F415020

General Info

Members Datasets Scaffolds Average Seq Length
342 189 684 193

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10294839|Ga0070658_102948392
Length 190
Sequence MRYRPEHKGEIHQKIVKDASRRVRSEGITGAAVSAVMKDAGLTHGGFYKHFGSKDELLVESVGEAFGEMAERLAHVAEQSRPGTAWKAIVKAYLSVEHCDHAECGCPLAAIAPELARAGEMKAPIFEELQRYRNRMLPFMPGRRTADKERAFFSIFSTMIGAIEIARMMPEKAVREKVLTSAREFLLHSF

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
81 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
82 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
83 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
132 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
133 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
134 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
135 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
136 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
137 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
138 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
139 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
140 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
141 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
142 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
143 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
144 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
145 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
146 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
147 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
148 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
149 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
150 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
151 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
152 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
153 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
154 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
155 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
156 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
157 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
158 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
159 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
160 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
161 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
162 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
163 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
164 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
165 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
166 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
167 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
168 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
169 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
170 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
171 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
172 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
173 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
174 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
175 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
176 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
177 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
178 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
179 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
180 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
181 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
182 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
183 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
184 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
185 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
186 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
187 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
188 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
189 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.12
Metatranscriptomes 0.88
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.68
Rhizosphere 91.23
Stem 0
Stem Tuber 0
Unclassified 12.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10294839 3300005327 Bacteria 1382
2 rootH2_10232582 3300003320 Bacteria 1783
3 rootH2_10265272 3300003320 Bacteria 1461
4 Ga0070658_10000539 3300005327 Bacteria 32873
5 Ga0070658_10009869 3300005327 Bacteria 7671
6 Ga0070683_100622916 3300005329 Unclassified 1033
7 Ga0070690_100141664 3300005330 Bacteria 1633
8 Ga0070677_10054668 3300005333 Bacteria 1627
9 Ga0070666_10176800 3300005335 Bacteria 1496
10 Ga0070680_100099222 3300005336 Bacteria 2416
11 Ga0068868_100028260 3300005338 Bacteria 4286
12 Ga0068868_100041623 3300005338 Bacteria 3579
13 Ga0070660_100001487 3300005339 Bacteria 16044
14 Ga0070660_100018140 3300005339 Bacteria 5136
15 Ga0070660_100062084 3300005339 Bacteria 2902
16 Ga0070660_100237718 3300005339 Unclassified 1483
17 Ga0070689_100093371 3300005340 Bacteria 2375
18 Ga0070661_100005875 3300005344 Bacteria 8443
19 Ga0070661_100115761 3300005344 Bacteria 2005
20 Ga0070692_10094092 3300005345 Bacteria 1633
21 Ga0070669_100192371 3300005353 Bacteria 1601
22 Ga0070659_100020960 3300005366 Bacteria 4971
23 Ga0070659_100217805 3300005366 Bacteria 1575
24 Ga0070667_100232358 3300005367 Bacteria 1645
25 Ga0070713_100150356 3300005436 Bacteria 2071
26 Ga0070713_100371807 3300005436 Unclassified 1330
27 Ga0070713_100620592 3300005436 Bacteria 1028
28 Ga0070711_100003018 3300005439 Bacteria 9730
29 Ga0070711_100490200 3300005439 Bacteria 1012
30 Ga0070705_100896265 3300005440 Bacteria 713
31 Ga0070663_100014407 3300005455 Bacteria 5074
32 Ga0070663_100083495 3300005455 Bacteria 2352
33 Ga0070663_100132660 3300005455 Bacteria 1893
34 Ga0070678_100752560 3300005456 Unclassified 881
35 Ga0070662_100001712 3300005457 Bacteria 13490
36 Ga0070662_100212219 3300005457 Bacteria 1541
37 Ga0070681_10007359 3300005458 Bacteria 10759
38 Ga0070681_10012031 3300005458 Bacteria 8582
39 Ga0070681_10563978 3300005458 Bacteria 1052
40 Ga0068867_100435550 3300005459 Bacteria 1114
41 Ga0070706_100363198 3300005467 Bacteria 1349
42 Ga0070698_100604394 3300005471 Bacteria 1037
43 Ga0070679_100000123 3300005530 Bacteria 61754
44 Ga0070684_100231959 3300005535 Bacteria 1685
45 Ga0070684_100369036 3300005535 Bacteria 1321
46 Ga0068853_100036470 3300005539 Bacteria 4182
47 Ga0068853_100049708 3300005539 Bacteria 3604
48 Ga0068853_100461720 3300005539 Bacteria 1195
49 Ga0070686_100125808 3300005544 Bacteria 1766
50 Ga0070695_100117550 3300005545 Bacteria 1814
51 Ga0070696_100166337 3300005546 Bacteria 1627
52 Ga0070693_100020358 3300005547 Bacteria 3497
53 Ga0070665_100025247 3300005548 Bacteria 5987
54 Ga0068855_100001313 3300005563 Bacteria 30797
55 Ga0068855_100024700 3300005563 Bacteria 7189
56 Ga0068855_100039161 3300005563 Bacteria 5627
57 Ga0068855_100589105 3300005563 Bacteria 1200
58 Ga0068855_100628800 3300005563 Unclassified 1155
59 Ga0068855_100634995 3300005563 Bacteria 1148
60 Ga0070664_100243730 3300005564 Bacteria 1614
61 Ga0070664_100279389 3300005564 Bacteria 1506
62 Ga0068857_100009015 3300005577 Bacteria 8649
63 Ga0068857_100054986 3300005577 Bacteria 3533
64 Ga0068854_100057172 3300005578 Bacteria 2813
65 Ga0068854_100730910 3300005578 Bacteria 857
66 Ga0068856_100012337 3300005614 Bacteria 8275
67 Ga0068856_100042777 3300005614 Bacteria 4458
68 Ga0068856_100310507 3300005614 Bacteria 1594
69 Ga0068856_100550177 3300005614 Bacteria 1175
70 Ga0068856_100664166 3300005614 Unclassified 1063
71 Ga0068852_100044856 3300005616 Bacteria 3758
