F414822

General Info

Members Datasets Scaffolds Average Seq Length
341 163 340 247

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_1448391|Ga0436364_1448391_86_925
Length 279
Sequence MFNGVELFTARVAAPPGLLSPHRQPEAENRFVNDFRLDGKTALITGGASGIGEATARLFADVGARVLIVDIDEQRASAVAQALPNSLKFVCDITDENQVAALFGSIDALDILVNCAGIGLVGGIEETELGDFQRLFRVNVDGTFLVTRAALPLLRKSHGSVVNIGSVAGLVGVKRRFAYCATKGAVIAMTRQLAVDYPTEIRANCITPGTVDSPFVEGYLEKYHRHEKEKVRLELNQRQPIGRLGRPDEIAKLALYISSPAADFMHGSVVTIDGGWTAA

Samples

Sample ID Description Type Environment
1 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
42 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
71 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
72 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
73 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
74 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
75 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
76 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
112 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
114 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
115 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
116 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
117 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
118 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
119 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
120 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
121 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
122 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
123 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
124 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
125 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
126 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
127 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
128 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
129 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
130 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
131 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
132 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
133 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
134 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
135 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
136 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
137 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
138 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
139 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
140 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
141 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
142 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
143 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
144 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
145 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
146 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
147 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
148 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
149 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
150 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
151 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
159 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
160 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
161 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
163 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.41
Metatranscriptomes 0.29
Isolates 0.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.29
Nodule 0
Rhizoplane 1.47
Rhizosphere 88.56
Stem 0
Stem Tuber 0
Unclassified 9.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10017605 3300001991 Bacteria 1343
2 Ga0070658_10065386 3300005327 Bacteria 2968
3 Ga0070658_10131664 3300005327 Bacteria 2084
4 Ga0070658_10152771 3300005327 Bacteria 1933
5 Ga0070658_10316575 3300005327 Bacteria 1332
6 Ga0070683_100001162 3300005329 Bacteria 19940
7 Ga0070683_100007583 3300005329 Bacteria 9176
8 Ga0070683_100108891 3300005329 Bacteria 2613
9 Ga0070683_100243881 3300005329 Bacteria 1709
10 Ga0070683_100429856 3300005329 Bacteria 1260
11 Ga0070670_100008190 3300005331 Bacteria 8900
12 Ga0068869_100011464 3300005334 Bacteria 5813
13 Ga0070680_100266770 3300005336 Unclassified 1449
14 Ga0068868_100001266 3300005338 Bacteria 17397
15 Ga0070660_100042729 3300005339 Unclassified 3461
16 Ga0070660_100110635 3300005339 Bacteria 2185
17 Ga0070660_100225576 3300005339 Bacteria 1523
18 Ga0070661_100016849 3300005344 Bacteria 5173
19 Ga0070661_100037458 3300005344 Bacteria 3528
20 Ga0070661_100288488 3300005344 Bacteria 1275
21 Ga0070671_100014315 3300005355 Bacteria 6407
22 Ga0070673_100136709 3300005364 Unclassified 2063
23 Ga0070667_100009292 3300005367 Bacteria 8148
24 Ga0070714_100026015 3300005435 Bacteria 4834
25 Ga0070714_100045461 3300005435 Bacteria 3721
26 Ga0070714_100045750 3300005435 Bacteria 3710
27 Ga0070713_100024703 3300005436 Bacteria 4687
28 Ga0070710_10239058 3300005437 Unclassified 1163
29 Ga0070663_100216715 3300005455 Bacteria 1501
30 Ga0070663_100243242 3300005455 Bacteria 1421
31 Ga0070678_100045164 3300005456 Bacteria 3150
32 Ga0070662_100151880 3300005457 Unclassified 1804
33 Ga0070681_10126456 3300005458 Bacteria 2489
34 Ga0070681_10144444 3300005458 Bacteria 2309
35 Ga0070681_10265763 3300005458 Bacteria 1627
36 Ga0070681_10517205 3300005458 Bacteria 1107
37 Ga0070681_10621486 3300005458 Bacteria 995
38 Ga0070679_100191146 3300005530 Bacteria 2016
39 Ga0070679_100342886 3300005530 Bacteria 1442
40 Ga0070679_100494754 3300005530 Bacteria 1167
41 Ga0070684_100001657 3300005535 Bacteria 16159
42 Ga0070684_100008510 3300005535 Bacteria 8025
43 Ga0070684_100226153 3300005535 Bacteria 1708
44 Ga0068853_100037021 3300005539 Bacteria 4151
45 Ga0070695_100323572 3300005545 Bacteria 1147
46 Ga0070693_100301547 3300005547 Bacteria 1080
47 Ga0070665_100083059 3300005548 Bacteria 3208
48 Ga0070665_100221032 3300005548 Unclassified 1894
49 Ga0068855_100000868 3300005563 Bacteria 37566
50 Ga0068855_100057526 3300005563 Bacteria 4557
51 Ga0068855_100064767 3300005563 Bacteria 4262
52 Ga0068855_100444931 3300005563 Bacteria 1415
53 Ga0070664_100345618 3300005564 Bacteria 1352
54 Ga0068857_100010531 3300005577 Bacteria 8039
55 Ga0068854_100184695 3300005578 Bacteria 1630
56 Ga0068856_100002738 3300005614 Bacteria 18050
57 Ga0068856_100020208 3300005614 Bacteria 6469
58 Ga0068856_100051632 3300005614 Bacteria 4054
59 Ga0068856_100133899 3300005614 Unclassified 2484
60 Ga0068856_100382301 3300005614 Unclassified 1427
61 Ga0068856_100406889 3300005614 Bacteria 1380
62 Ga0068852_100000003 3300005616 Bacteria 246525
