
164 Ga0466970_0088911 3300044765 Bacteria 1675
165 Ga0466957_0642592 3300044842 Bacteria 745
166 Ga0466960_0195624 3300044901 Bacteria 1102
167 Ga0466959_0429281 3300045049 Bacteria 897
168 Ga0466958_0122136 3300045836 Bacteria 1631
169 Ga0466967_2489692 3300045976 Bacteria 512
170 Ga0495627_177379 3300046453 Bacteria 591
171 Ga0495592_0217684 3300046454 Bacteria 1279
172 Ga0495603_0082633 3300046455 Bacteria 1881
173 Ga0495629_0015161 3300046459 Bacteria 5540
174 Ga0495629_0110028 3300046459 Bacteria 1921
175 Ga0495629_0360897 3300046459 Bacteria 990
176 Ga0495638_0555776 3300046460 Bacteria 570
177 Ga0495651_0011676 3300046462 Bacteria 6752
178 Ga0495653_0266761 3300046463 Bacteria 1129
179 Ga0495582_0536781 3300046473 Bacteria 676
180 Ga0495605_0015478 3300046474 Bacteria 4147
181 Ga0495639_0069738 3300046475 Bacteria 1622
182 Ga0495639_0593871 3300046475 Bacteria 569
183 Ga0495662_0001668 3300046476 Bacteria 11068
184 Ga0495662_0236388 3300046476 Bacteria 900
185 Ga0495585_0126130 3300046492 Bacteria 1350
186 Ga0495594_0059235 3300046499 Bacteria 2117
187 Ga0495594_0228826 3300046499 Bacteria 1060
188 Ga0495607_0053087 3300046501 Bacteria 2344
189 Ga0495583_0152339 3300046506 Bacteria 958
190 Ga0495606_0004553 3300046507 Bacteria 13778
191 Ga0495608_0012209 3300046511 Bacteria 5970
192 Ga0495608_0777028 3300046511 Bacteria 566
193 Ga0495616_0100488 3300046513 Bacteria 1357
194 Ga0495620_0005950 3300046515 Bacteria 6758
195 Ga0495630_0802075 3300046517 Bacteria 719
196 Ga0495630_0898919 3300046517 Bacteria 675
197 Ga0495630_0899792 3300046517 Bacteria 674
198 Ga0495648_0035820 3300046524 Bacteria 3212
199 Ga0495652_0150952 3300046529 Bacteria 1816
200 Ga0495640_0853604 3300046533 Bacteria 541
201 Ga0495587_0114425 3300046536 Bacteria 1548
202 Ga0495587_0310489 3300046536 Bacteria 881
203 Ga0495622_0166273 3300046557 Bacteria 993
204 Ga0495667_0146944 3300046559 Bacteria 1518
205 Ga0495668_0039199 3300046616 Bacteria 2645
206 Ga0495611_0508932 3300046648 Bacteria 547
207 Ga0495625_0011064 3300046660 Bacteria 7394
208 Ga0495635_0557540 3300046663 Bacteria 751
209 Ga0495661_0153142 3300046665 Bacteria 1244
210 Ga0495588_0058569 3300046674 Bacteria 1991
211 Ga0495657_0201877 3300046675 Bacteria 1211
212 Ga0495623_0080715 3300046679 Bacteria 2013
213 Ga0495646_0438938 3300046680 Bacteria 675
214 Ga0495647_0187871 3300046681 Bacteria 902
215 Ga0495658_0613521 3300046683 Bacteria 697
216 Ga0495613_0011252 3300046689 Bacteria 6648
217 Ga0495613_0396754 3300046689 Bacteria 941
218 Ga0495670_0057930 3300046691 Bacteria 1945
219 Ga0495649_0074825 3300046694 Bacteria 1814
220 Ga0495649_0268731 3300046694 Bacteria 873
221 Ga0495649_0315313 3300046694 Bacteria 794
222 Ga0495589_0012642 3300046794 Bacteria 4366
223 Ga0495589_0132093 3300046794 Bacteria 1198
224 Ga0495600_0087006 3300046809 Bacteria 2039
225 Ga0495600_0184115 3300046809 Bacteria 1345
226 Ga0495660_0091018 3300046810 Bacteria 1585
227 Ga0495604_0192477 3300047317 Bacteria 1420
228 Ga0495636_0003098 3300047318 Bacteria 6452
229 Ga0495636_0027563 3300047318 Bacteria 2314
230 Ga0495674_0113562 3300047319 Bacteria 2294
231 Ga0495674_0658388 3300047319 Bacteria 825
232 Ga0495672_0496327 3300047320 Bacteria 543
233 Ga0495676_1033750 3300047321 Bacteria 523
234 Ga0495680_0058676 3300047322 Bacteria 2973
235 Ga0495680_0245214 3300047322 Bacteria 1271
236 Ga0495683_0020245 3300047323 Bacteria 3433
237 Ga0495687_007595 3300047443 Bacteria 6352
238 Ga0495675_0050975 3300047444 Bacteria 2630
239 Ga0495675_0073946 3300047444 Bacteria 2148
240 Ga0495677_0259776 3300047445 Bacteria 680
241 Ga0495685_003755 3300047447 Bacteria 4863
242 Ga0495685_026502 3300047447 Bacteria 1994
243 Ga0495685_026688 3300047447 Bacteria 1986
244 Ga0495684_0372699 3300047471 Bacteria 1009
245 Ga0495602_0118226 3300048088 Bacteria 2138
246 Ga0495614_0142989 3300048089 Bacteria 1064
247 Ga0495626_0018072 3300048091 Bacteria 3549
248 Ga0496104_0018747 3300048907 Bacteria 6319
249 Ga0496104_0034486 3300048907 Bacteria 4720
250 Ga0496104_0179062 3300048907 Bacteria 2030
251 Ga0496105_0372330 3300048908 Bacteria 1138
252 Ga0496105_1337428 3300048908 Bacteria 522
253 Ga0496107_0913911 3300048910 Bacteria 639