72 Ga0068852_100084944 3300005616 Bacteria 2818
73 Ga0068852_100090832 3300005616 Bacteria 2732
74 Ga0068852_100094854 3300005616 Bacteria 2678
75 Ga0068859_100264037 3300005617 Bacteria 1813
76 Ga0068866_10013351 3300005718 Unclassified 3602
77 Ga0068861_100034182 3300005719 Bacteria 3758
78 Ga0068851_10008255 3300005834 Bacteria 4810
79 Ga0068851_10013135 3300005834 Bacteria 3917
80 Ga0068870_10447747 3300005840 Unclassified 851
81 Ga0068858_100081961 3300005842 Bacteria 2998
82 Ga0068860_100093964 3300005843 Bacteria 2858
83 Ga0068860_100228708 3300005843 Bacteria 1807
84 Ga0068862_100032056 3300005844 Bacteria 4440
85 Ga0070717_10051849 3300006028 Bacteria 3378
86 Ga0070712_100017473 3300006175 Bacteria 4644
87 Ga0097621_100639193 3300006237 Bacteria 975
88 Ga0075433_10019098 3300006852 Bacteria 5702
89 Ga0075434_100010382 3300006871 Bacteria 8729
90 Ga0068865_100068640 3300006881 Bacteria 2506
91 Ga0075436_100041923 3300006914 Bacteria 3157
92 Ga0075436_100327373 3300006914 Bacteria 1101
93 Ga0097620_100264019 3300006931 Bacteria 1813
94 Ga0075435_100007162 3300007076 Bacteria 7930
95 Ga0105240_10000690 3300009093 Bacteria 62106
96 Ga0105240_10047728 3300009093 Bacteria 5417
97 Ga0105240_10112677 3300009093 Bacteria 3288
98 Ga0105240_10131790 3300009093 Bacteria 2998
99 Ga0105240_10142133 3300009093 Bacteria 2868
100 Ga0105240_10144977 3300009093 Bacteria 2835
101 Ga0105240_10296270 3300009093 Bacteria 1852
102 Ga0105240_10671126 3300009093 Bacteria 1134
103 Ga0105240_10888489 3300009093 Unclassified 959
104 Ga0105245_10124786 3300009098 Bacteria 2408
105 Ga0105243_10055552 3300009148 Bacteria 3146
106 Ga0105241_10026579 3300009174 Bacteria 4308
107 Ga0105242_10033712 3300009176 Bacteria 4102
108 Ga0105242_10164563 3300009176 Bacteria 1945
109 Ga0105242_10340086 3300009176 Bacteria 1383
110 Ga0105237_10180176 3300009545 Bacteria 2113
111 Ga0105237_10226886 3300009545 Bacteria 1868
112 Ga0105237_10998427 3300009545 Bacteria 844
113 Ga0105238_10003585 3300009551 Bacteria 15480
114 Ga0105238_10006325 3300009551 Bacteria 11773
115 Ga0105238_10041158 3300009551 Bacteria 4681
116 Ga0105238_10051822 3300009551 Bacteria 4126
117 Ga0105238_10102849 3300009551 Bacteria 2838
118 Ga0105249_10007735 3300009553 Bacteria 9366
119 Ga0105239_10132671 3300010375 Bacteria 2771
120 Ga0105239_10518388 3300010375 Bacteria 1356
121 Ga0105246_10005192 3300011119 Bacteria 7916
122 Ga0105246_10557143 3300011119 Bacteria 983
123 Ga0157373_10124027 3300013100 Bacteria 1816
124 Ga0157373_10525390 3300013100 Unclassified 856
125 Ga0157371_10009811 3300013102 Bacteria 7507
126 Ga0157371_10094441 3300013102 Bacteria 2119
127 Ga0157371_10116114 3300013102 Bacteria 1901
128 Ga0157370_10002157 3300013104 Bacteria 24022
129 Ga0157370_10012040 3300013104 Bacteria 9004
130 Ga0157370_10024218 3300013104 Bacteria 6015
131 Ga0157370_10051319 3300013104 Bacteria 3940
132 Ga0157370_10059713 3300013104 Bacteria 3623
133 Ga0157370_10174062 3300013104 Bacteria 2000
134 Ga0157370_10196804 3300013104 Bacteria 1870
135 Ga0157370_10317604 3300013104 Unclassified 1437
136 Ga0157370_10456877 3300013104 Bacteria 1174
137 Ga0157369_10004733 3300013105 Bacteria 15992
138 Ga0157369_10020985 3300013105 Bacteria 7303
139 Ga0157369_10038807 3300013105 Bacteria 5207
140 Ga0157369_10041904 3300013105 Bacteria 4996
141 Ga0157369_10064058 3300013105 Bacteria 3959
142 Ga0157369_10158696 3300013105 Bacteria 2388
143 Ga0157374_10003056 3300013296 Bacteria 14033
144 Ga0157374_10009852 3300013296 Bacteria 8201
145 Ga0157374_10011769 3300013296 Bacteria 7589
146 Ga0157374_10193303 3300013296 Bacteria 1990
147 Ga0157374_11201248 3300013296 Unclassified 780
148 Ga0157378_10084232 3300013297 Bacteria 2878
149 Ga0163162_10096240 3300013306 Bacteria 3048
150 Ga0157372_10000419 3300013307 Bacteria 46619
