F414508

General Info

Members Datasets Scaffolds Average Seq Length
340 166 680 226

Family's Representative Sequence

Representative Sequence 3300049584|Ga0501068_0098243|Ga0501068_0098243_573_1364
Length 263
Sequence LNPSYAQIRARIDKAAQAAGHAVRLLAVSKTQAASAIRELSVQGQLAFGENRVQEALTKQQALTDLNLEWHLIGPLQSNKCREAALQFDWLQSLDREKLLEPLNRFRPADAPPLNVLVQVNIDAEASKSGCTPAAVPMLARAIAQFPRLRLRGLMAIPEPHPDSARRRATFARMRDLFESLRPDHPDIDTLSMGMSDDFELAIAEGATLVRIGTALFGARPSPIRPCCGTPCIVRTNRVDSRTRLKQRARNHCLVNHLMRRVS

Samples

Sample ID Description Type Environment
1 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
57 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
70 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
71 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
119 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
120 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
121 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
122 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
123 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
124 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
125 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
126 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
127 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
128 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
129 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
130 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
131 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
132 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
133 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
134 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
135 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
136 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
137 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
138 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
139 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
140 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
150 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
151 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
152 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
153 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
154 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
155 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
156 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
157 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
158 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
160 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
161 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
162 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
163 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
164 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
165 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
166 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.76
Nodule 0
Rhizoplane 0.88
Rhizosphere 94.41
Stem 0
Stem Tuber 0
Unclassified 0.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501068_0098243 3300049584 Bacteria 1812
2 Ga0070658_10047190 3300005327 Bacteria 3485
3 Ga0070658_10098624 3300005327 Bacteria 2413
4 Ga0070658_10235197 3300005327 Bacteria 1552
5 Ga0070676_10042819 3300005328 Bacteria 2631
6 Ga0070683_100066135 3300005329 Bacteria 3367