63 Ga0068852_100031829 3300005616 Bacteria 4359
64 Ga0068852_100131723 3300005616 Bacteria 2303
65 Ga0068852_100324858 3300005616 Bacteria 1495
66 Ga0068859_100019776 3300005617 Bacteria 6758
67 Ga0068864_100002109 3300005618 Bacteria 16439
68 Ga0068864_100471902 3300005618 Bacteria 1203
69 Ga0068851_10022757 3300005834 Bacteria 3057
70 Ga0068851_10135922 3300005834 Bacteria 1333
71 Ga0068851_10168408 3300005834 Bacteria 1207
72 Ga0068863_100000455 3300005841 Bacteria 41700
73 Ga0068863_100025919 3300005841 Bacteria 5594
74 Ga0068858_100027449 3300005842 Bacteria 5289
75 Ga0068860_100001340 3300005843 Bacteria 26791
76 Ga0081455_10165004 3300005937 Bacteria 1693
77 Ga0070717_10016393 3300006028 Bacteria 5744
78 Ga0070717_10069896 3300006028 Bacteria 2925
79 Ga0070717_10098823 3300006028 Bacteria 2475
80 Ga0070717_10295871 3300006028 Unclassified 1438
81 Ga0075364_10042242 3300006051 Bacteria 2962
82 Ga0075432_10006084 3300006058 Bacteria 4102
83 Ga0070712_100370829 3300006175 Bacteria 1176
84 Ga0070712_100446395 3300006175 Unclassified 1076
85 Ga0097621_100052722 3300006237 Bacteria 3314
86 Ga0097621_100274906 3300006237 Bacteria 1481
87 Ga0068871_100001078 3300006358 Bacteria 18304
88 Ga0068871_100119560 3300006358 Bacteria 2224
89 Ga0075430_100270168 3300006846 Bacteria 1407
90 Ga0097620_100019776 3300006931 Bacteria 6758
91 Ga0105240_10000286 3300009093 Bacteria 98493
92 Ga0105240_10000531 3300009093 Bacteria 70393
93 Ga0105240_10003156 3300009093 Bacteria 25926
94 Ga0105240_10062519 3300009093 Bacteria 4635
95 Ga0105240_10088297 3300009093 Bacteria 3794
96 Ga0105240_10097609 3300009093 Bacteria 3580
97 Ga0105240_10128825 3300009093 Bacteria 3038
98 Ga0105240_10239756 3300009093 Bacteria 2103
99 Ga0105245_10000532 3300009098 Bacteria 34970
100 Ga0105245_10208507 3300009098 Bacteria 1880
101 Ga0105247_10004315 3300009101 Bacteria 9085
102 Ga0114129_10560242 3300009147 Bacteria 1485
103 Ga0105243_10042202 3300009148 Bacteria 3570
104 Ga0105241_10000563 3300009174 Bacteria 28046
105 Ga0105241_10003635 3300009174 Bacteria 11451
106 Ga0105241_10117810 3300009174 Bacteria 2134
107 Ga0105241_10355618 3300009174 Bacteria 1273
108 Ga0105248_10008071 3300009177 Bacteria 11555
109 Ga0105237_10003159 3300009545 Bacteria 19813
110 Ga0105237_10052217 3300009545 Bacteria 4104
111 Ga0105237_10534424 3300009545 Unclassified 1179
112 Ga0105238_10006306 3300009551 Bacteria 11791
113 Ga0105238_10024976 3300009551 Bacteria 6091
114 Ga0105238_10075863 3300009551 Bacteria 3354
115 Ga0105238_10146907 3300009551 Bacteria 2334
116 Ga0105238_10409187 3300009551 Bacteria 1350
117 Ga0105238_10461761 3300009551 Bacteria 1268
118 Ga0105239_10023576 3300010375 Bacteria 6777
119 Ga0105239_10109116 3300010375 Bacteria 3066
120 Ga0105246_10004381 3300011119 Bacteria 8590
121 Ga0157373_10327999 3300013100 Bacteria 1089
122 Ga0157370_10000001 3300013104 Bacteria 529517
123 Ga0157370_10067397 3300013104 Bacteria 3383
124 Ga0157370_10069681 3300013104 Bacteria 3321
125 Ga0157370_10127903 3300013104 Bacteria 2371
126 Ga0157370_10164757 3300013104 Unclassified 2062
127 Ga0157370_10180159 3300013104 Bacteria 1964
128 Ga0157370_10244287 3300013104 Bacteria 1661
129 Ga0157370_10391087 3300013104 Bacteria 1280
130 Ga0157369_10000519 3300013105 Bacteria 50731
131 Ga0157369_10007516 3300013105 Bacteria 12545
132 Ga0157369_10011788 3300013105 Bacteria 9926
133 Ga0157369_10022253 3300013105 Bacteria 7078
134 Ga0157369_10024577 3300013105 Bacteria 6698
135 Ga0157369_10045299 3300013105 Bacteria 4785
136 Ga0157369_10075147 3300013105 Bacteria 3623
137 Ga0157369_10107499 3300013105 Bacteria 2968
138 Ga0157369_10133077 3300013105 Bacteria 2634
139 Ga0157369_10519848 3300013105 Bacteria 1231
140 Ga0157369_10876730 3300013105 Bacteria 921
141 Ga0157374_10008545 3300013296 Bacteria 8756
142 Ga0157374_10016467 3300013296 Bacteria 6499
143 Ga0157374_10039909 3300013296 Bacteria 4322
144 Ga0157374_10234843 3300013296 Bacteria 1802
145 Ga0157378_10004302 3300013297 Bacteria 12541
146 Ga0157378_10017828 3300013297 Bacteria 6233
147 Ga0157378_10114728 3300013297 Bacteria 2475
148 Ga0157378_10134904 3300013297 Bacteria 2288
149 Ga0157378_10253588 3300013297 Bacteria 1685
150 Ga0157378_10335959 3300013297 Bacteria 1472
151 Ga0157378_10363667 3300013297 Bacteria 1416
152 Ga0163162_10010249 3300013306 Bacteria 9105
153 Ga0157372_10000045 3300013307 Bacteria 151277
154 Ga0157372_10005324 3300013307 Bacteria 13666
155 Ga0157372_10016073 3300013307 Bacteria 8028
156 Ga0157372_10027671 3300013307 Bacteria 6178
157 Ga0157372_10048627 3300013307 Bacteria 4714
158 Ga0157372_10085537 3300013307 Bacteria 3577
159 Ga0157372_10092632 3300013307 Bacteria 3438
160 Ga0157375_10008531 3300013308 Bacteria 8970
161 Ga0157375_10027068 3300013308 Bacteria 5355
162 Ga0157375_10139540 3300013308 Unclassified 2550
163 Ga0163163_10000396 3300014325 Bacteria 41149
164 Ga0157380_10391525 3300014326 Bacteria 1315
165 Ga0157376_10002999 3300014969 Bacteria 11581
166 Ga0157376_10004004 3300014969 Bacteria 10189
167 Ga0157376_10128569 3300014969 Bacteria 2257
168 Ga0157376_10175217 3300014969 Bacteria 1956
169 Ga0213873_10007469 3300021358 Bacteria 2192
170 Ga0213872_10000901 3300021361 Bacteria 21377
171 Ga0213874_10012645 3300021377 Unclassified 2169
172 Ga0213876_10013651 3300021384 Bacteria 4308
173 Ga0213876_10022871 3300021384 Unclassified 3303
174 Ga0213876_10155110 3300021384 Unclassified 1218
175 Ga0213875_10000008 3300021388 Bacteria 533344
176 Ga0213875_10005919 3300021388 Bacteria 6490
177 Ga0213875_10119893 3300021388 Unclassified 1229
178 Ga0213871_10005878 3300021441 Bacteria 2565
179 Ga0224712_10033724 3300022467 Bacteria 1876
180 Ga0207656_10183611 3300025321 Bacteria 1005
181 Ga0207710_10004004 3300025900 Bacteria 6495
182 Ga0207645_10236038 3300025907 Bacteria 1208
183 Ga0207705_10032877 3300025909 Bacteria 3706
184 Ga0207705_10063954 3300025909 Bacteria 2659
185 Ga0207705_10134648 3300025909 Bacteria 1841
186 Ga0207705_10317874 3300025909 Unclassified 1196
187 Ga0207705_10324693 3300025909 Bacteria 1183
188 Ga0207654_10000023 3300025911 Bacteria 161401
189 Ga0207654_10001415 3300025911 Bacteria 12727
190 Ga0207654_10316002 3300025911 Bacteria 1066
191 Ga0207707_10134267 3300025912 Bacteria 2164
192 Ga0207707_10484700 3300025912 Bacteria 1056
193 Ga0207707_10677372 3300025912 Bacteria 867
194 Ga0207695_10000026 3300025913 Bacteria 624558
195 Ga0207695_10002371 3300025913 Bacteria 27983
196 Ga0207695_10002710 3300025913 Bacteria 25847
197 Ga0207695_10057380 3300025913 Bacteria 4045
198 Ga0207695_10057421 3300025913 Bacteria 4043
199 Ga0207695_10064919 3300025913 Bacteria 3755
200 Ga0207695_10418104 3300025913 Unclassified 1225
201 Ga0207671_10001836 3300025914 Bacteria 23699