151 Ga0157372_10020710 3300013307 Bacteria 7098
152 Ga0157372_10046477 3300013307 Bacteria 4819
153 Ga0157372_10047630 3300013307 Bacteria 4763
154 Ga0157372_10184298 3300013307 Bacteria 2417
155 Ga0157372_10200541 3300013307 Bacteria 2311
156 Ga0157372_10369217 3300013307 Bacteria 1672
157 Ga0157372_10475582 3300013307 Bacteria 1457
158 Ga0157372_10518775 3300013307 Bacteria 1389
159 Ga0157375_10039264 3300013308 Bacteria 4555
160 Ga0157375_10045514 3300013308 Bacteria 4271
161 Ga0157375_10158514 3300013308 Bacteria 2404
162 Ga0163163_10020215 3300014325 Bacteria 6266
163 Ga0163163_10055793 3300014325 Bacteria 3905
164 Ga0163163_10244433 3300014325 Bacteria 1845
165 Ga0157377_10394235 3300014745 Bacteria 941
166 Ga0157379_10059444 3300014968 Bacteria 3417
167 Ga0157376_10059632 3300014969 Bacteria 3200
168 Ga0157376_10838711 3300014969 Bacteria 934
169 Ga0157376_11149385 3300014969 Unclassified 803
170 Ga0213872_10000592 3300021361 Bacteria 27781
171 Ga0213872_10005397 3300021361 Bacteria 6589
172 Ga0213874_10042962 3300021377 Unclassified 1360
173 Ga0213875_10026107 3300021388 Bacteria 2780
174 Ga0207656_10043416 3300025321 Bacteria 1917
175 Ga0207642_10119320 3300025899 Unclassified 1358
176 Ga0207680_10048001 3300025903 Bacteria 2533
177 Ga0207647_10063963 3300025904 Bacteria 2236
178 Ga0207647_10561753 3300025904 Unclassified 632
179 Ga0207699_10334040 3300025906 Bacteria 1066
180 Ga0207705_10000310 3300025909 Bacteria 44931
181 Ga0207705_10008661 3300025909 Bacteria 7415
182 Ga0207705_10009507 3300025909 Bacteria 7074
183 Ga0207705_10139356 3300025909 Bacteria 1810
184 Ga0207654_10038326 3300025911 Bacteria 2689
185 Ga0207707_10019463 3300025912 Bacteria 5927
186 Ga0207707_10038282 3300025912 Bacteria 4191
187 Ga0207707_10582809 3300025912 Bacteria 948
188 Ga0207695_10001035 3300025913 Bacteria 48857
189 Ga0207695_10033788 3300025913 Bacteria 5572
190 Ga0207695_10125381 3300025913 Bacteria 2531
191 Ga0207695_10134353 3300025913 Bacteria 2429
192 Ga0207695_10135802 3300025913 Bacteria 2413
193 Ga0207695_11177183 3300025913 Bacteria 647
194 Ga0207671_10105798 3300025914 Bacteria 2136
195 Ga0207671_10120381 3300025914 Bacteria 2006
196 Ga0207693_10008408 3300025915 Bacteria 8444
197 Ga0207663_10027457 3300025916 Bacteria 3318
198 Ga0207660_10057375 3300025917 Bacteria 2789
199 Ga0207660_10382369 3300025917 Bacteria 1132
200 Ga0207660_10624959 3300025917 Bacteria 878
201 Ga0207657_10000481 3300025919 Bacteria 42115
202 Ga0207657_10027820 3300025919 Bacteria 5171
203 Ga0207657_10353209 3300025919 Bacteria 1159
204 Ga0207649_10091021 3300025920 Bacteria 1997
205 Ga0207649_10373455 3300025920 Bacteria 1061
206 Ga0207652_10001465 3300025921 Bacteria 20880
207 Ga0207681_10011869 3300025923 Bacteria 5363
208 Ga0207694_10009629 3300025924 Bacteria 7286
209 Ga0207694_10009853 3300025924 Bacteria 7214
210 Ga0207694_10164912 3300025924 Bacteria 1791
211 Ga0207687_10028072 3300025927 Bacteria 3780
212 Ga0207687_10033007 3300025927 Bacteria 3510
213 Ga0207700_10392532 3300025928 Bacteria 1215
214 Ga0207700_10443525 3300025928 Bacteria 1143
215 Ga0207700_11090585 3300025928 Unclassified 714
216 Ga0207690_10463145 3300025932 Unclassified 1020
217 Ga0207706_10001872 3300025933 Bacteria 20612
218 Ga0207686_10021775 3300025934 Bacteria 3684
219 Ga0207686_10047017 3300025934 Bacteria 2666
220 Ga0207670_10122681 3300025936 Bacteria 1891
221 Ga0207704_10070077 3300025938 Bacteria 2219
222 Ga0207665_10445753 3300025939 Bacteria 993
223 Ga0207711_10012093 3300025941 Bacteria 7174
224 Ga0207689_10030837 3300025942 Bacteria 4468
225 Ga0207661_10016418 3300025944 Bacteria 5462
226 Ga0207661_10852261 3300025944 Unclassified 839
227 Ga0207679_10127076 3300025945 Bacteria 2039
228 Ga0207679_10207872 3300025945 Bacteria 1639