254 Ga0496108_0267270 3300048911 Bacteria 1489
255 Ga0496108_0735779 3300048911 Bacteria 854
256 Ga0496108_0987302 3300048911 Bacteria 720
257 Ga0496108_1210633 3300048911 Bacteria 638
258 Ga0496109_0030226 3300048912 Bacteria 4856
259 Ga0496109_0507189 3300048912 Bacteria 1139
260 Ga0496109_0661539 3300048912 Bacteria 982
261 Ga0496109_0867157 3300048912 Bacteria 841
262 Ga0496111_0846072 3300048914 Bacteria 661
263 Ga0496112_0033140 3300048915 Bacteria 5019
264 Ga0496112_1712040 3300048915 Bacteria 541
265 Ga0496113_0795841 3300048916 Bacteria 751
266 Ga0496114_0015537 3300048917 Bacteria 6121
267 Ga0501031_0082888 3300049568 Bacteria 2090
268 Ga0501031_0110661 3300049568 Bacteria 1794
269 Ga0501033_0020055 3300049570 Bacteria 5054
270 Ga0501034_0233279 3300049571 Bacteria 1788
271 Ga0501036_0018591 3300049572 Bacteria 5826
272 Ga0501036_0650443 3300049572 Unclassified 873
273 Ga0501036_1055684 3300049572 Bacteria 664
274 Ga0501037_0279083 3300049573 Bacteria 1164
275 Ga0501038_0507508 3300049574 Bacteria 921
276 Ga0501038_0635952 3300049574 Bacteria 804
277 Ga0501039_0014883 3300049575 Bacteria 5949
278 Ga0501040_0000764 3300049576 Bacteria 19964
279 Ga0501040_0133450 3300049576 Bacteria 1747
280 Ga0501040_0415786 3300049576 Bacteria 966
281 Ga0501041_0001954 3300049577 Bacteria 11577
282 Ga0501041_0102121 3300049577 Bacteria 1776
283 Ga0501041_0213661 3300049577 Bacteria 1210
284 Ga0501042_0136925 3300049578 Bacteria 1765
285 Ga0501043_0621824 3300049579 Bacteria 796
286 Ga0501046_0058085 3300049580 Bacteria 3033
287 Ga0501046_1058582 3300049580 Bacteria 561
288 Ga0501047_0045575 3300049581 Bacteria 4240
289 Ga0501048_0011342 3300049582 Bacteria 6646
290 Ga0501048_0084154 3300049582 Bacteria 2243
291 Ga0501067_0229947 3300049583 Bacteria 1032
292 Ga0501068_0009487 3300049584 Bacteria 5449
293 Ga0501070_0028877 3300049586 Bacteria 4650
294 Ga0501070_0388363 3300049586 Bacteria 1130
295 Ga0501071_0320125 3300049587 Bacteria 1178
296 Ga0501072_0002994 3300049588 Bacteria 12735
297 Ga0501072_0456972 3300049588 Bacteria 1011
298 Ga0501072_1207899 3300049588 Bacteria 587
299 Ga0501073_0111199 3300049589 Bacteria 1900
300 Ga0501074_0057472 3300049590 Bacteria 2803
301 Ga0501074_0083573 3300049590 Bacteria 2289
302 Ga0501074_0180592 3300049590 Bacteria 1506
303 Ga0501075_0001776 3300049591 Bacteria 14187
304 Ga0501075_0285406 3300049591 Bacteria 1257
305 Ga0501076_0012619 3300049592 Bacteria 6322
306 Ga0501076_0057825 3300049592 Bacteria 3080
307 Ga0501079_0055830 3300049741 Bacteria 3047
308 Ga0501079_1254661 3300049741 Bacteria 584
309 Ga0501080_0198405 3300049742 Bacteria 1843
310 Ga0501080_1558188 3300049742 Bacteria 560
311 Ga0501081_0004027 3300049743 Bacteria 9424
312 Ga0501083_0567539 3300049744 Bacteria 738
313 Ga0501083_0847108 3300049744 Bacteria 595
314 Ga0501035_0673162 3300049822 Bacteria 837
315 Ga0501044_0450470 3300049823 Bacteria 1194
316 Ga0501044_0667793 3300049823 Bacteria 927
317 Ga0501045_0027654 3300049824 Bacteria 4089
318 Ga0501045_0348056 3300049824 Bacteria 1103
319 nmdc:mga03n38_98316_c1 3300050490 Bacteria 1407
320 nmdc:mga00v17_452114_c1 3300050491 Bacteria 834
321 nmdc:mga0yw44_4532_c1 3300050492 Bacteria 6392
322 nmdc:mga06z11_46742_c1 3300050494 Bacteria 2195
323 nmdc:mga04h51_442044_c1 3300050495 Bacteria 549
324 nmdc:mga0rr50_515681_c1 3300050513 Bacteria 1017
325 nmdc:mga0rr50_555145_c1 3300050513 Bacteria 978
326 nmdc:mga0a205_494649_c1 3300050515 Bacteria 1080
327 Ga0495601_0335331 3300053077 Bacteria 984
328 Ga0495612_0063637 3300053078 Bacteria 1530
329 Ga0495595_0011599 3300053084 Bacteria 3688
330 Ga0495595_0155302 3300053084 Bacteria 1127
331 Ga0495619_0019510 3300053085 Bacteria 4312
332 Ga0495619_0066813 3300053085 Bacteria 2400
333 Ga0495619_0294225 3300053085 Bacteria 1125
334 Ga0495619_0431392 3300053085 Bacteria 909
335 Ga0495619_0510727 3300053085 Bacteria 826
336 Ga0501084_0018608 3300054114 Bacteria 5781
337 Ga0501084_0268839 3300054114 Bacteria 1439
338 Ga0501084_0615374 3300054114 Bacteria 917
339 Ga0587125_037213 3300059607 Bacteria 645
340 Ga0501082_0026601 3300060353 Bacteria 4987
341 Ga0530510_0001779 3300061734 Bacteria 14689