202 Ga0207671_10024577 3300025914 Bacteria 4527
203 Ga0207671_10085338 3300025914 Bacteria 2372
204 Ga0207660_10269747 3300025917 Unclassified 1348
205 Ga0207657_10021584 3300025919 Bacteria 6055
206 Ga0207649_10118731 3300025920 Bacteria 1780
207 Ga0207652_10050861 3300025921 Bacteria 3551
208 Ga0207652_10167982 3300025921 Bacteria 1968
209 Ga0207694_10000429 3300025924 Bacteria 39058
210 Ga0207694_10139156 3300025924 Bacteria 1951
211 Ga0207694_10301323 3300025924 Bacteria 1320
212 Ga0207650_10005037 3300025925 Bacteria 9020
213 Ga0207687_10006480 3300025927 Bacteria 7730
214 Ga0207687_10070095 3300025927 Bacteria 2502
215 Ga0207700_10512312 3300025928 Bacteria 1062
216 Ga0207664_10061994 3300025929 Bacteria 2985
217 Ga0207664_10144816 3300025929 Bacteria 2014
218 Ga0207664_10438032 3300025929 Bacteria 1165
219 Ga0207644_10018227 3300025931 Bacteria 4747
220 Ga0207706_10017105 3300025933 Bacteria 6538
221 Ga0207689_10001181 3300025942 Bacteria 25124
222 Ga0207661_10001470 3300025944 Bacteria 15929
223 Ga0207661_10004933 3300025944 Bacteria 9357
224 Ga0207661_10011225 3300025944 Bacteria 6482
225 Ga0207661_10281435 3300025944 Bacteria 1487
226 Ga0207667_10000923 3300025949 Bacteria 37509
227 Ga0207667_10009269 3300025949 Bacteria 11618
228 Ga0207667_10023155 3300025949 Bacteria 6841
229 Ga0207712_10040745 3300025961 Bacteria 3189
230 Ga0207640_10056280 3300025981 Bacteria 2580
231 Ga0207640_10183018 3300025981 Bacteria 1573
232 Ga0207658_10005898 3300025986 Bacteria 8369
233 Ga0207677_10001506 3300026023 Bacteria 12300
234 Ga0207703_10026586 3300026035 Bacteria 4556
235 Ga0207639_10041560 3300026041 Bacteria 3441
236 Ga0207678_10281383 3300026067 Bacteria 1428
237 Ga0207702_10003964 3300026078 Bacteria 13294
238 Ga0207702_10054564 3300026078 Unclassified 3387
239 Ga0207702_10094789 3300026078 Bacteria 2621
240 Ga0207702_10199181 3300026078 Bacteria 1855
241 Ga0207702_10481135 3300026078 Unclassified 1208
242 Ga0207641_10007080 3300026088 Bacteria 9366
243 Ga0207641_10020687 3300026088 Bacteria 5406
244 Ga0207676_10009811 3300026095 Bacteria 6809
245 Ga0207674_10016634 3300026116 Bacteria 8042
246 Ga0207674_10229136 3300026116 Bacteria 1806
247 Ga0207698_10000128 3300026142 Bacteria 47261
248 Ga0207698_10010847 3300026142 Bacteria 5881
249 Ga0207698_10034504 3300026142 Bacteria 3689
250 Ga0207428_10237685 3300027907 Bacteria 1362
251 Ga0268266_10001975 3300028379 Bacteria 22986
252 Ga0268266_10577302 3300028379 Bacteria 1079
253 Ga0265328_10079230 3300031239 Bacteria 1210
254 Ga0265339_10000040 3300031249 Bacteria 120556
255 Ga0265339_10035204 3300031249 Bacteria 2811
256 Ga0265316_10129656 3300031344 Bacteria 1900
257 Ga0265314_10010488 3300031711 Bacteria 7725
258 Ga0265314_10082514 3300031711 Bacteria 2115
259 Ga0265342_10005070 3300031712 Bacteria 10151
260 Ga0373936_0000085 3300035113 Bacteria 34909
261 Ga0373945_0041308 3300035116 Bacteria 1667
262 Ga0373927_0001589 3300035695 Bacteria 17035
263 Ga0373927_0003084 3300035695 Bacteria 12068
264 Ga0373937_0276823 3300036401 Bacteria 1584
265 Ga0395900_0040566 3300037418 Bacteria 4797
266 Ga0436364_0061843 3300037853 Bacteria 14650
267 Ga0436364_0300871 3300037853 Unclassified 1419
268 Ga0436364_0499135 3300037853 Bacteria 5901
269 Ga0436364_0534382 3300037853 Unclassified 4734
270 Ga0436364_0672952 3300037853 Bacteria 1417
271 Ga0436364_0933894 3300037853 Bacteria 3838
272 Ga0436364_1149080 3300037853 Bacteria 1082
273 Ga0436364_1153730 3300037853 Bacteria 1900
274 Ga0436364_1295187 3300037853 Bacteria 1348
275 Ga0436364_1415525 3300037853 Bacteria 425173
276 Ga0436364_1448391 3300037853 Unclassified 969
277 Ga0436364_1480059 3300037853 Bacteria 11624
278 Ga0436365_0196182 3300039437 Bacteria 42871
279 Ga0436365_0222745 3300039437 Bacteria 1298
280 Ga0436365_0479513 3300039437 Bacteria 1349
281 Ga0436365_0732737 3300039437 Bacteria 965
282 Ga0436365_0896865 3300039437 Bacteria 1479
283 Ga0436365_1108047 3300039437 Unclassified 3635
284 Ga0436365_1280955 3300039437 Unclassified 1219
285 Ga0436365_1425003 3300039437 Unclassified 1533
286 Ga0436361_0222193 3300039447 Unclassified 2863
287 Ga0436361_0333408 3300039447 Unclassified 3166
288 Ga0436361_0402273 3300039447 Bacteria 11165
289 Ga0436361_0779674 3300039447 Bacteria 61407
290 Ga0436363_0007176 3300039450 Bacteria 3708
291 Ga0436363_1121244 3300039450 Bacteria 1497
292 Ga0436362_0025762 3300039453 Unclassified 1958
293 Ga0436362_0634081 3300039453 Bacteria 2943
294 Ga0466967_0280455 3300045976 Unclassified 1599
295 Ga0495592_0230115 3300046454 Bacteria 1235
296 Ga0495651_0009441 3300046462 Bacteria 7491
297 Ga0495580_0031265 3300046472 Bacteria 3848
298 Ga0495580_0213935 3300046472 Bacteria 1326
299 Ga0495606_0111672 3300046507 Bacteria 1648
300 Ga0495652_0041366 3300046529 Bacteria 3979
301 Ga0495587_0041885 3300046536 Bacteria 2732
302 Ga0495587_0250526 3300046536 Bacteria 996
303 Ga0495645_0004744 3300046543 Bacteria 9291
304 Ga0495645_0214047 3300046543 Unclassified 1300
305 Ga0495667_0135888 3300046559 Bacteria 1585
306 Ga0495599_0121060 3300046678 Bacteria 1627
307 Ga0495623_0018452 3300046679 Bacteria 4507
308 Ga0495646_0056040 3300046680 Bacteria 2364
309 Ga0495600_0008041 3300046809 Bacteria 6465
310 Ga0495604_0012335 3300047317 Bacteria 6794
311 Ga0495674_0037704 3300047319 Bacteria 4343
312 Ga0495672_0082203 3300047320 Bacteria 1792
313 Ga0495681_0005982 3300047470 Bacteria 8065
314 Ga0495602_0036828 3300048088 Bacteria 4548
315 Ga0496102_0084543 3300048905 Bacteria 2929
316 Ga0496110_0828706 3300048913 Bacteria 830
317 Ga0496112_0053893 3300048915 Unclassified 3951
318 Ga0496112_0095153 3300048915 Bacteria 2949
319 Ga0496114_0165373 3300048917 Bacteria 1926
320 Ga0496126_0000004 3300048929 Bacteria 925026
321 Ga0496126_0000836 3300048929 Bacteria 54625
322 Ga0496126_0220526 3300048929 Bacteria 1593
323 Ga0501032_0239490 3300049569 Unclassified 1179
324 Ga0501033_0193916 3300049570 Bacteria 1453
325 Ga0501034_0049085 3300049571 Bacteria 4260
326 Ga0501037_0435883 3300049573 Bacteria 895
327 Ga0501043_0090175 3300049579 Bacteria 2410
328 Ga0501043_0127663 3300049579 Unclassified 1994
329 Ga0501047_0178011 3300049581 Bacteria 1994
330 Ga0501047_0368540 3300049581 Bacteria 1271
331 Ga0501048_0035931 3300049582 Bacteria 3564
332 Ga0501070_0018304 3300049586 Bacteria 5876
333 Ga0501070_0084266 3300049586 Bacteria 2632
334 Ga0501249_006409 3300049679 Bacteria 2420
335 Ga0501080_0094792 3300049742 Bacteria 2772
336 Ga0501035_0018786 3300049822 Bacteria 6367
337 Ga0501044_0000597 3300049823 Bacteria 43761
338 Ga0501044_0001053 3300049823 Bacteria 33150
339 Ga0501044_0051996 3300049823 Bacteria 4224
340 nmdc:mga08x19_935_c1 3300050514 Bacteria 18384