229 Ga0207667_10000163 3300025949 Bacteria 98321
230 Ga0207667_10011608 3300025949 Bacteria 10228
231 Ga0207667_10012252 3300025949 Bacteria 9900
232 Ga0207667_10024609 3300025949 Bacteria 6606
233 Ga0207667_10078000 3300025949 Bacteria 3434
234 Ga0207667_10100263 3300025949 Bacteria 2987
235 Ga0207667_10145883 3300025949 Bacteria 2436
236 Ga0207712_10068775 3300025961 Bacteria 2539
237 Ga0207668_10026731 3300025972 Bacteria 3751
238 Ga0207640_10146153 3300025981 Bacteria 1730
239 Ga0207677_10002686 3300026023 Bacteria 9376
240 Ga0207677_10019397 3300026023 Bacteria 4106
241 Ga0207703_10319019 3300026035 Bacteria 1422
242 Ga0207639_10078631 3300026041 Bacteria 2604
243 Ga0207639_10236177 3300026041 Bacteria 1587
244 Ga0207678_10000691 3300026067 Bacteria 30832
245 Ga0207678_10015933 3300026067 Bacteria 6602
246 Ga0207678_10022843 3300026067 Bacteria 5477
247 Ga0207678_10776953 3300026067 Unclassified 845
248 Ga0207702_10088980 3300026078 Bacteria 2699
249 Ga0207702_10249024 3300026078 Bacteria 1668
250 Ga0207648_10018198 3300026089 Bacteria 6364
251 Ga0207674_10007804 3300026116 Bacteria 12445
252 Ga0207674_10084760 3300026116 Bacteria 3166
253 Ga0207674_10130840 3300026116 Unclassified 2473
254 Ga0207675_100039880 3300026118 Bacteria 4382
255 Ga0207683_10295406 3300026121 Bacteria 1482
256 Ga0207698_10006231 3300026142 Bacteria 7427
257 Ga0207698_10456139 3300026142 Bacteria 1235
258 Ga0265356_1004313 3300028017 Bacteria 1744
259 Ga0268266_10063294 3300028379 Bacteria 3193
260 Ga0268265_10041289 3300028380 Bacteria 3413
261 Ga0268264_10154348 3300028381 Bacteria 2062
262 Ga0265762_1000021 3300030760 Bacteria 17880
263 Ga0265770_1069744 3300030878 Unclassified 669
264 Ga0265760_10047489 3300031090 Bacteria 1289
265 Ga0373928_0074184 3300035084 Bacteria 847
266 Ga0373932_0031116 3300035112 Bacteria 1485
267 Ga0373961_0071843 3300035241 Bacteria 1072
268 Ga0373935_0660393 3300035692 Bacteria 767
269 Ga0373933_0005338 3300035724 Bacteria 7005
270 Ga0373937_0026764 3300036401 Bacteria 5212
271 Ga0395900_1073873 3300037418 Bacteria 723
272 Ga0436364_0057335 3300037853 Unclassified 923
273 Ga0436364_0115941 3300037853 Bacteria 1626
274 Ga0436364_0442246 3300037853 Bacteria 11225
275 Ga0436364_0575286 3300037853 Unclassified 1341
276 Ga0436364_0838310 3300037853 Bacteria 19399
277 Ga0436365_1456402 3300039437 Unclassified 1402
278 Ga0436360_1254475 3300039438 Bacteria 4395
279 Ga0436361_0014704 3300039447 Bacteria 686
280 Ga0436361_0213924 3300039447 Bacteria 37960
281 Ga0436361_0434431 3300039447 Bacteria 90700
282 Ga0436361_0564223 3300039447 Bacteria 15737
283 Ga0436361_0931454 3300039447 Unclassified 756
284 Ga0436361_1213611 3300039447 Bacteria 3167
285 Ga0436363_0338528 3300039450 Unclassified 849
286 Ga0436363_1346412 3300039450 Bacteria 1078
287 Ga0436363_1515552 3300039450 Bacteria 708
288 Ga0466967_0043645 3300045976 Bacteria 3883
289 Ga0466967_0907565 3300045976 Unclassified 876
290 Ga0495603_0004102 3300046455 Bacteria 8676
291 Ga0495629_0034333 3300046459 Bacteria 3586
292 Ga0495651_0368973 3300046462 Bacteria 944
293 Ga0495580_0103958 3300046472 Unclassified 1974
294 Ga0495582_0067301 3300046473 Bacteria 1979
295 Ga0495585_0011766 3300046492 Bacteria 5170
296 Ga0495594_0003547 3300046499 Bacteria 8031
297 Ga0495607_0097385 3300046501 Unclassified 1582
298 Ga0495583_0042043 3300046506 Unclassified 2137
299 Ga0495608_0252554 3300046511 Bacteria 1099
300 Ga0495628_0737443 3300046516 Unclassified 693
301 Ga0495631_0090424 3300046518 Bacteria 1318
302 Ga0495644_0000013 3300046523 Bacteria 94729
303 Ga0495642_0032108 3300046528 Unclassified 2106
304 Ga0495652_0267705 3300046529 Bacteria 1257
305 Ga0495665_0081096 3300046531 Bacteria 1706
306 Ga0495609_0018608 3300046538 Unclassified 3218
307 Ga0495609_0062340 3300046538 Unclassified 1646