7 Ga0070690_100023709 3300005330 Bacteria 3767
8 Ga0070690_100080579 3300005330 Bacteria 2129
9 Ga0070670_100089092 3300005331 Bacteria 2652
10 Ga0068869_100015489 3300005334 Bacteria 5116
11 Ga0068869_100585895 3300005334 Unclassified 941
12 Ga0070666_10007605 3300005335 Bacteria 6684
13 Ga0070666_10044605 3300005335 Bacteria 2970
14 Ga0070666_10113058 3300005335 Bacteria 1878
15 Ga0070666_10119778 3300005335 Bacteria 1825
16 Ga0068868_100226556 3300005338 Bacteria 1567
17 Ga0070661_100050745 3300005344 Bacteria 3036
18 Ga0070668_100015331 3300005347 Bacteria 5727
19 Ga0070668_100285586 3300005347 Bacteria 1379
20 Ga0070669_100068716 3300005353 Bacteria 2616
21 Ga0070675_100255750 3300005354 Bacteria 1534
22 Ga0070675_100596321 3300005354 Bacteria 1002
23 Ga0070673_100193988 3300005364 Bacteria 1746
24 Ga0070673_100376407 3300005364 Bacteria 1265
25 Ga0070667_100000065 3300005367 Bacteria 135172
26 Ga0070667_100072738 3300005367 Bacteria 2930
27 Ga0070667_100154226 3300005367 Bacteria 2019
28 Ga0070667_100175881 3300005367 Bacteria 1892
29 Ga0070667_100198853 3300005367 Bacteria 1778
30 Ga0070709_10319158 3300005434 Bacteria 1139
31 Ga0070663_100000323 3300005455 Bacteria 24799
32 Ga0070663_100376781 3300005455 Bacteria 1155
33 Ga0070663_100625008 3300005455 Bacteria 908
34 Ga0070678_100002751 3300005456 Bacteria 9716
35 Ga0070678_100180517 3300005456 Bacteria 1727
36 Ga0070662_100339422 3300005457 Bacteria 1229
37 Ga0070681_10000006 3300005458 Bacteria 169066
38 Ga0070681_10160246 3300005458 Bacteria 2174
39 Ga0068867_100021286 3300005459 Bacteria 4627
40 Ga0068867_100150852 3300005459 Bacteria 1825
41 Ga0070679_100374287 3300005530 Bacteria 1371
42 Ga0070684_100292210 3300005535 Bacteria 1494
43 Ga0068853_100004932 3300005539 Bacteria 10391
44 Ga0068853_100016082 3300005539 Bacteria 6153
45 Ga0068853_100058712 3300005539 Bacteria 3321
46 Ga0068853_100104751 3300005539 Bacteria 2505
47 Ga0068853_100323763 3300005539 Bacteria 1429
48 Ga0070672_100012694 3300005543 Bacteria 5928
49 Ga0070672_100085389 3300005543 Bacteria 2537
50 Ga0070686_100339974 3300005544 Bacteria 1125
51 Ga0070696_100155448 3300005546 Bacteria 1682
52 Ga0070693_100224907 3300005547 Bacteria 1232
53 Ga0070665_100398712 3300005548 Bacteria 1383
54 Ga0070665_100469443 3300005548 Bacteria 1269
55 Ga0070665_101112013 3300005548 Bacteria 802
56 Ga0068855_100013929 3300005563 Bacteria 9698
57 Ga0068855_100148069 3300005563 Bacteria 2671
58 Ga0068855_100367222 3300005563 Bacteria 1583
59 Ga0068855_100408605 3300005563 Bacteria 1487
60 Ga0070664_100051863 3300005564 Bacteria 3474
61 Ga0068857_100224540 3300005577 Bacteria 1716
62 Ga0068857_100856096 3300005577 Bacteria 870
63 Ga0068856_100014180 3300005614 Bacteria 7704
64 Ga0068856_100019846 3300005614 Bacteria 6526
65 Ga0068856_100154260 3300005614 Bacteria 2306
66 Ga0068856_100244281 3300005614 Bacteria 1810
67 Ga0068852_100002303 3300005616 Bacteria 13129
68 Ga0068852_100013899 3300005616 Bacteria 6174
69 Ga0068852_100100664 3300005616 Bacteria 2608
70 Ga0068859_100766594 3300005617 Bacteria 1053
71 Ga0068864_100033089 3300005618 Bacteria 4394
72 Ga0068866_10054141 3300005718 Bacteria 2055
73 Ga0068870_10072000 3300005840 Bacteria 1888
74 Ga0068863_100006433 3300005841 Bacteria 11520
75 Ga0068863_100007265 3300005841 Bacteria 10849
76 Ga0068863_100145522 3300005841 Bacteria 2266
77 Ga0068863_100179677 3300005841 Bacteria 2031