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005458 Ga0070681_10621486 Ga0070681_106214861 211
2 3300013104 Ga0157370_10180159 Ga0157370_101801592 211
3 3300025912 Ga0207707_10484700 Ga0207707_104847002 211
4 3300028379 Ga0268266_10577302 Ga0268266_105773022 211
5 3300037853 Ga0436364_0300871 Ga0436364_0300871_361_1125 211
6 3300048929 Ga0496126_0000836 Ga0496126_0000836_22885_23634 211
7 3300046507 Ga0495606_0111672 Ga0495606_0111672_642_1391 213
8 3300049586 Ga0501070_0084266 Ga0501070_0084266_58_807 213
9 3300005329 Ga0070683_100007583 Ga0070683_1000075832 216
10 3300005535 Ga0070684_100008510 Ga0070684_1000085106 216
11 3300014326 Ga0157380_10391525 Ga0157380_103915252 216
12 3300025944 Ga0207661_10004933 Ga0207661_100049332 216
13 3300035113 Ga0373936_0000085 Ga0373936_0000085_19892_20641 216
14 3300013297 Ga0157378_10114728 Ga0157378_101147282 217
15 3300005548 Ga0070665_100083059 Ga0070665_1000830594 218
16 3300028379 Ga0268266_10001975 Ga0268266_1000197524 218
17 3300048929 Ga0496126_0000004 Ga0496126_0000004_498210_498959 218
18 3300049581 Ga0501047_0178011 Ga0501047_0178011_523_1461 220
19 iso_pu_bacteria 2738543015 2739262693 221
20 3300009093 Ga0105240_10097609 Ga0105240_100976092 222
21 3300009551 Ga0105238_10024976 Ga0105238_100249763 222
22 3300047319 Ga0495674_0037704 Ga0495674_0037704_13_762 222
23 3300025907 Ga0207645_10236038 Ga0207645_102360381 223
24 3300005578 Ga0068854_100184695 Ga0068854_1001846952 224
25 3300010375 Ga0105239_10109116 Ga0105239_101091162 224
26 3300013105 Ga0157369_10519848 Ga0157369_105198482 224
27 3300013308 Ga0157375_10008531 Ga0157375_100085314 224
28 3300025921 Ga0207652_10050861 Ga0207652_100508612 224
29 3300025981 Ga0207640_10056280 Ga0207640_100562802 224
30 3300026041 Ga0207639_10041560 Ga0207639_100415602 224
31 3300039450 Ga0436363_1121244 Ga0436363_1121244_760_1479 224
32 3300005530 Ga0070679_100342886 Ga0070679_1003428862 225
33 3300006051 Ga0075364_10042242 Ga0075364_100422421 225
34 3300006058 Ga0075432_10006084 Ga0075432_100060843 225
35 3300013297 Ga0157378_10004302 Ga0157378_100043029 225
36 3300027907 Ga0207428_10237685 Ga0207428_102376851 225
37 3300047320 Ga0495672_0082203 Ga0495672_0082203_930_1670 225
38 3300047470 Ga0495681_0005982 Ga0495681_0005982_4710_5450 225
39 3300005327 Ga0070658_10131664 Ga0070658_101316642 226
40 3300005329 Ga0070683_100108891 Ga0070683_1001088912 226
41 3300005344 Ga0070661_100037458 Ga0070661_1000374581 226
42 3300005614 Ga0068856_100051632 Ga0068856_1000516323 226
43 3300005616 Ga0068852_100131723 Ga0068852_1001317232 226
44 3300005834 Ga0068851_10168408 Ga0068851_101684082 226
45 3300009551 Ga0105238_10075863 Ga0105238_100758632 226
46 3300013307 Ga0157372_10005324 Ga0157372_100053247 226
47 3300025909 Ga0207705_10134648 Ga0207705_101346481 226
48 3300025944 Ga0207661_10011225 Ga0207661_100112253 226
49 3300026142 Ga0207698_10010847 Ga0207698_100108473 226
50 3300031239 Ga0265328_10079230 Ga0265328_100792302 228
51 3300031249 Ga0265339_10000040 Ga0265339_10000040113 228
52 3300031711 Ga0265314_10082514 Ga0265314_100825142 228
53 3300031712 Ga0265342_10005070 Ga0265342_100050706 228
54 3300005455 Ga0070663_100216715 Ga0070663_1002167152 230
55 3300006846 Ga0075430_100270168 Ga0075430_1002701682 232
56 3300014969 Ga0157376_10128569 Ga0157376_101285692 232
57 3300025928 Ga0207700_10512312 Ga0207700_105123121 232
58 3300035695 Ga0373927_0001589 Ga0373927_0001589_6853_7596 232
59 3300046472 Ga0495580_0213935 Ga0495580_0213935_319_1062 232
60 3300048905 Ga0496102_0084543 Ga0496102_0084543_1297_2052 232
61 3300048913 Ga0496110_0828706 Ga0496110_0828706_49_792 232
62 3300048915 Ga0496112_0095153 Ga0496112_0095153_2072_2827 232
63 3300049679 Ga0501249_006409 Ga0501249_006409_109_852 232
64 3300005339 Ga0070660_100042729 Ga0070660_1000427292 233
65 3300005437 Ga0070710_10239058 Ga0070710_102390581 233
66 3300005456 Ga0070678_100045164 Ga0070678_1000451642 233
67 3300005458 Ga0070681_10517205 Ga0070681_105172051 233
68 3300005547 Ga0070693_100301547 Ga0070693_1003015471 233
69 3300005563 Ga0068855_100444931 Ga0068855_1004449311 233
70 3300006028 Ga0070717_10016393 Ga0070717_100163935 233
71 3300009093 Ga0105240_10239756 Ga0105240_102397562 233
72 3300009551 Ga0105238_10461761 Ga0105238_104617612 233
73 3300013104 Ga0157370_10244287 Ga0157370_102442871 233
74 3300013105 Ga0157369_10022253 Ga0157369_100222532 233
75 3300013296 Ga0157374_10039909 Ga0157374_100399094 233
76 3300013297 Ga0157378_10363667 Ga0157378_103636672 233
77 3300021377 Ga0213874_10012645 Ga0213874_100126452 233
78 3300025924 Ga0207694_10301323 Ga0207694_103013232 233
79 3300026078 Ga0207702_10054564 Ga0207702_100545642 233
80 3300039437 Ga0436365_0479513 Ga0436365_0479513_39_785 233
81 3300039437 Ga0436365_0732737 Ga0436365_0732737_196_942 233
82 3300039437 Ga0436365_0896865 Ga0436365_0896865_169_915 233
83 3300039450 Ga0436363_0007176 Ga0436363_0007176_1518_2264 233
84 3300048915 Ga0496112_0053893 Ga0496112_0053893_1154_1900 233
85 3300005327 Ga0070658_10316575 Ga0070658_103165751 234
86 3300005329 Ga0070683_100429856 Ga0070683_1004298562 234