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026121 Ga0207683_11460820 Ga0207683_114608202 101
2 3300031251 Ga0265327_10010059 Ga0265327_100100599 102
3 3300048908 Ga0496105_0372330 Ga0496105_0372330_463_909 115
4 3300048912 Ga0496109_0661539 Ga0496109_0661539_316_675 115
5 3300048917 Ga0496114_0015537 Ga0496114_0015537_331_777 115
6 3300044693 Ga0466961_0239067 Ga0466961_0239067_580_936 116
7 3300044765 Ga0466970_0088911 Ga0466970_0088911_319_675 116
8 3300045836 Ga0466958_0122136 Ga0466958_0122136_28_384 116
9 3300014325 Ga0163163_10553685 Ga0163163_105536852 117
10 3300026095 Ga0207676_10491413 Ga0207676_104914133 117
11 3300044706 Ga0466964_0198564 Ga0466964_0198564_158_559 117
12 3300044842 Ga0466957_0642592 Ga0466957_0642592_162_563 117
13 3300044901 Ga0466960_0195624 Ga0466960_0195624_549_965 117
14 3300048910 Ga0496107_0913911 Ga0496107_0913911_141_587 117
15 3300048915 Ga0496112_1712040 Ga0496112_1712040_73_447 117
16 3300041453 Ga0451797_0791348 Ga0451797_0791348_1126_1491 118
17 3300044684 Ga0466966_0154640 Ga0466966_0154640_954_1322 118
18 3300044694 Ga0466963_0211607 Ga0466963_0211607_505_864 118
19 3300045049 Ga0466959_0429281 Ga0466959_0429281_366_725 118
20 3300049584 Ga0501068_0009487 Ga0501068_0009487_4471_4833 118
21 3300005843 Ga0068860_100578793 Ga0068860_1005787933 119
22 3300006042 Ga0075368_10544733 Ga0075368_105447331 119
23 3300006844 Ga0075428_100388493 Ga0075428_1003884933 119
24 3300006844 Ga0075428_102017160 Ga0075428_1020171602 119
25 3300009094 Ga0111539_10618525 Ga0111539_106185252 119
26 3300009098 Ga0105245_11166116 Ga0105245_111661161 119
27 3300009993 Ga0105028_111239 Ga0105028_1112391 119
28 3300028381 Ga0268264_10412272 Ga0268264_104122723 119
29 3300039437 Ga0436365_0306872 Ga0436365_0306872_460_825 119
30 3300041486 Ga0451807_2260731 Ga0451807_2260731_124_507 119
31 3300044658 Ga0466972_0565139 Ga0466972_0565139_105_518 119
32 3300048911 Ga0496108_0735779 Ga0496108_0735779_454_834 119
33 3300048911 Ga0496108_1210633 Ga0496108_1210633_191_553 119
34 3300049572 Ga0501036_1055684 Ga0501036_1055684_86_451 119
35 3300049576 Ga0501040_0415786 Ga0501040_0415786_365_730 119
36 3300049577 Ga0501041_0102121 Ga0501041_0102121_274_639 119
37 3300049579 Ga0501043_0621824 Ga0501043_0621824_315_680 119
38 3300049582 Ga0501048_0084154 Ga0501048_0084154_148_513 119
39 3300049590 Ga0501074_0057472 Ga0501074_0057472_787_1152 119
40 3300049591 Ga0501075_0285406 Ga0501075_0285406_600_965 119
41 3300049592 Ga0501076_0057825 Ga0501076_0057825_1516_1881 119
42 3300049741 Ga0501079_1254661 Ga0501079_1254661_137_502 119
43 3300049742 Ga0501080_1558188 Ga0501080_1558188_170_535 119
44 3300049744 Ga0501083_0847108 Ga0501083_0847108_77_442 119
45 3300054114 Ga0501084_0268839 Ga0501084_0268839_147_512 119
46 3300005471 Ga0070698_100425762 Ga0070698_1004257622 120
47 3300005539 Ga0068853_100126977 Ga0068853_1001269772 120
48 3300005578 Ga0068854_100498254 Ga0068854_1004982541 120
49 3300005614 Ga0068856_101770013 Ga0068856_1017700131 120
50 3300005841 Ga0068863_100752001 Ga0068863_1007520012 120
51 3300006175 Ga0070712_100268860 Ga0070712_1002688601 120
52 3300010375 Ga0105239_10700725 Ga0105239_107007252 120
53 3300010375 Ga0105239_11318166 Ga0105239_113181662 120
54 3300025735 Ga0207713_1034358 Ga0207713_10343582 120
55 3300025898 Ga0207692_10462064 Ga0207692_104620642 120
56 3300026041 Ga0207639_10118168 Ga0207639_101181683 120
57 3300026088 Ga0207641_10908932 Ga0207641_109089322 120
58 3300026089 Ga0207648_11954145 Ga0207648_119541451 120
59 3300031616 Ga0307508_10172561 Ga0307508_101725611 120
60 3300031838 Ga0307518_10061739 Ga0307518_100617393 120
61 3300037466 Ga0395898_0008507 Ga0395898_0008507_7999_8361 120
62 3300046455 Ga0495603_0082633 Ga0495603_0082633_1459_1821 120
63 3300046459 Ga0495629_0015161 Ga0495629_0015161_2229_2591 120
64 3300046459 Ga0495629_0360897 Ga0495629_0360897_398_760 120
65 3300046460 Ga0495638_0555776 Ga0495638_0555776_26_388 120
66 3300046473 Ga0495582_0536781 Ga0495582_0536781_148_510 120
67 3300046474 Ga0495605_0015478 Ga0495605_0015478_345_707 120
68 3300046475 Ga0495639_0069738 Ga0495639_0069738_101_463 120
69 3300046476 Ga0495662_0001668 Ga0495662_0001668_9613_9975 120