308 Ga0495645_0019293 3300046543 Bacteria 4909
309 Ga0495667_0154081 3300046559 Bacteria 1479
310 Ga0495625_0006268 3300046660 Bacteria 10641
311 Ga0495669_0001127 3300046684 Bacteria 11073
312 Ga0495669_0057748 3300046684 Unclassified 1751
313 Ga0495669_0289159 3300046684 Bacteria 789
314 Ga0495600_0043265 3300046809 Bacteria 2937
315 Ga0495680_0523493 3300047322 Unclassified 802
316 Ga0495677_0021778 3300047445 Bacteria 2323
317 Ga0495673_0148968 3300047469 Bacteria 906
318 Ga0495681_0117544 3300047470 Bacteria 1144
319 Ga0495684_0222267 3300047471 Bacteria 1384
320 Ga0495602_0177189 3300048088 Bacteria 1648
321 Ga0496102_0423444 3300048905 Bacteria 1250
322 Ga0496104_0738143 3300048907 Unclassified 892
323 Ga0496106_0285529 3300048909 Bacteria 1322
324 Ga0496106_0654243 3300048909 Unclassified 839
325 Ga0496106_1111883 3300048909 Unclassified 619
326 Ga0496108_0826192 3300048911 Unclassified 798
327 Ga0496108_1143558 3300048911 Unclassified 660
328 Ga0496109_0025498 3300048912 Bacteria 5269
329 Ga0496109_0332708 3300048912 Bacteria 1434
330 Ga0496110_0141039 3300048913 Bacteria 2179
331 Ga0496111_0405145 3300048914 Bacteria 1008
332 Ga0496112_0207243 3300048915 Bacteria 1918
333 Ga0496112_0527319 3300048915 Bacteria 1115
334 Ga0496113_0626371 3300048916 Unclassified 861
335 Ga0496115_0322876 3300048918 Bacteria 1262
336 Ga0496115_0784441 3300048918 Bacteria 743
337 Ga0496126_0000209 3300048929 Bacteria 131440
338 nmdc:mga0rr50_1774_c1 3300050513 Bacteria 11916
339 nmdc:mga08x19_12949_c1 3300050514 Bacteria 5035
340 nmdc:mga08x19_778060_c1 3300050514 Bacteria 680
341 nmdc:mga0a205_54191_c1 3300050515 Plasmid 3872
342 Ga0495601_0083111 3300053077 Bacteria 2056
343 Ga0070658_10294839
344 rootH2_10232582
345 rootH2_10265272
346 Ga0070658_10000539
347 Ga0070658_10009869
348 Ga0070683_100622916
349 Ga0070690_100141664
350 Ga0070677_10054668
351 Ga0070666_10176800
352 Ga0070680_100099222
353 Ga0068868_100028260
354 Ga0068868_100041623
355 Ga0070660_100001487
356 Ga0070660_100018140
357 Ga0070660_100062084
358 Ga0070660_100237718
359 Ga0070689_100093371
360 Ga0070661_100005875
361 Ga0070661_100115761
362 Ga0070692_10094092
363 Ga0070669_100192371
364 Ga0070659_100020960
365 Ga0070659_100217805
366 Ga0070667_100232358
367 Ga0070713_100150356
368 Ga0070713_100371807
369 Ga0070713_100620592
370 Ga0070711_100003018
371 Ga0070711_100490200
372 Ga0070705_100896265
373 Ga0070663_100014407
374 Ga0070663_100083495
375 Ga0070663_100132660
376 Ga0070678_100752560
377 Ga0070662_100001712
378 Ga0070662_100212219
379 Ga0070681_10007359
380 Ga0070681_10012031
381 Ga0070681_10563978
382 Ga0068867_100435550
383 Ga0070706_100363198
384 Ga0070698_100604394
385 Ga0070679_100000123
386 Ga0070684_100231959
387 Ga0070684_100369036
388 Ga0068853_100036470
389 Ga0068853_100049708
390 Ga0068853_100461720
391 Ga0070686_100125808
392 Ga0070695_100117550
393 Ga0070696_100166337
394 Ga0070693_100020358
395 Ga0070665_100025247
396 Ga0068855_100001313
397 Ga0068855_100024700
398 Ga0068855_100039161
399 Ga0068855_100589105
400 Ga0068855_100628800
401 Ga0068855_100634995
402 Ga0070664_100243730
403 Ga0070664_100279389
404 Ga0068857_100009015
405 Ga0068857_100054986
406 Ga0068854_100057172
407 Ga0068854_100730910
408 Ga0068856_100012337
409 Ga0068856_100042777
410 Ga0068856_100310507
411 Ga0068856_100550177
412 Ga0068856_100664166
413 Ga0068852_100044856
414 Ga0068852_100084944
415 Ga0068852_100090832
416 Ga0068852_100094854
417 Ga0068859_100264037
418 Ga0068866_10013351
419 Ga0068861_100034182
420 Ga0068851_10008255
421 Ga0068851_10013135
422 Ga0068870_10447747
423 Ga0068858_100081961
424 Ga0068860_100093964
425 Ga0068860_100228708
426 Ga0068862_100032056
427 Ga0070717_10051849
428 Ga0070712_100017473
429 Ga0097621_100639193
430 Ga0075433_10019098