78 Ga0068863_100344235 3300005841 Bacteria 1451
79 Ga0068863_100359501 3300005841 Bacteria 1419
80 Ga0068858_100438555 3300005842 Bacteria 1258
81 Ga0068858_100560410 3300005842 Bacteria 1106
82 Ga0068862_100045337 3300005844 Bacteria 3752
83 Ga0068862_100163895 3300005844 Bacteria 1986
84 Ga0097621_100116512 3300006237 Bacteria 2262
85 Ga0097621_100158139 3300006237 Bacteria 1946
86 Ga0097621_100538672 3300006237 Bacteria 1061
87 Ga0068871_100024015 3300006358 Bacteria 4724
88 Ga0068871_100110064 3300006358 Bacteria 2316
89 Ga0068871_100235745 3300006358 Bacteria 1589
90 Ga0068865_100003484 3300006881 Bacteria 9432
91 Ga0068865_100034824 3300006881 Bacteria 3381
92 Ga0097620_100752770 3300006931 Bacteria 1063
93 Ga0097620_100766603 3300006931 Bacteria 1053
94 Ga0105240_10036912 3300009093 Bacteria 6283
95 Ga0105240_10183751 3300009093 Bacteria 2465
96 Ga0105240_10441285 3300009093 Bacteria 1458
97 Ga0105245_10112069 3300009098 Bacteria 2538
98 Ga0105245_10256967 3300009098 Bacteria 1699
99 Ga0105241_10007418 3300009174 Bacteria 8071
100 Ga0105241_10023728 3300009174 Bacteria 4550
101 Ga0105241_10477969 3300009174 Bacteria 1107
102 Ga0105242_10087290 3300009176 Bacteria 2619
103 Ga0105242_10648617 3300009176 Bacteria 1026
104 Ga0105248_10052542 3300009177 Bacteria 4572
105 Ga0105248_10373936 3300009177 Bacteria 1604
106 Ga0105237_10005392 3300009545 Bacteria 14452
107 Ga0105237_10046122 3300009545 Bacteria 4384
108 Ga0105238_10010067 3300009551 Bacteria 9484
109 Ga0105238_10045986 3300009551 Bacteria 4408
110 Ga0105238_10060412 3300009551 Bacteria 3794
111 Ga0105249_10000221 3300009553 Bacteria 64924
112 Ga0105249_10209333 3300009553 Bacteria 1913
113 Ga0105249_10424709 3300009553 Bacteria 1364
114 Ga0105249_10778288 3300009553 Bacteria 1020
115 Ga0105239_10010154 3300010375 Bacteria 10550
116 Ga0105239_10016417 3300010375 Bacteria 8187
117 Ga0105239_10023284 3300010375 Bacteria 6823
118 Ga0105239_10287131 3300010375 Bacteria 1852
119 Ga0105239_10899367 3300010375 Bacteria 1016
120 Ga0105246_10049640 3300011119 Bacteria 2874
121 Ga0157373_10038772 3300013100 Bacteria 3414
122 Ga0157373_10291236 3300013100 Bacteria 1158
123 Ga0157371_10286405 3300013102 Bacteria 1191
124 Ga0157370_10020832 3300013104 Bacteria 6542
125 Ga0157370_10096706 3300013104 Bacteria 2770
126 Ga0157370_10103241 3300013104 Bacteria 2669
127 Ga0157370_10331144 3300013104 Bacteria 1404
128 Ga0157369_10000114 3300013105 Bacteria 113453
129 Ga0157369_10014852 3300013105 Bacteria 8789
130 Ga0157369_10128079 3300013105 Bacteria 2690
131 Ga0157374_10249492 3300013296 Bacteria 1746
132 Ga0157374_10428663 3300013296 Bacteria 1322
133 Ga0157378_10000322 3300013297 Bacteria 47146
134 Ga0157378_10041842 3300013297 Bacteria 4065
135 Ga0157378_10108509 3300013297 Bacteria 2542
136 Ga0163162_10018746 3300013306 Bacteria 6782
137 Ga0163162_10048786 3300013306 Bacteria 4242
138 Ga0163162_10058299 3300013306 Bacteria 3890
139 Ga0163162_10093354 3300013306 Bacteria 3094
140 Ga0157372_10004055 3300013307 Bacteria 15698
141 Ga0157372_10055037 3300013307 Bacteria 4441
142 Ga0157372_10518556 3300013307 Bacteria 1389
143 Ga0157372_10671104 3300013307 Bacteria 1207
144 Ga0157375_10000459 3300013308 Bacteria 37058
145 Ga0157375_10130162 3300013308 Bacteria 2635
146 Ga0157375_10270868 3300013308 Bacteria 1860
147 Ga0157375_10567025 3300013308 Bacteria 1296