70 3300046476 Ga0495662_0236388 Ga0495662_0236388_171_533 120
71 3300046492 Ga0495585_0126130 Ga0495585_0126130_957_1319 120
72 3300046499 Ga0495594_0059235 Ga0495594_0059235_254_616 120
73 3300046499 Ga0495594_0228826 Ga0495594_0228826_444_806 120
74 3300046501 Ga0495607_0053087 Ga0495607_0053087_22_384 120
75 3300046506 Ga0495583_0152339 Ga0495583_0152339_71_433 120
76 3300046507 Ga0495606_0004553 Ga0495606_0004553_12652_13014 120
77 3300046513 Ga0495616_0100488 Ga0495616_0100488_731_1093 120
78 3300046515 Ga0495620_0005950 Ga0495620_0005950_2643_3005 120
79 3300046517 Ga0495630_0898919 Ga0495630_0898919_98_460 120
80 3300046517 Ga0495630_0899792 Ga0495630_0899792_228_590 120
81 3300046524 Ga0495648_0035820 Ga0495648_0035820_122_484 120
82 3300046557 Ga0495622_0166273 Ga0495622_0166273_150_512 120
83 3300046616 Ga0495668_0039199 Ga0495668_0039199_1504_1866 120
84 3300046648 Ga0495611_0508932 Ga0495611_0508932_46_408 120
85 3300046660 Ga0495625_0011064 Ga0495625_0011064_5333_5695 120
86 3300046665 Ga0495661_0153142 Ga0495661_0153142_311_673 120
87 3300046674 Ga0495588_0058569 Ga0495588_0058569_903_1265 120
88 3300046675 Ga0495657_0201877 Ga0495657_0201877_351_713 120
89 3300046681 Ga0495647_0187871 Ga0495647_0187871_49_411 120
90 3300046689 Ga0495613_0011252 Ga0495613_0011252_1745_2107 120
91 3300046689 Ga0495613_0396754 Ga0495613_0396754_66_428 120
92 3300046691 Ga0495670_0057930 Ga0495670_0057930_1110_1472 120
93 3300046694 Ga0495649_0074825 Ga0495649_0074825_316_678 120
94 3300046794 Ga0495589_0012642 Ga0495589_0012642_624_986 120
95 3300046794 Ga0495589_0132093 Ga0495589_0132093_308_670 120
96 3300046809 Ga0495600_0087006 Ga0495600_0087006_1072_1434 120
97 3300046810 Ga0495660_0091018 Ga0495660_0091018_381_743 120
98 3300047318 Ga0495636_0003098 Ga0495636_0003098_3140_3502 120
99 3300047318 Ga0495636_0027563 Ga0495636_0027563_1827_2189 120
100 3300047320 Ga0495672_0496327 Ga0495672_0496327_110_472 120
101 3300047323 Ga0495683_0020245 Ga0495683_0020245_725_1087 120
102 3300047443 Ga0495687_007595 Ga0495687_007595_936_1298 120
103 3300047444 Ga0495675_0073946 Ga0495675_0073946_1586_1948 120
104 3300047445 Ga0495677_0259776 Ga0495677_0259776_276_638 120
105 3300047447 Ga0495685_003755 Ga0495685_003755_2293_2655 120
106 3300047447 Ga0495685_026502 Ga0495685_026502_111_473 120
107 3300047447 Ga0495685_026688 Ga0495685_026688_1096_1458 120
108 3300048089 Ga0495614_0142989 Ga0495614_0142989_454_816 120
109 3300048091 Ga0495626_0018072 Ga0495626_0018072_1467_1829 120
110 3300048908 Ga0496105_1337428 Ga0496105_1337428_39_419 120
111 3300048911 Ga0496108_0267270 Ga0496108_0267270_566_928 120
112 3300048912 Ga0496109_0030226 Ga0496109_0030226_1542_1904 120
113 3300049587 Ga0501071_0320125 Ga0501071_0320125_751_1116 120
114 3300005367 Ga0070667_101640083 Ga0070667_1016400831 121
115 3300005434 Ga0070709_10529672 Ga0070709_105296722 121
116 3300005435 Ga0070714_100782062 Ga0070714_1007820622 121
117 3300005439 Ga0070711_101183044 Ga0070711_1011830441 121
118 3300005530 Ga0070679_101765769 Ga0070679_1017657692 121
119 3300005535 Ga0070684_100778202 Ga0070684_1007782022 121
120 3300005535 Ga0070684_101375615 Ga0070684_1013756152 121
121 3300006048 Ga0075363_100130948 Ga0075363_1001309482 121
122 3300006173 Ga0070716_100024596 Ga0070716_1000245963 121
123 3300006178 Ga0075367_10110221 Ga0075367_101102213 121
124 3300006881 Ga0068865_101422692 Ga0068865_1014226921 121
125 3300009148 Ga0105243_10366610 Ga0105243_103666102 121
126 3300009174 Ga0105241_11025600 Ga0105241_110256002 121
127 3300010375 Ga0105239_10179479 Ga0105239_101794794 121
128 3300010375 Ga0105239_10858715 Ga0105239_108587153 121
129 3300013296 Ga0157374_11528172 Ga0157374_115281722 121
130 3300013306 Ga0163162_11277005 Ga0163162_112770051 121
131 3300013308 Ga0157375_12576457 Ga0157375_125764572 121
132 3300025906 Ga0207699_10068495 Ga0207699_100684952 121
133 3300025915 Ga0207693_10082127 Ga0207693_100821272 121
134 3300025927 Ga0207687_11450864 Ga0207687_114508642 121
135 3300025928 Ga0207700_10133003 Ga0207700_101330032 121
136 3300025934 Ga0207686_10548416 Ga0207686_105484162 121
137 3300025935 Ga0207709_11181320 Ga0207709_111813202 121
138 3300025941 Ga0207711_11348626 Ga0207711_113486262 121