87 3300005336 Ga0070680_100266770 Ga0070680_1002667702 234
88 3300005339 Ga0070660_100110635 Ga0070660_1001106352 234
89 3300005344 Ga0070661_100016849 Ga0070661_1000168492 234
90 3300005455 Ga0070663_100243242 Ga0070663_1002432422 234
91 3300005458 Ga0070681_10126456 Ga0070681_101264562 234
92 3300005530 Ga0070679_100191146 Ga0070679_1001911462 234
93 3300005535 Ga0070684_100226153 Ga0070684_1002261532 234
94 3300005545 Ga0070695_100323572 Ga0070695_1003235722 234
95 3300005614 Ga0068856_100020208 Ga0068856_1000202084 234
96 3300005614 Ga0068856_100133899 Ga0068856_1001338992 234
97 3300005618 Ga0068864_100471902 Ga0068864_1004719023 234
98 3300005841 Ga0068863_100025919 Ga0068863_1000259193 234
99 3300005937 Ga0081455_10165004 Ga0081455_101650042 234
100 3300006028 Ga0070717_10069896 Ga0070717_100698964 234
101 3300006028 Ga0070717_10295871 Ga0070717_102958711 234
102 3300006175 Ga0070712_100446395 Ga0070712_1004463952 234
103 3300006237 Ga0097621_100274906 Ga0097621_1002749061 234
104 3300006358 Ga0068871_100119560 Ga0068871_1001195602 234
105 3300009093 Ga0105240_10003156 Ga0105240_1000315613 234
106 3300009174 Ga0105241_10355618 Ga0105241_103556182 234
107 3300009545 Ga0105237_10003159 Ga0105237_100031597 234
108 3300009545 Ga0105237_10534424 Ga0105237_105344241 234
109 3300013100 Ga0157373_10327999 Ga0157373_103279992 234
110 3300013104 Ga0157370_10069681 Ga0157370_100696812 234
111 3300013104 Ga0157370_10127903 Ga0157370_101279031 234
112 3300013104 Ga0157370_10391087 Ga0157370_103910872 234
113 3300013105 Ga0157369_10007516 Ga0157369_100075168 234
114 3300013105 Ga0157369_10045299 Ga0157369_100452993 234
115 3300013105 Ga0157369_10876730 Ga0157369_108767301 234
116 3300013297 Ga0157378_10335959 Ga0157378_103359592 234
117 3300014969 Ga0157376_10175217 Ga0157376_101752172 234
118 3300021361 Ga0213872_10000901 Ga0213872_100009019 234
119 3300021384 Ga0213876_10013651 Ga0213876_100136512 234
120 3300021384 Ga0213876_10022871 Ga0213876_100228713 234
121 3300021384 Ga0213876_10155110 Ga0213876_101551101 234
122 3300021388 Ga0213875_10000008 Ga0213875_1000000844 234
123 3300021388 Ga0213875_10005919 Ga0213875_100059192 234
124 3300021388 Ga0213875_10119893 Ga0213875_101198932 234
125 3300021441 Ga0213871_10005878 Ga0213871_100058782 234
126 3300022467 Ga0224712_10033724 Ga0224712_100337242 234
127 3300025909 Ga0207705_10324693 Ga0207705_103246932 234
128 3300025912 Ga0207707_10677372 Ga0207707_106773721 234
129 3300025913 Ga0207695_10002710 Ga0207695_1000271014 234
130 3300025914 Ga0207671_10024577 Ga0207671_100245772 234
131 3300025917 Ga0207660_10269747 Ga0207660_102697472 234
132 3300025921 Ga0207652_10167982 Ga0207652_101679822 234
133 3300025944 Ga0207661_10281435 Ga0207661_102814352 234
134 3300025961 Ga0207712_10040745 Ga0207712_100407453 234
135 3300026067 Ga0207678_10281383 Ga0207678_102813831 234
136 3300026078 Ga0207702_10094789 Ga0207702_100947892 234
137 3300026088 Ga0207641_10020687 Ga0207641_100206873 234
138 3300026116 Ga0207674_10229136 Ga0207674_102291361 234
139 3300031249 Ga0265339_10035204 Ga0265339_100352042 234
140 3300031711 Ga0265314_10010488 Ga0265314_100104883 234
141 3300035116 Ga0373945_0041308 Ga0373945_0041308_251_1000 234
142 3300035695 Ga0373927_0003084 Ga0373927_0003084_2063_2812 234
143 3300036401 Ga0373937_0276823 Ga0373937_0276823_624_1373 234
144 3300037418 Ga0395900_0040566 Ga0395900_0040566_2519_3268 234
145 3300037853 Ga0436364_0061843 Ga0436364_0061843_11767_12516 234
146 3300037853 Ga0436364_0499135 Ga0436364_0499135_445_1194 234
147 3300037853 Ga0436364_0534382 Ga0436364_0534382_566_1324 234
148 3300037853 Ga0436364_0933894 Ga0436364_0933894_2692_3441 234
149 3300037853 Ga0436364_1149080 Ga0436364_1149080_82_831 234
150 3300037853 Ga0436364_1153730 Ga0436364_1153730_1114_1863 234
151 3300037853 Ga0436364_1295187 Ga0436364_1295187_306_1064 234
152 3300037853 Ga0436364_1415525 Ga0436364_1415525_366439_367203 234
153 3300037853 Ga0436364_1448391 Ga0436364_1448391_86_925 234
154 3300037853 Ga0436364_1480059 Ga0436364_1480059_2038_2787 234
155 3300039437 Ga0436365_0196182 Ga0436365_0196182_33106_33855 234
156 3300039437 Ga0436365_0222745 Ga0436365_0222745_399_1148 234
157 3300039437 Ga0436365_1108047 Ga0436365_1108047_177_926 234
158 3300039437 Ga0436365_1280955 Ga0436365_1280955_234_983 234
159 3300039437 Ga0436365_1425003 Ga0436365_1425003_238_987 234
160 3300039447 Ga0436361_0222193 Ga0436361_0222193_186_935 234
161 3300039447 Ga0436361_0333408 Ga0436361_0333408_1854_2603 234
162 3300039447 Ga0436361_0779674 Ga0436361_0779674_10536_11285 234
163 3300039453 Ga0436362_0025762 Ga0436362_0025762_135_884 234
164 3300045976 Ga0466967_0280455 Ga0466967_0280455_25_774 234
165 3300046472 Ga0495580_0031265 Ga0495580_0031265_2555_3304 234
166 3300046543 Ga0495645_0214047 Ga0495645_0214047_457_1206 234
167 3300048917 Ga0496114_0165373 Ga0496114_0165373_268_1044 234
168 3300049569 Ga0501032_0239490 Ga0501032_0239490_402_1160 234
169 3300049570 Ga0501033_0193916 Ga0501033_0193916_604_1362 234
170 3300049571 Ga0501034_0049085 Ga0501034_0049085_3438_4196 234