148 Ga0163163_10000404 3300014325 Bacteria 40714
149 Ga0163163_10080418 3300014325 Bacteria 3259
150 Ga0163163_10102868 3300014325 Bacteria 2881
151 Ga0182008_10054109 3300014497 Bacteria 1986
152 Ga0157379_10009947 3300014968 Bacteria 8284
153 Ga0157379_10044170 3300014968 Bacteria 3978
154 Ga0157379_10157803 3300014968 Bacteria 2047
155 Ga0157376_10005681 3300014969 Bacteria 8738
156 Ga0157376_10051310 3300014969 Bacteria 3426
157 Ga0157376_10163678 3300014969 Bacteria 2019
158 Ga0157376_10174697 3300014969 Bacteria 1959
159 Ga0157376_10723467 3300014969 Bacteria 1002
160 Ga0182007_10054351 3300015262 Bacteria 1317
161 Ga0163161_10117976 3300017792 Bacteria 1991
162 Ga0207656_10274146 3300025321 Bacteria 831
163 Ga0207680_10000218 3300025903 Bacteria 27690
164 Ga0207680_10033774 3300025903 Bacteria 2922
165 Ga0207680_10106237 3300025903 Bacteria 1812
166 Ga0207647_10007321 3300025904 Bacteria 7982
167 Ga0207699_10135696 3300025906 Bacteria 1611
168 Ga0207645_10025450 3300025907 Bacteria 3829
169 Ga0207643_10048065 3300025908 Bacteria 2416
170 Ga0207654_10000266 3300025911 Bacteria 31883
171 Ga0207707_10001002 3300025912 Bacteria 27055
172 Ga0207707_10544811 3300025912 Bacteria 986
173 Ga0207695_10000359 3300025913 Bacteria 104462
174 Ga0207695_10033139 3300025913 Bacteria 5642
175 Ga0207695_10430273 3300025913 Bacteria 1204
176 Ga0207695_10759915 3300025913 Bacteria 849
177 Ga0207671_10000940 3300025914 Bacteria 36298
178 Ga0207671_10001203 3300025914 Bacteria 30754
179 Ga0207671_10002422 3300025914 Bacteria 19967
180 Ga0207663_10372299 3300025916 Bacteria 1086
181 Ga0207660_10055463 3300025917 Bacteria 2832
182 Ga0207657_10044918 3300025919 Bacteria 3881
183 Ga0207649_10207390 3300025920 Bacteria 1388
184 Ga0207649_10333761 3300025920 Bacteria 1118
185 Ga0207649_10624243 3300025920 Bacteria 831
186 Ga0207652_10093346 3300025921 Bacteria 2648
187 Ga0207652_10150068 3300025921 Bacteria 2087
188 Ga0207681_10165986 3300025923 Bacteria 1669
189 Ga0207694_10014315 3300025924 Bacteria 5980
190 Ga0207694_10035262 3300025924 Bacteria 3838
191 Ga0207694_10275793 3300025924 Bacteria 1380
192 Ga0207650_10315129 3300025925 Bacteria 1280
193 Ga0207690_10125346 3300025932 Bacteria 1872
194 Ga0207706_10390216 3300025933 Bacteria 1208
195 Ga0207686_10034560 3300025934 Bacteria 3026
196 Ga0207669_10806032 3300025937 Bacteria 779
197 Ga0207704_10002700 3300025938 Bacteria 8007
198 Ga0207691_10020532 3300025940 Bacteria 6246
199 Ga0207691_10025673 3300025940 Bacteria 5529
200 Ga0207711_10001306 3300025941 Bacteria 23569
201 Ga0207711_10094208 3300025941 Bacteria 2639
202 Ga0207689_10017009 3300025942 Bacteria 6153
203 Ga0207689_10085306 3300025942 Bacteria 2596
204 Ga0207689_10218444 3300025942 Bacteria 1575
205 Ga0207661_10085104 3300025944 Bacteria 2620
206 Ga0207667_10006234 3300025949 Bacteria 14473
207 Ga0207667_10077055 3300025949 Bacteria 3458
208 Ga0207667_10435278 3300025949 Bacteria 1334
209 Ga0207651_10131938 3300025960 Bacteria 1914
210 Ga0207712_10000107 3300025961 Bacteria 94254
211 Ga0207668_10058206 3300025972 Bacteria 2700
212 Ga0207658_10000114 3300025986 Bacteria 88818
213 Ga0207658_10143805 3300025986 Bacteria 1934
214 Ga0207658_10143921 3300025986 Bacteria 1933
215 Ga0207677_10096899 3300026023 Bacteria 2159
216 Ga0207677_10268582 3300026023 Bacteria 1394
217 Ga0207703_10052315 3300026035 Bacteria 3315