139 3300025986 Ga0207658_11053187 Ga0207658_110531872 121
140 3300026075 Ga0207708_10744742 Ga0207708_107447421 121
141 3300034817 Ga0373948_0090442 Ga0373948_0090442_235_600 121
142 3300047322 Ga0495680_0245214 Ga0495680_0245214_251_679 121
143 3300048907 Ga0496104_0018747 Ga0496104_0018747_5915_6280 121
144 3300048911 Ga0496108_0987302 Ga0496108_0987302_130_528 121
145 3300048916 Ga0496113_0795841 Ga0496113_0795841_349_714 121
146 3300049823 Ga0501044_0667793 Ga0501044_0667793_189_554 121
147 3300050490 nmdc:mga03n38_98316_c1 nmdc:mga03n38_98316_c1_257_655 121
148 3300050491 nmdc:mga00v17_452114_c1 nmdc:mga00v17_452114_c1_209_607 121
149 3300050494 nmdc:mga06z11_46742_c1 nmdc:mga06z11_46742_c1_806_1204 121
150 3300053085 Ga0495619_0294225 Ga0495619_0294225_85_468 121
151 3300005440 Ga0070705_100226823 Ga0070705_1002268232 122
152 3300005444 Ga0070694_100143682 Ga0070694_1001436823 122
153 3300005457 Ga0070662_100725278 Ga0070662_1007252782 122
154 3300005459 Ga0068867_100624382 Ga0068867_1006243822 122
155 3300005546 Ga0070696_100823065 Ga0070696_1008230652 122
156 3300005549 Ga0070704_100053388 Ga0070704_1000533882 122
157 3300005564 Ga0070664_102042561 Ga0070664_1020425611 122
158 3300005615 Ga0070702_100580781 Ga0070702_1005807812 122
159 3300005840 Ga0068870_10929294 Ga0068870_109292942 122
160 3300006038 Ga0075365_10523945 Ga0075365_105239452 122
161 3300006358 Ga0068871_100791045 Ga0068871_1007910451 122
162 3300006852 Ga0075433_10377402 Ga0075433_103774022 122
163 3300007076 Ga0075435_100486756 Ga0075435_1004867562 122
164 3300009148 Ga0105243_10891354 Ga0105243_108913541 122
165 3300009148 Ga0105243_11716045 Ga0105243_117160451 122
166 3300009176 Ga0105242_10842600 Ga0105242_108426002 122
167 3300009177 Ga0105248_11082457 Ga0105248_110824572 122
168 3300013296 Ga0157374_12225472 Ga0157374_122254722 122
169 3300013308 Ga0157375_11602960 Ga0157375_116029601 122
170 3300021384 Ga0213876_10028141 Ga0213876_100281415 122
171 3300025905 Ga0207685_10107366 Ga0207685_101073662 122
172 3300025923 Ga0207681_10336901 Ga0207681_103369012 122
173 3300025927 Ga0207687_11199309 Ga0207687_111993092 122
174 3300025927 Ga0207687_11233906 Ga0207687_112339062 122
175 3300025933 Ga0207706_11552682 Ga0207706_115526821 122
176 3300025934 Ga0207686_11492554 Ga0207686_114925541 122
177 3300025935 Ga0207709_10240631 Ga0207709_102406312 122
178 3300025936 Ga0207670_10798474 Ga0207670_107984742 122
179 3300025945 Ga0207679_11914212 Ga0207679_119142121 122
180 3300025960 Ga0207651_10920454 Ga0207651_109204542 122
181 3300025961 Ga0207712_10378943 Ga0207712_103789432 122
182 3300025972 Ga0207668_10588857 Ga0207668_105888572 122
183 3300026067 Ga0207678_10539674 Ga0207678_105396742 122
184 3300026075 Ga0207708_10174413 Ga0207708_101744132 122
185 3300026089 Ga0207648_10172712 Ga0207648_101727124 122
186 3300028380 Ga0268265_10848125 Ga0268265_108481251 122
187 3300031824 Ga0307413_11934397 Ga0307413_119343971 122
188 3300039437 Ga0436365_1425313 Ga0436365_1425313_2120_2506 122
189 3300039453 Ga0436362_0798996 Ga0436362_0798996_54_458 122
190 3300041451 Ga0451791_1835344 Ga0451791_1835344_33_419 122
191 3300041496 Ga0451839_0215989 Ga0451839_0215989_66_434 122
192 3300046453 Ga0495627_177379 Ga0495627_177379_210_578 122
193 3300046459 Ga0495629_0110028 Ga0495629_0110028_156_524 122
194 3300046536 Ga0495587_0114425 Ga0495587_0114425_34_420 122
195 3300046536 Ga0495587_0310489 Ga0495587_0310489_298_666 122
196 3300049568 Ga0501031_0110661 Ga0501031_0110661_513_881 122
197 3300049572 Ga0501036_0650443 Ga0501036_0650443_25_393 122
198 3300049574 Ga0501038_0507508 Ga0501038_0507508_218_586 122
199 3300049576 Ga0501040_0133450 Ga0501040_0133450_1176_1544 122
200 3300049577 Ga0501041_0213661 Ga0501041_0213661_748_1116 122
201 3300049583 Ga0501067_0229947 Ga0501067_0229947_585_986 122
202 3300049588 Ga0501072_0456972 Ga0501072_0456972_587_988 122
203 3300049588 Ga0501072_1207899 Ga0501072_1207899_178_564 122
204 3300049824 Ga0501045_0348056 Ga0501045_0348056_178_546 122
205 3300050513 nmdc:mga0rr50_515681_c1 nmdc:mga0rr50_515681_c1_520_888 122
206 3300050515 nmdc:mga0a205_494649_c1 nmdc:mga0a205_494649_c1_84_452 122
207 3300054114 Ga0501084_0615374 Ga0501084_0615374_127_495 122