171 3300049573 Ga0501037_0435883 Ga0501037_0435883_44_802 234
172 3300049579 Ga0501043_0090175 Ga0501043_0090175_1169_1927 234
173 3300049579 Ga0501043_0127663 Ga0501043_0127663_276_1034 234
174 3300049581 Ga0501047_0368540 Ga0501047_0368540_20_778 234
175 3300049582 Ga0501048_0035931 Ga0501048_0035931_1006_1764 234
176 3300049586 Ga0501070_0018304 Ga0501070_0018304_1199_1957 234
177 3300049742 Ga0501080_0094792 Ga0501080_0094792_1061_1819 234
178 3300049822 Ga0501035_0018786 Ga0501035_0018786_4901_5659 234
179 3300049823 Ga0501044_0000597 Ga0501044_0000597_18430_19188 234
180 3300049823 Ga0501044_0001053 Ga0501044_0001053_25846_26604 234
181 3300049823 Ga0501044_0051996 Ga0501044_0051996_3362_4120 234
182 3300050514 nmdc:mga08x19_935_c1 nmdc:mga08x19_935_c1_5761_6510 234
183 3300005327 Ga0070658_10065386 Ga0070658_100653862 235
184 3300005435 Ga0070714_100026015 Ga0070714_1000260151 235
185 3300005458 Ga0070681_10144444 Ga0070681_101444442 235
186 3300005530 Ga0070679_100494754 Ga0070679_1004947541 235
187 3300009147 Ga0114129_10560242 Ga0114129_105602422 235
188 3300021358 Ga0213873_10007469 Ga0213873_100074691 235
189 3300025909 Ga0207705_10063954 Ga0207705_100639542 235
190 3300025912 Ga0207707_10134267 Ga0207707_101342672 235
191 3300025929 Ga0207664_10144816 Ga0207664_101448161 235
192 3300037853 Ga0436364_0672952 Ga0436364_0672952_548_1300 235
193 3300039453 Ga0436362_0634081 Ga0436362_0634081_903_1655 235
194 3300005616 Ga0068852_100324858 Ga0068852_1003248582 236
195 3300013297 Ga0157378_10134904 Ga0157378_101349041 236
196 3300009148 Ga0105243_10042202 Ga0105243_100422022 237
197 3300014969 Ga0157376_10004004 Ga0157376_100040042 237
198 3300048929 Ga0496126_0220526 Ga0496126_0220526_523_1281 237
199 3300005327 Ga0070658_10152771 Ga0070658_101527712 238
200 3300005339 Ga0070660_100225576 Ga0070660_1002255762 238
201 3300005344 Ga0070661_100288488 Ga0070661_1002884882 238
202 3300005435 Ga0070714_100045750 Ga0070714_1000457503 238
203 3300005539 Ga0068853_100037021 Ga0068853_1000370214 238
204 3300005563 Ga0068855_100064767 Ga0068855_1000647673 238
205 3300005614 Ga0068856_100406889 Ga0068856_1004068892 238
206 3300005616 Ga0068852_100031829 Ga0068852_1000318292 238
207 3300005834 Ga0068851_10135922 Ga0068851_101359222 238
208 3300006028 Ga0070717_10098823 Ga0070717_100988232 238
209 3300009093 Ga0105240_10000531 Ga0105240_1000053120 238
210 3300009093 Ga0105240_10128825 Ga0105240_101288252 238
211 3300009174 Ga0105241_10117810 Ga0105241_101178102 238
212 3300009551 Ga0105238_10409187 Ga0105238_104091871 238
213 3300013104 Ga0157370_10067397 Ga0157370_100673972 238
214 3300013104 Ga0157370_10164757 Ga0157370_101647572 238
215 3300013105 Ga0157369_10024577 Ga0157369_100245776 238
216 3300013105 Ga0157369_10075147 Ga0157369_100751475 238
217 3300013105 Ga0157369_10133077 Ga0157369_101330772 238
218 3300013296 Ga0157374_10234843 Ga0157374_102348432 238
219 3300013307 Ga0157372_10016073 Ga0157372_100160734 238
220 3300013307 Ga0157372_10048627 Ga0157372_100486272 238
221 3300013307 Ga0157372_10085537 Ga0157372_100855372 238
222 3300025909 Ga0207705_10032877 Ga0207705_100328772 238
223 3300025909 Ga0207705_10317874 Ga0207705_103178742 238
224 3300025913 Ga0207695_10002371 Ga0207695_1000237114 238
225 3300025913 Ga0207695_10418104 Ga0207695_104181041 238
226 3300025919 Ga0207657_10021584 Ga0207657_100215847 238
227 3300025920 Ga0207649_10118731 Ga0207649_101187311 238
228 3300025929 Ga0207664_10438032 Ga0207664_104380321 238
229 3300025949 Ga0207667_10009269 Ga0207667_100092696 238
230 3300025981 Ga0207640_10183018 Ga0207640_101830182 238
231 3300026142 Ga0207698_10034504 Ga0207698_100345042 238
232 3300046454 Ga0495592_0230115 Ga0495592_0230115_37_810 239
233 3300046462 Ga0495651_0009441 Ga0495651_0009441_3822_4595 239
234 3300046529 Ga0495652_0041366 Ga0495652_0041366_3118_3891 239
235 3300046536 Ga0495587_0041885 Ga0495587_0041885_52_825 239
236 3300046543 Ga0495645_0004744 Ga0495645_0004744_6855_7628 239
237 3300046559 Ga0495667_0135888 Ga0495667_0135888_532_1305 239
238 3300046678 Ga0495599_0121060 Ga0495599_0121060_653_1426 239
239 3300046679 Ga0495623_0018452 Ga0495623_0018452_1884_2657 239
240 3300046680 Ga0495646_0056040 Ga0495646_0056040_990_1763 239
241 3300046809 Ga0495600_0008041 Ga0495600_0008041_424_1197 239
242 3300047317 Ga0495604_0012335 Ga0495604_0012335_3265_4038 239
243 3300048088 Ga0495602_0036828 Ga0495602_0036828_2652_3425 239
244 3300039447 Ga0436361_0402273 Ga0436361_0402273_8515_9288 242
245 3300005364 Ga0070673_100136709 Ga0070673_1001367092 243
246 3300005457 Ga0070662_100151880 Ga0070662_1001518802 243
247 3300005548 Ga0070665_100221032 Ga0070665_1002210322 243
248 3300005563 Ga0068855_100057526 Ga0068855_1000575262 243
249 3300009093 Ga0105240_10062519 Ga0105240_100625192 243
250 3300009098 Ga0105245_10208507 Ga0105245_102085072 243
251 3300013105 Ga0157369_10011788 Ga0157369_100117888 243
252 3300013297 Ga0157378_10253588 Ga0157378_102535881 243
253 3300013307 Ga0157372_10027671 Ga0157372_100276712 243
254 3300013308 Ga0157375_10139540 Ga0157375_101395402 243
255 3300025913 Ga0207695_10057421 Ga0207695_100574214 243