218 Ga0207703_10512262 3300026035 Bacteria 1127
219 Ga0207639_10000258 3300026041 Bacteria 38476
220 Ga0207639_10029293 3300026041 Bacteria 4029
221 Ga0207639_10036965 3300026041 Bacteria 3623
222 Ga0207639_10075076 3300026041 Bacteria 2657
223 Ga0207639_10208831 3300026041 Bacteria 1679
224 Ga0207639_10320966 3300026041 Bacteria 1375
225 Ga0207639_10645124 3300026041 Bacteria 979
226 Ga0207678_10001080 3300026067 Bacteria 24986
227 Ga0207678_10266259 3300026067 Bacteria 1469
228 Ga0207702_10001632 3300026078 Bacteria 22176
229 Ga0207702_10254954 3300026078 Bacteria 1649
230 Ga0207702_10903393 3300026078 Bacteria 875
231 Ga0207641_10047489 3300026088 Bacteria 3620
232 Ga0207641_10128000 3300026088 Bacteria 2276
233 Ga0207648_10015569 3300026089 Bacteria 6988
234 Ga0207648_10019820 3300026089 Bacteria 6070
235 Ga0207648_10353726 3300026089 Bacteria 1324
236 Ga0207676_10018568 3300026095 Bacteria 5058
237 Ga0207674_10006181 3300026116 Bacteria 14129
238 Ga0207674_10794659 3300026116 Bacteria 913
239 Ga0207675_100703301 3300026118 Unclassified 1020
240 Ga0207683_10004575 3300026121 Bacteria 11916
241 Ga0207683_10017684 3300026121 Bacteria 6079
242 Ga0207683_10066132 3300026121 Bacteria 3188
243 Ga0207698_10007442 3300026142 Bacteria 6856
244 Ga0207698_10018903 3300026142 Bacteria 4705
245 Ga0207698_10025546 3300026142 Bacteria 4163
246 Ga0207698_10067410 3300026142 Bacteria 2822
247 Ga0207698_10158265 3300026142 Bacteria 1977
248 Ga0207698_10422382 3300026142 Bacteria 1279
249 Ga0207698_11013999 3300026142 Bacteria 841
250 Ga0268266_10081688 3300028379 Bacteria 2819
251 Ga0268266_10216056 3300028379 Bacteria 1760
252 Ga0268266_10437314 3300028379 Bacteria 1242
253 Ga0268265_10031668 3300028380 Bacteria 3821
254 Ga0268265_10199788 3300028380 Bacteria 1734
255 Ga0268264_10041126 3300028381 Bacteria 3822
256 Ga0268264_10086790 3300028381 Bacteria 2689
257 Ga0268264_10261747 3300028381 Bacteria 1612
258 Ga0307509_10052848 3300031507 Bacteria 4336
259 Ga0307507_10050508 3300033179 Bacteria 4013
260 Ga0373957_0086999 3300035120 Bacteria 1238
261 Ga0373955_0461956 3300035172 Bacteria 774
262 Ga0395900_0001309 3300037418 Bacteria 30258
263 Ga0395900_0055165 3300037418 Bacteria 4092
264 Ga0395898_0578772 3300037466 Bacteria 1065
265 Ga0451807_0586572 3300041486 Bacteria 1348
266 Ga0451577_0094550 3300042876 Bacteria 2669
267 Ga0495603_0030195 3300046455 Bacteria 3266
268 Ga0495580_0018830 3300046472 Bacteria 5138
269 Ga0495639_0050962 3300046475 Bacteria 1881
270 Ga0495657_0036094 3300046675 Bacteria 3419
271 Ga0495658_0017152 3300046683 Bacteria 3736
272 Ga0495686_0010519 3300047472 Bacteria 6575
273 Ga0495593_0049364 3300047673 Bacteria 2233
274 Ga0496104_0000041 3300048907 Bacteria 161394
275 Ga0496105_0000022 3300048908 Bacteria 161208
276 Ga0496117_0040092 3300048920 Bacteria 3450
277 Ga0496117_0137788 3300048920 Bacteria 1467
278 Ga0496117_0153422 3300048920 Bacteria 1360
279 Ga0496118_0000101 3300048921 Bacteria 159577
280 Ga0496118_0000264 3300048921 Bacteria 91882
281 Ga0496121_0136916 3300048924 Bacteria 1823
282 Ga0496122_0000212 3300048925 Bacteria 129245
283 Ga0496123_0003184 3300048926 Bacteria 18734
284 Ga0501032_0001459 3300049569 Bacteria 18794
285 Ga0501032_0204210 3300049569 Bacteria 1289
286 Ga0501033_0006045 3300049570 Bacteria 9488
287 Ga0501034_0007119 3300049571 Bacteria 11931
288 Ga0501034_0041200 3300049571 Bacteria 4672