431 Ga0075434_100010382
432 Ga0068865_100068640
433 Ga0075436_100041923
434 Ga0075436_100327373
435 Ga0097620_100264019
436 Ga0075435_100007162
437 Ga0105240_10000690
438 Ga0105240_10047728
439 Ga0105240_10112677
440 Ga0105240_10131790
441 Ga0105240_10142133
442 Ga0105240_10144977
443 Ga0105240_10296270
444 Ga0105240_10671126
445 Ga0105240_10888489
446 Ga0105245_10124786
447 Ga0105243_10055552
448 Ga0105241_10026579
449 Ga0105242_10033712
450 Ga0105242_10164563
451 Ga0105242_10340086
452 Ga0105237_10180176
453 Ga0105237_10226886
454 Ga0105237_10998427
455 Ga0105238_10003585
456 Ga0105238_10006325
457 Ga0105238_10041158
458 Ga0105238_10051822
459 Ga0105238_10102849
460 Ga0105249_10007735
461 Ga0105239_10132671
462 Ga0105239_10518388
463 Ga0105246_10005192
464 Ga0105246_10557143
465 Ga0157373_10124027
466 Ga0157373_10525390
467 Ga0157371_10009811
468 Ga0157371_10094441
469 Ga0157371_10116114
470 Ga0157370_10002157
471 Ga0157370_10012040
472 Ga0157370_10024218
473 Ga0157370_10051319
474 Ga0157370_10059713
475 Ga0157370_10174062
476 Ga0157370_10196804
477 Ga0157370_10317604
478 Ga0157370_10456877
479 Ga0157369_10004733
480 Ga0157369_10020985
481 Ga0157369_10038807
482 Ga0157369_10041904
483 Ga0157369_10064058
484 Ga0157369_10158696
485 Ga0157374_10003056
486 Ga0157374_10009852
487 Ga0157374_10011769
488 Ga0157374_10193303
489 Ga0157374_11201248
490 Ga0157378_10084232
491 Ga0163162_10096240
492 Ga0157372_10000419
493 Ga0157372_10020710
494 Ga0157372_10046477
495 Ga0157372_10047630
496 Ga0157372_10184298
497 Ga0157372_10200541
498 Ga0157372_10369217
499 Ga0157372_10475582
500 Ga0157372_10518775
501 Ga0157375_10039264
502 Ga0157375_10045514
503 Ga0157375_10158514
504 Ga0163163_10020215
505 Ga0163163_10055793
506 Ga0163163_10244433
507 Ga0157377_10394235
508 Ga0157379_10059444
509 Ga0157376_10059632
510 Ga0157376_10838711
511 Ga0157376_11149385
512 Ga0213872_10000592
513 Ga0213872_10005397
514 Ga0213874_10042962
515 Ga0213875_10026107
516 Ga0207656_10043416
517 Ga0207642_10119320
518 Ga0207680_10048001
519 Ga0207647_10063963
520 Ga0207647_10561753
521 Ga0207699_10334040
522 Ga0207705_10000310
523 Ga0207705_10008661
524 Ga0207705_10009507
525 Ga0207705_10139356
526 Ga0207654_10038326
527 Ga0207707_10019463
528 Ga0207707_10038282
529 Ga0207707_10582809
530 Ga0207695_10001035
531 Ga0207695_10033788
532 Ga0207695_10125381
533 Ga0207695_10134353
534 Ga0207695_10135802
535 Ga0207695_11177183
536 Ga0207671_10105798
537 Ga0207671_10120381
538 Ga0207693_10008408
539 Ga0207663_10027457
540 Ga0207660_10057375
541 Ga0207660_10382369
542 Ga0207660_10624959
543 Ga0207657_10000481
544 Ga0207657_10027820
545 Ga0207657_10353209
546 Ga0207649_10091021
547 Ga0207649_10373455
548 Ga0207652_10001465
549 Ga0207681_10011869
550 Ga0207694_10009629
551 Ga0207694_10009853
552 Ga0207694_10164912
553 Ga0207687_10028072
554 Ga0207687_10033007
555 Ga0207700_10392532
556 Ga0207700_10443525
557 Ga0207700_11090585
558 Ga0207690_10463145
559 Ga0207706_10001872
560 Ga0207686_10021775
561 Ga0207686_10047017
562 Ga0207670_10122681
563 Ga0207704_10070077
564 Ga0207665_10445753
565 Ga0207711_10012093
566 Ga0207689_10030837
567 Ga0207661_10016418
568 Ga0207661_10852261
569 Ga0207679_10127076
570 Ga0207679_10207872
571 Ga0207667_10000163
572 Ga0207667_10011608
573 Ga0207667_10012252
574 Ga0207667_10024609
575 Ga0207667_10078000
576 Ga0207667_10100263
577 Ga0207667_10145883
578 Ga0207712_10068775
579 Ga0207668_10026731
580 Ga0207640_10146153
581 Ga0207677_10002686
582 Ga0207677_10019397
583 Ga0207703_10319019
584 Ga0207639_10078631
585 Ga0207639_10236177
586 Ga0207678_10000691
587 Ga0207678_10015933
588 Ga0207678_10022843
589 Ga0207678_10776953
590 Ga0207702_10088980
591 Ga0207702_10249024
592 Ga0207648_10018198
593 Ga0207674_10007804
594 Ga0207674_10084760