256 3300025924 Ga0207694_10139156 Ga0207694_101391562 243
257 3300025927 Ga0207687_10070095 Ga0207687_100700952 243
258 3300025933 Ga0207706_10017105 Ga0207706_100171053 243
259 3300025949 Ga0207667_10023155 Ga0207667_100231552 243
260 3300031344 Ga0265316_10129656 Ga0265316_101296562 243
261 3300005329 Ga0070683_100243881 Ga0070683_1002438812 244
262 3300005458 Ga0070681_10265763 Ga0070681_102657632 244
263 3300005563 Ga0068855_100000868 Ga0068855_10000086810 244
264 3300005616 Ga0068852_100000003 Ga0068852_100000003214 244
265 3300009093 Ga0105240_10000286 Ga0105240_1000028618 244
266 3300013104 Ga0157370_10000001 Ga0157370_10000001239 244
267 3300013105 Ga0157369_10000519 Ga0157369_1000051926 244
268 3300013307 Ga0157372_10000045 Ga0157372_1000004526 244
269 3300025911 Ga0207654_10316002 Ga0207654_103160022 244
270 3300025913 Ga0207695_10000026 Ga0207695_10000026328 244
271 3300025925 Ga0207650_10005037 Ga0207650_100050378 244
272 3300025949 Ga0207667_10000923 Ga0207667_1000092310 244
273 3300026142 Ga0207698_10000128 Ga0207698_1000012826 244
274 3300001991 JGI24743J22301_10017605 JGI24743J22301_100176052 245
275 3300005329 Ga0070683_100001162 Ga0070683_10000116210 245
276 3300005331 Ga0070670_100008190 Ga0070670_1000081903 245
277 3300005334 Ga0068869_100011464 Ga0068869_1000114643 245
278 3300005338 Ga0068868_100001266 Ga0068868_10000126610 245
279 3300005355 Ga0070671_100014315 Ga0070671_1000143152 245
280 3300005367 Ga0070667_100009292 Ga0070667_1000092926 245
281 3300005435 Ga0070714_100045461 Ga0070714_1000454613 245
282 3300005436 Ga0070713_100024703 Ga0070713_1000247032 245
283 3300005535 Ga0070684_100001657 Ga0070684_10000165712 245
284 3300005564 Ga0070664_100345618 Ga0070664_1003456182 245
285 3300005577 Ga0068857_100010531 Ga0068857_1000105316 245
286 3300005614 Ga0068856_100002738 Ga0068856_1000027384 245
287 3300005614 Ga0068856_100382301 Ga0068856_1003823012 245
288 3300005617 Ga0068859_100019776 Ga0068859_1000197762 245
289 3300005618 Ga0068864_100002109 Ga0068864_10000210912 245
290 3300005834 Ga0068851_10022757 Ga0068851_100227574 245
291 3300005841 Ga0068863_100000455 Ga0068863_1000004554 245
292 3300005842 Ga0068858_100027449 Ga0068858_1000274494 245
293 3300005843 Ga0068860_100001340 Ga0068860_1000013408 245
294 3300006175 Ga0070712_100370829 Ga0070712_1003708292 245
295 3300006237 Ga0097621_100052722 Ga0097621_1000527222 245
296 3300006358 Ga0068871_100001078 Ga0068871_1000010784 245
297 3300006931 Ga0097620_100019776 Ga0097620_1000197762 245
298 3300009093 Ga0105240_10088297 Ga0105240_100882973 245
299 3300009098 Ga0105245_10000532 Ga0105245_1000053211 245
300 3300009101 Ga0105247_10004315 Ga0105247_100043153 245
301 3300009174 Ga0105241_10000563 Ga0105241_1000056314 245
302 3300009174 Ga0105241_10003635 Ga0105241_100036357 245
303 3300009177 Ga0105248_10008071 Ga0105248_100080715 245
304 3300009545 Ga0105237_10052217 Ga0105237_100522173 245
305 3300009551 Ga0105238_10006306 Ga0105238_100063067 245
306 3300009551 Ga0105238_10146907 Ga0105238_101469072 245
307 3300010375 Ga0105239_10023576 Ga0105239_100235763 245
308 3300011119 Ga0105246_10004381 Ga0105246_100043814 245
309 3300013105 Ga0157369_10107499 Ga0157369_101074992 245
310 3300013296 Ga0157374_10008545 Ga0157374_100085459 245
311 3300013296 Ga0157374_10016467 Ga0157374_100164676 245
312 3300013297 Ga0157378_10017828 Ga0157378_100178282 245
313 3300013306 Ga0163162_10010249 Ga0163162_100102499 245
314 3300013307 Ga0157372_10092632 Ga0157372_100926322 245
315 3300013308 Ga0157375_10027068 Ga0157375_100270684 245
316 3300014325 Ga0163163_10000396 Ga0163163_100003965 245
317 3300014969 Ga0157376_10002999 Ga0157376_100029995 245
318 3300025321 Ga0207656_10183611 Ga0207656_101836111 245
319 3300025900 Ga0207710_10004004 Ga0207710_100040046 245
320 3300025911 Ga0207654_10000023 Ga0207654_10000023139 245
321 3300025911 Ga0207654_10001415 Ga0207654_100014159 245
322 3300025913 Ga0207695_10057380 Ga0207695_100573804 245
323 3300025913 Ga0207695_10064919 Ga0207695_100649192 245
324 3300025914 Ga0207671_10001836 Ga0207671_100018363 245
325 3300025914 Ga0207671_10085338 Ga0207671_100853382 245
326 3300025924 Ga0207694_10000429 Ga0207694_1000042922 245
327 3300025927 Ga0207687_10006480 Ga0207687_100064806 245
328 3300025929 Ga0207664_10061994 Ga0207664_100619943 245
329 3300025931 Ga0207644_10018227 Ga0207644_100182272 245
330 3300025942 Ga0207689_10001181 Ga0207689_100011813 245
331 3300025944 Ga0207661_10001470 Ga0207661_100014703 245
332 3300025986 Ga0207658_10005898 Ga0207658_100058983 245
333 3300026023 Ga0207677_10001506 Ga0207677_100015063 245
334 3300026035 Ga0207703_10026586 Ga0207703_100265862 245
335 3300026078 Ga0207702_10003964 Ga0207702_1000396410 245
336 3300026078 Ga0207702_10199181 Ga0207702_101991812 245
337 3300026078 Ga0207702_10481135 Ga0207702_104811352 245
338 3300026088 Ga0207641_10007080 Ga0207641_100070802 245
339 3300026095 Ga0207676_10009811 Ga0207676_100098116 245
340 3300026116 Ga0207674_10016634 Ga0207674_100166346 245
341 3300046536 Ga0495587_0250526 Ga0495587_0250526_71_862 245