289 Ga0501034_0149318 3300049571 Bacteria 2313
290 Ga0501034_0448931 3300049571 Bacteria 1207
291 Ga0501036_0012332 3300049572 Bacteria 7078
292 Ga0501036_0049398 3300049572 Bacteria 3562
293 Ga0501038_0008808 3300049574 Bacteria 9257
294 Ga0501038_0087248 3300049574 Bacteria 2620
295 Ga0501039_0006854 3300049575 Bacteria 8667
296 Ga0501043_0263323 3300049579 Bacteria 1325
297 Ga0501046_0001553 3300049580 Bacteria 21923
298 Ga0501046_0137642 3300049580 Bacteria 1849
299 Ga0501047_0003391 3300049581 Bacteria 15079
300 Ga0501047_0009312 3300049581 Bacteria 9275
301 Ga0501047_0046459 3300049581 Bacteria 4196
302 Ga0501067_0000679 3300049583 Bacteria 18323
303 Ga0501068_0023740 3300049584 Bacteria 3596
304 Ga0501068_0336208 3300049584 Bacteria 969
305 Ga0501069_0112150 3300049585 Bacteria 1553
306 Ga0501069_0180197 3300049585 Bacteria 1221
307 Ga0501070_0024853 3300049586 Bacteria 5023
308 Ga0501070_0044784 3300049586 Bacteria 3680
309 Ga0501070_0050074 3300049586 Bacteria 3468
310 Ga0501070_0108597 3300049586 Bacteria 2292
311 Ga0501070_0188355 3300049586 Bacteria 1696
312 Ga0501072_0001569 3300049588 Bacteria 17055
313 Ga0501073_0002650 3300049589 Bacteria 13415
314 Ga0501073_0038750 3300049589 Bacteria 3379
315 Ga0501073_0457676 3300049589 Bacteria 882
316 Ga0501074_0055966 3300049590 Bacteria 2842
317 Ga0501074_0175010 3300049590 Bacteria 1531
318 Ga0501074_0362171 3300049590 Bacteria 1029
319 Ga0501079_0233983 3300049741 Bacteria 1435
320 Ga0501079_0263741 3300049741 Bacteria 1346
321 Ga0501080_0003901 3300049742 Bacteria 13206
322 Ga0501080_0034205 3300049742 Bacteria 4743
323 Ga0501080_0037581 3300049742 Bacteria 4523
324 Ga0501080_0111766 3300049742 Bacteria 2532
325 Ga0501080_0129960 3300049742 Bacteria 2331
326 Ga0501083_0003475 3300049744 Bacteria 11017
327 Ga0501035_0019699 3300049822 Bacteria 6199
328 Ga0501035_0390706 3300049822 Bacteria 1159
329 Ga0501044_0006152 3300049823 Bacteria 13257
330 Ga0500610_0000097 3300053079 Bacteria 25957
331 Ga0500643_014585 3300053087 Bacteria 2725
332 Ga0500651_0016256 3300053093 Bacteria 4576
333 Ga0500651_0132709 3300053093 Bacteria 1505
334 Ga0500597_000037 3300053120 Bacteria 26711
335 Ga0501084_0031037 3300054114 Bacteria 4469
336 Ga0501084_0319291 3300054114 Bacteria 1312
337 Ga0500661_002907 3300055283 Bacteria 3224
338 Ga0501082_0028450 3300060353 Bacteria 4815
339 Ga0501082_0112153 3300060353 Bacteria 2361
340 Ga0501082_0233031 3300060353 Bacteria 1602
341 Ga0501068_0098243
342 Ga0070658_10047190
343 Ga0070658_10098624
344 Ga0070658_10235197
345 Ga0070676_10042819
346 Ga0070683_100066135
347 Ga0070690_100023709
348 Ga0070690_100080579
349 Ga0070670_100089092
350 Ga0068869_100015489
351 Ga0068869_100585895
352 Ga0070666_10007605
353 Ga0070666_10044605
354 Ga0070666_10113058
355 Ga0070666_10119778
356 Ga0068868_100226556
357 Ga0070661_100050745
358 Ga0070668_100015331
359 Ga0070668_100285586
360 Ga0070669_100068716
361 Ga0070675_100255750
362 Ga0070675_100596321
363 Ga0070673_100193988
364 Ga0070673_100376407
365 Ga0070667_100000065
366 Ga0070667_100072738
367 Ga0070667_100154226
368 Ga0070667_100175881
369 Ga0070667_100198853
370 Ga0070709_10319158
371 Ga0070663_100000323
372 Ga0070663_100376781
373 Ga0070663_100625008
374 Ga0070678_100002751
375 Ga0070678_100180517
376 Ga0070662_100339422
377 Ga0070681_10000006
378 Ga0070681_10160246
379 Ga0068867_100021286