208 3300059607 Ga0587125_037213 Ga0587125_037213_122_511 122
209 2088090001 CNB_F6ESG4R02FWBCL CNB_02135680 123
210 3300003911 JGI25405J52794_10050139 JGI25405J52794_100501391 123
211 3300005340 Ga0070689_101025418 Ga0070689_1010254182 123
212 3300005364 Ga0070673_101146568 Ga0070673_1011465681 123
213 3300005441 Ga0070700_101157874 Ga0070700_1011578742 123
214 3300005548 Ga0070665_100817714 Ga0070665_1008177142 123
215 3300005564 Ga0070664_101062498 Ga0070664_1010624982 123
216 3300005615 Ga0070702_100893932 Ga0070702_1008939322 123
217 3300005844 Ga0068862_101747349 Ga0068862_1017473491 123
218 3300005844 Ga0068862_102523953 Ga0068862_1025239531 123
219 3300005937 Ga0081455_10018565 Ga0081455_100185654 123
220 3300005981 Ga0081538_10113557 Ga0081538_101135572 123
221 3300006038 Ga0075365_10023716 Ga0075365_100237162 123
222 3300006038 Ga0075365_10825648 Ga0075365_108256482 123
223 3300006042 Ga0075368_10343364 Ga0075368_103433641 123
224 3300006358 Ga0068871_100750260 Ga0068871_1007502602 123
225 3300007076 Ga0075435_100762512 Ga0075435_1007625122 123
226 3300009094 Ga0111539_10229249 Ga0111539_102292492 123
227 3300009094 Ga0111539_12170306 Ga0111539_121703061 123
228 3300011119 Ga0105246_10970387 Ga0105246_109703871 123
229 3300013100 Ga0157373_10746962 Ga0157373_107469622 123
230 3300013297 Ga0157378_11234266 Ga0157378_112342661 123
231 3300013308 Ga0157375_12414311 Ga0157375_124143111 123
232 3300014325 Ga0163163_12468997 Ga0163163_124689972 123
233 3300014745 Ga0157377_10951890 Ga0157377_109518902 123
234 3300014968 Ga0157379_10444307 Ga0157379_104443071 123
235 3300014969 Ga0157376_10910364 Ga0157376_109103642 123
236 3300014969 Ga0157376_11418600 Ga0157376_114186001 123
237 3300021358 Ga0213873_10004803 Ga0213873_100048032 123
238 3300025916 Ga0207663_11669972 Ga0207663_116699722 123
239 3300025945 Ga0207679_10884901 Ga0207679_108849011 123
240 3300026023 Ga0207677_11650854 Ga0207677_116508541 123
241 3300026035 Ga0207703_10017685 Ga0207703_100176857 123
242 3300026041 Ga0207639_12184674 Ga0207639_121846741 123
243 3300026118 Ga0207675_100756910 Ga0207675_1007569102 123
244 3300028379 Ga0268266_10594588 Ga0268266_105945882 123
245 3300028379 Ga0268266_10825159 Ga0268266_108251592 123
246 3300028380 Ga0268265_11102497 Ga0268265_111024972 123
247 3300031251 Ga0265327_10014684 Ga0265327_100146845 123
248 3300031595 Ga0265313_10110704 Ga0265313_101107042 123
249 3300035086 Ga0373934_0255447 Ga0373934_0255447_33_422 123
250 3300035088 Ga0373940_0222670 Ga0373940_0222670_152_526 123
251 3300035116 Ga0373945_0022545 Ga0373945_0022545_806_1195 123
252 3300035117 Ga0373953_0151124 Ga0373953_0151124_580_951 123
253 3300035118 Ga0373954_0240092 Ga0373954_0240092_170_541 123
254 3300035170 Ga0373943_0102004 Ga0373943_0102004_839_1228 123
255 3300035691 Ga0373931_0000080 Ga0373931_0000080_43253_43633 123
256 3300035692 Ga0373935_0154441 Ga0373935_0154441_447_836 123
257 3300035695 Ga0373927_0901097 Ga0373927_0901097_76_456 123
258 3300035724 Ga0373933_0192247 Ga0373933_0192247_610_999 123
259 3300035725 Ga0373947_0300609 Ga0373947_0300609_162_533 123
260 3300036401 Ga0373937_0106582 Ga0373937_0106582_1324_1713 123
261 3300037068 Ga0373925_0829547 Ga0373925_0829547_148_537 123
262 3300038443 Ga0395901_0473794 Ga0395901_0473794_342_776 123
263 3300039453 Ga0436362_0513590 Ga0436362_0513590_4434_4853 123
264 3300041492 Ga0451835_0010128 Ga0451835_0010128_110_526 123
265 3300042531 Ga0450918_120627 Ga0450918_120627_50_421 123
266 3300042993 Ga0439440_0228146 Ga0439440_0228146_89_478 123
267 3300045976 Ga0466967_2489692 Ga0466967_2489692_87_458 123
268 3300046454 Ga0495592_0217684 Ga0495592_0217684_261_668 123
269 3300046462 Ga0495651_0011676 Ga0495651_0011676_5761_6150 123
270 3300046463 Ga0495653_0266761 Ga0495653_0266761_545_934 123
271 3300046475 Ga0495639_0593871 Ga0495639_0593871_27_398 123
272 3300046511 Ga0495608_0012209 Ga0495608_0012209_2958_3347 123
273 3300046511 Ga0495608_0777028 Ga0495608_0777028_85_456 123
274 3300046517 Ga0495630_0802075 Ga0495630_0802075_58_429 123
275 3300046529 Ga0495652_0150952 Ga0495652_0150952_270_659 123
276 3300046533 Ga0495640_0853604 Ga0495640_0853604_76_447 123