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

40

224

0.96

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

46

277

0.94

PF08659

KR

KR domain

40

196

0.87

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

42

245

0.71

PF23441

33

277

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
5jsf-assembly1.cif.gz_A crystal structure of 17beta-hydroxysteroid dehydrogenase 14 s205 variant in complex with nad. 0.9247 15 238
6emm-assembly1.cif.gz_A 17beta-hydroxysteroid dehydrogenase 14 variant t205 in complex with salicylic acid 0.9242 15 238
6qck-assembly1.cif.gz_A 17beta-hydroxysteroid dehydrogenase 14 variant t205 in complex with fb262 0.9238 16 238
6gtb-assembly1.cif.gz_A 17beta-hydroxysteroid dehydrogenase 14 variant t205 in complex with fb211 0.9233 16 238
6h0m-assembly1.cif.gz_A 17beta-hydroxysteroid dehydrogenase type 14 mutant k158a in complex with nicotinamide adenine dinucleotide 0.9215 16 238
ID Description Score Start End Superfamily
af_K7MUD1_29_120_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9454 18 90 3.40.50.720
2ag5D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9209 15 242 3.40.50.720
1iy8A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9187 16 241 3.40.50.720
af_C6T421_12_106_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9185 13 83 3.40.50.720
5itvA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.917 13 242 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A847ZWD3-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9665 15 130 GO:0008667
GO:0019290
AF-A0A7J8AYS6-F1-model_v4 Dehydrogenase/reductase SDR family member 6 (EC 1.1.1.104) (EC 1.1.1.30) ((R)-beta-hydroxybutyrate dehydrogenase) (3-hydroxybutyrate dehydrogenase type 2) (4-oxo-L-proline reductase) (Oxidoreductase UCPA) (Short chain dehydrogenase/reductase family 15C member 1) 0.9615 15 134 GO:0003858
GO:0005737
GO:0019290
AF-A0A529XRR3-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9567 14 134 GO:0016491
AF-A0A3Q7WL48-F1-model_v4 deleted 0.9541 15 137
AF-A0A2V9UFI3-F1-model_v4 Short-chain dehydrogenase 0.9413 8 242 GO:0016616

Feature Viewer

pLDDT pTM Quality
87.42 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map