380 Ga0068867_100150852
381 Ga0070679_100374287
382 Ga0070684_100292210
383 Ga0068853_100004932
384 Ga0068853_100016082
385 Ga0068853_100058712
386 Ga0068853_100104751
387 Ga0068853_100323763
388 Ga0070672_100012694
389 Ga0070672_100085389
390 Ga0070686_100339974
391 Ga0070696_100155448
392 Ga0070693_100224907
393 Ga0070665_100398712
394 Ga0070665_100469443
395 Ga0070665_101112013
396 Ga0068855_100013929
397 Ga0068855_100148069
398 Ga0068855_100367222
399 Ga0068855_100408605
400 Ga0070664_100051863
401 Ga0068857_100224540
402 Ga0068857_100856096
403 Ga0068856_100014180
404 Ga0068856_100019846
405 Ga0068856_100154260
406 Ga0068856_100244281
407 Ga0068852_100002303
408 Ga0068852_100013899
409 Ga0068852_100100664
410 Ga0068859_100766594
411 Ga0068864_100033089
412 Ga0068866_10054141
413 Ga0068870_10072000
414 Ga0068863_100006433
415 Ga0068863_100007265
416 Ga0068863_100145522
417 Ga0068863_100179677
418 Ga0068863_100344235
419 Ga0068863_100359501
420 Ga0068858_100438555
421 Ga0068858_100560410
422 Ga0068862_100045337
423 Ga0068862_100163895
424 Ga0097621_100116512
425 Ga0097621_100158139
426 Ga0097621_100538672
427 Ga0068871_100024015
428 Ga0068871_100110064
429 Ga0068871_100235745
430 Ga0068865_100003484
431 Ga0068865_100034824
432 Ga0097620_100752770
433 Ga0097620_100766603
434 Ga0105240_10036912
435 Ga0105240_10183751
436 Ga0105240_10441285
437 Ga0105245_10112069
438 Ga0105245_10256967
439 Ga0105241_10007418
440 Ga0105241_10023728
441 Ga0105241_10477969
442 Ga0105242_10087290
443 Ga0105242_10648617
444 Ga0105248_10052542
445 Ga0105248_10373936
446 Ga0105237_10005392
447 Ga0105237_10046122
448 Ga0105238_10010067
449 Ga0105238_10045986
450 Ga0105238_10060412
451 Ga0105249_10000221
452 Ga0105249_10209333
453 Ga0105249_10424709
454 Ga0105249_10778288
455 Ga0105239_10010154
456 Ga0105239_10016417
457 Ga0105239_10023284
458 Ga0105239_10287131
459 Ga0105239_10899367
460 Ga0105246_10049640
461 Ga0157373_10038772
462 Ga0157373_10291236
463 Ga0157371_10286405
464 Ga0157370_10020832
465 Ga0157370_10096706
466 Ga0157370_10103241
467 Ga0157370_10331144
468 Ga0157369_10000114
469 Ga0157369_10014852
470 Ga0157369_10128079
471 Ga0157374_10249492
472 Ga0157374_10428663
473 Ga0157378_10000322
474 Ga0157378_10041842
475 Ga0157378_10108509
476 Ga0163162_10018746
477 Ga0163162_10048786
478 Ga0163162_10058299
479 Ga0163162_10093354
480 Ga0157372_10004055
481 Ga0157372_10055037
482 Ga0157372_10518556
483 Ga0157372_10671104
484 Ga0157375_10000459
485 Ga0157375_10130162
486 Ga0157375_10270868
487 Ga0157375_10567025
488 Ga0163163_10000404
489 Ga0163163_10080418
490 Ga0163163_10102868
491 Ga0182008_10054109
492 Ga0157379_10009947
493 Ga0157379_10044170
494 Ga0157379_10157803
495 Ga0157376_10005681
496 Ga0157376_10051310
497 Ga0157376_10163678
498 Ga0157376_10174697
499 Ga0157376_10723467
500 Ga0182007_10054351
501 Ga0163161_10117976
502 Ga0207656_10274146
503 Ga0207680_10000218
504 Ga0207680_10033774
505 Ga0207680_10106237
506 Ga0207647_10007321
507 Ga0207699_10135696
508 Ga0207645_10025450
509 Ga0207643_10048065
510 Ga0207654_10000266
511 Ga0207707_10001002
512 Ga0207707_10544811
513 Ga0207695_10000359
514 Ga0207695_10033139
515 Ga0207695_10430273
516 Ga0207695_10759915
517 Ga0207671_10000940
518 Ga0207671_10001203
519 Ga0207671_10002422
520 Ga0207663_10372299
521 Ga0207660_10055463
522 Ga0207657_10044918
523 Ga0207649_10207390