277 3300046559 Ga0495667_0146944 Ga0495667_0146944_1099_1488 123
278 3300046663 Ga0495635_0557540 Ga0495635_0557540_279_668 123
279 3300046679 Ga0495623_0080715 Ga0495623_0080715_623_1012 123
280 3300046680 Ga0495646_0438938 Ga0495646_0438938_279_650 123
281 3300046683 Ga0495658_0613521 Ga0495658_0613521_268_639 123
282 3300046694 Ga0495649_0268731 Ga0495649_0268731_74_445 123
283 3300046694 Ga0495649_0315313 Ga0495649_0315313_369_740 123
284 3300046809 Ga0495600_0184115 Ga0495600_0184115_780_1169 123
285 3300047317 Ga0495604_0192477 Ga0495604_0192477_375_764 123
286 3300047319 Ga0495674_0113562 Ga0495674_0113562_1243_1632 123
287 3300047319 Ga0495674_0658388 Ga0495674_0658388_322_693 123
288 3300047321 Ga0495676_1033750 Ga0495676_1033750_77_466 123
289 3300047322 Ga0495680_0058676 Ga0495680_0058676_498_887 123
290 3300047444 Ga0495675_0050975 Ga0495675_0050975_507_896 123
291 3300047471 Ga0495684_0372699 Ga0495684_0372699_108_497 123
292 3300048088 Ga0495602_0118226 Ga0495602_0118226_1187_1576 123
293 3300048907 Ga0496104_0034486 Ga0496104_0034486_3475_3846 123
294 3300048907 Ga0496104_0179062 Ga0496104_0179062_1315_1686 123
295 3300048912 Ga0496109_0507189 Ga0496109_0507189_642_1013 123
296 3300048912 Ga0496109_0867157 Ga0496109_0867157_402_791 123
297 3300048914 Ga0496111_0846072 Ga0496111_0846072_198_587 123
298 3300048915 Ga0496112_0033140 Ga0496112_0033140_2137_2508 123
299 3300049568 Ga0501031_0082888 Ga0501031_0082888_460_831 123
300 3300049570 Ga0501033_0020055 Ga0501033_0020055_838_1209 123
301 3300049571 Ga0501034_0233279 Ga0501034_0233279_1320_1694 123
302 3300049572 Ga0501036_0018591 Ga0501036_0018591_5082_5453 123
303 3300049573 Ga0501037_0279083 Ga0501037_0279083_245_616 123
304 3300049574 Ga0501038_0635952 Ga0501038_0635952_386_757 123
305 3300049575 Ga0501039_0014883 Ga0501039_0014883_69_440 123
306 3300049576 Ga0501040_0000764 Ga0501040_0000764_8759_9130 123
307 3300049577 Ga0501041_0001954 Ga0501041_0001954_2390_2761 123
308 3300049578 Ga0501042_0136925 Ga0501042_0136925_1350_1721 123
309 3300049580 Ga0501046_0058085 Ga0501046_0058085_1620_1991 123
310 3300049580 Ga0501046_1058582 Ga0501046_1058582_30_404 123
311 3300049581 Ga0501047_0045575 Ga0501047_0045575_3071_3445 123
312 3300049582 Ga0501048_0011342 Ga0501048_0011342_6004_6375 123
313 3300049586 Ga0501070_0028877 Ga0501070_0028877_1269_1643 123
314 3300049586 Ga0501070_0388363 Ga0501070_0388363_690_1061 123
315 3300049588 Ga0501072_0002994 Ga0501072_0002994_656_1027 123
316 3300049589 Ga0501073_0111199 Ga0501073_0111199_318_695 123
317 3300049590 Ga0501074_0083573 Ga0501074_0083573_1620_1991 123
318 3300049590 Ga0501074_0180592 Ga0501074_0180592_668_1042 123
319 3300049591 Ga0501075_0001776 Ga0501075_0001776_12189_12560 123
320 3300049592 Ga0501076_0012619 Ga0501076_0012619_1602_1973 123
321 3300049741 Ga0501079_0055830 Ga0501079_0055830_1158_1529 123
322 3300049742 Ga0501080_0198405 Ga0501080_0198405_223_594 123
323 3300049743 Ga0501081_0004027 Ga0501081_0004027_2064_2435 123
324 3300049744 Ga0501083_0567539 Ga0501083_0567539_307_678 123
325 3300049822 Ga0501035_0673162 Ga0501035_0673162_352_723 123
326 3300049823 Ga0501044_0450470 Ga0501044_0450470_543_914 123
327 3300049824 Ga0501045_0027654 Ga0501045_0027654_242_613 123
328 3300050492 nmdc:mga0yw44_4532_c1 nmdc:mga0yw44_4532_c1_334_708 123
329 3300050495 nmdc:mga04h51_442044_c1 nmdc:mga04h51_442044_c1_60_431 123
330 3300050513 nmdc:mga0rr50_555145_c1 nmdc:mga0rr50_555145_c1_171_560 123
331 3300053077 Ga0495601_0335331 Ga0495601_0335331_490_861 123
332 3300053078 Ga0495612_0063637 Ga0495612_0063637_644_1015 123
333 3300053084 Ga0495595_0011599 Ga0495595_0011599_1745_2134 123
334 3300053084 Ga0495595_0155302 Ga0495595_0155302_92_463 123
335 3300053085 Ga0495619_0019510 Ga0495619_0019510_1549_1920 123
336 3300053085 Ga0495619_0066813 Ga0495619_0066813_1752_2159 123
337 3300053085 Ga0495619_0431392 Ga0495619_0431392_438_809 123
338 3300053085 Ga0495619_0510727 Ga0495619_0510727_393_764 123
339 3300054114 Ga0501084_0018608 Ga0501084_0018608_3364_3735 123
340 3300060353 Ga0501082_0026601 Ga0501082_0026601_3359_3730 123
341 3300061734 Ga0530510_0001779 Ga0530510_0001779_11843_12214 123
342 iso_pu_bacteria 8033684223 8033690602 123