595 Ga0207674_10130840
596 Ga0207675_100039880
597 Ga0207683_10295406
598 Ga0207698_10006231
599 Ga0207698_10456139
600 Ga0265356_1004313
601 Ga0268266_10063294
602 Ga0268265_10041289
603 Ga0268264_10154348
604 Ga0265762_1000021
605 Ga0265770_1069744
606 Ga0265760_10047489
607 Ga0373928_0074184
608 Ga0373932_0031116
609 Ga0373961_0071843
610 Ga0373935_0660393
611 Ga0373933_0005338
612 Ga0373937_0026764
613 Ga0395900_1073873
614 Ga0436364_0057335
615 Ga0436364_0115941
616 Ga0436364_0442246
617 Ga0436364_0575286
618 Ga0436364_0838310
619 Ga0436365_1456402
620 Ga0436360_1254475
621 Ga0436361_0014704
622 Ga0436361_0213924
623 Ga0436361_0434431
624 Ga0436361_0564223
625 Ga0436361_0931454
626 Ga0436361_1213611
627 Ga0436363_0338528
628 Ga0436363_1346412
629 Ga0436363_1515552
630 Ga0466967_0043645
631 Ga0466967_0907565
632 Ga0495603_0004102
633 Ga0495629_0034333
634 Ga0495651_0368973
635 Ga0495580_0103958
636 Ga0495582_0067301
637 Ga0495585_0011766
638 Ga0495594_0003547
639 Ga0495607_0097385
640 Ga0495583_0042043
641 Ga0495608_0252554
642 Ga0495628_0737443
643 Ga0495631_0090424
644 Ga0495644_0000013
645 Ga0495642_0032108
646 Ga0495652_0267705
647 Ga0495665_0081096
648 Ga0495609_0018608
649 Ga0495609_0062340
650 Ga0495645_0019293
651 Ga0495667_0154081
652 Ga0495625_0006268
653 Ga0495669_0001127
654 Ga0495669_0057748
655 Ga0495669_0289159
656 Ga0495600_0043265
657 Ga0495680_0523493
658 Ga0495677_0021778
659 Ga0495673_0148968
660 Ga0495681_0117544
661 Ga0495684_0222267
662 Ga0495602_0177189
663 Ga0496102_0423444
664 Ga0496104_0738143
665 Ga0496106_0285529
666 Ga0496106_0654243
667 Ga0496106_1111883
668 Ga0496108_0826192
669 Ga0496108_1143558
670 Ga0496109_0025498
671 Ga0496109_0332708
672 Ga0496110_0141039
673 Ga0496111_0405145
674 Ga0496112_0207243
675 Ga0496112_0527319
676 Ga0496113_0626371
677 Ga0496115_0322876
678 Ga0496115_0784441
679 Ga0496126_0000209
680 nmdc:mga0rr50_1774_c1
681 nmdc:mga08x19_12949_c1
682 nmdc:mga08x19_778060_c1
683 nmdc:mga0a205_54191_c1
684 Ga0495601_0083111

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

15

60

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fd5-assembly1.cif.gz_A-2 the crystal structure of a transcriptional regulator from pseudomonas aeruginosa pao1 0.7743 7 187
3eup-assembly1.cif.gz_B the crystal structure of the transcriptional regulator, tetr family from cytophaga hutchinsonii 0.7713 10 189
4yze-assembly1.cif.gz_A crystal structure of e.coli nemr reduced form 0.7705 10 187
4l62-assembly1.cif.gz_C crystal structure of pseudomonas aeruginosa transcriptional regulator pa2196 bound to its operator dna 0.7635 9 186
6zui-assembly1.cif.gz_A crystal structure of the cys-ser mutant of the cpyfp-based biosensor for hypochlorous acid 0.7627 11 94
ID Description Score Start End Superfamily
2fd5A02 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;Tetracycline Repressor, domain 2 0.803 53 187 1.10.357.10
2fd5A02 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;Tetracycline Repressor, domain 2 0.7872 53 187 1.10.357.10
1jt0D01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.775 11 57 1.10.10.60
1jt0C01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.7743 11 57 1.10.10.60
1qvuA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.7738 11 57 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A7Y9TAZ4-F1-model_v4 TetR family transcriptional regulator 0.9566 60 191
AF-A0A852VI50-F1-model_v4 TetR/AcrR family transcriptional repressor of nem operon 0.9454 37 191 GO:0003677
GO:0006355
AF-A0A2Z5G4A7-F1-model_v4 Transcriptional regulator, TetR family 0.9431 33 189 GO:0003677
GO:0006355
AF-A0A7Y9TAZ4-F1-model_v4 TetR family transcriptional regulator 0.9427 60 191
AF-Q1ITU9-F1-model_v4 Transcriptional regulator, TetR family 0.9323 1 191 GO:0003677
GO:0006355

Map