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01022

HTH_5

Bacterial regulatory protein, arsR family

41

87

0.98

PF12840

HTH_20

Helix-turn-helix domain

39

87

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6j05-assembly1.cif.gz_B structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression 0.928 3 84
3f6o-assembly1.cif.gz_B crystal structure of arsr family transcriptional regulator, rha00566 0.9271 5 92
7p6f-assembly1.cif.gz_BBB 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus 0.9164 1 79
6j05-assembly1.cif.gz_A structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression 0.9073 4 84
3f6o-assembly1.cif.gz_A crystal structure of arsr family transcriptional regulator, rha00566 0.8992 3 92
ID Description Score Start End Superfamily
af_Q5NE14_88_145_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9369 17 72 1.10.10.10
3f6oB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9271 5 92 1.10.10.10
af_Q58793_322_389_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9086 13 77 1.10.10.10
af_P15082_1_58_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9066 16 72 1.10.10.10
2oqgC00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9066 4 102 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7W0UJ71-F1-model_v4 Winged helix-turn-helix transcriptional regulator 0.9726 5 74 GO:0003700
AF-A0A2M8HG34-F1-model_v4 Transcriptional regulator 0.952 2 89 GO:0003700
AF-A0A7Y8ZE16-F1-model_v4 deleted 0.9511 5 88
AF-A0A2V7PG10-F1-model_v4 Transcriptional regulator 0.9496 5 84 GO:0003700
AF-A0A1S2J3F8-F1-model_v4 deleted 0.9486 1 88

Feature Viewer

pLDDT pTM Quality
86.56 0.67 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map