524 Ga0207649_10333761
525 Ga0207649_10624243
526 Ga0207652_10093346
527 Ga0207652_10150068
528 Ga0207681_10165986
529 Ga0207694_10014315
530 Ga0207694_10035262
531 Ga0207694_10275793
532 Ga0207650_10315129
533 Ga0207690_10125346
534 Ga0207706_10390216
535 Ga0207686_10034560
536 Ga0207669_10806032
537 Ga0207704_10002700
538 Ga0207691_10020532
539 Ga0207691_10025673
540 Ga0207711_10001306
541 Ga0207711_10094208
542 Ga0207689_10017009
543 Ga0207689_10085306
544 Ga0207689_10218444
545 Ga0207661_10085104
546 Ga0207667_10006234
547 Ga0207667_10077055
548 Ga0207667_10435278
549 Ga0207651_10131938
550 Ga0207712_10000107
551 Ga0207668_10058206
552 Ga0207658_10000114
553 Ga0207658_10143805
554 Ga0207658_10143921
555 Ga0207677_10096899
556 Ga0207677_10268582
557 Ga0207703_10052315
558 Ga0207703_10512262
559 Ga0207639_10000258
560 Ga0207639_10029293
561 Ga0207639_10036965
562 Ga0207639_10075076
563 Ga0207639_10208831
564 Ga0207639_10320966
565 Ga0207639_10645124
566 Ga0207678_10001080
567 Ga0207678_10266259
568 Ga0207702_10001632
569 Ga0207702_10254954
570 Ga0207702_10903393
571 Ga0207641_10047489
572 Ga0207641_10128000
573 Ga0207648_10015569
574 Ga0207648_10019820
575 Ga0207648_10353726
576 Ga0207676_10018568
577 Ga0207674_10006181
578 Ga0207674_10794659
579 Ga0207675_100703301
580 Ga0207683_10004575
581 Ga0207683_10017684
582 Ga0207683_10066132
583 Ga0207698_10007442
584 Ga0207698_10018903
585 Ga0207698_10025546
586 Ga0207698_10067410
587 Ga0207698_10158265
588 Ga0207698_10422382
589 Ga0207698_11013999
590 Ga0268266_10081688
591 Ga0268266_10216056
592 Ga0268266_10437314
593 Ga0268265_10031668
594 Ga0268265_10199788
595 Ga0268264_10041126
596 Ga0268264_10086790
597 Ga0268264_10261747
598 Ga0307509_10052848
599 Ga0307507_10050508
600 Ga0373957_0086999
601 Ga0373955_0461956
602 Ga0395900_0001309
603 Ga0395900_0055165
604 Ga0395898_0578772
605 Ga0451807_0586572
606 Ga0451577_0094550
607 Ga0495603_0030195
608 Ga0495580_0018830
609 Ga0495639_0050962
610 Ga0495657_0036094
611 Ga0495658_0017152
612 Ga0495686_0010519
613 Ga0495593_0049364
614 Ga0496104_0000041
615 Ga0496105_0000022
616 Ga0496117_0040092
617 Ga0496117_0137788
618 Ga0496117_0153422
619 Ga0496118_0000101
620 Ga0496118_0000264
621 Ga0496121_0136916
622 Ga0496122_0000212
623 Ga0496123_0003184
624 Ga0501032_0001459
625 Ga0501032_0204210
626 Ga0501033_0006045
627 Ga0501034_0007119
628 Ga0501034_0041200
629 Ga0501034_0149318
630 Ga0501034_0448931
631 Ga0501036_0012332
632 Ga0501036_0049398
633 Ga0501038_0008808
634 Ga0501038_0087248
635 Ga0501039_0006854
636 Ga0501043_0263323
637 Ga0501046_0001553
638 Ga0501046_0137642
639 Ga0501047_0003391
640 Ga0501047_0009312
641 Ga0501047_0046459
642 Ga0501067_0000679
643 Ga0501068_0023740
644 Ga0501068_0336208
645 Ga0501069_0112150
646 Ga0501069_0180197
647 Ga0501070_0024853
648 Ga0501070_0044784
649 Ga0501070_0050074
650 Ga0501070_0108597
651 Ga0501070_0188355
652 Ga0501072_0001569
653 Ga0501073_0002650
654 Ga0501073_0038750
655 Ga0501073_0457676
656 Ga0501074_0055966
657 Ga0501074_0175010
658 Ga0501074_0362171
659 Ga0501079_0233983
660 Ga0501079_0263741
661 Ga0501080_0003901
662 Ga0501080_0034205
663 Ga0501080_0037581
664 Ga0501080_0111766
665 Ga0501080_0129960
666 Ga0501083_0003475
667 Ga0501035_0019699
668 Ga0501035_0390706
669 Ga0501044_0006152
670 Ga0500610_0000097
671 Ga0500643_014585
672 Ga0500651_0016256
673 Ga0500651_0132709
674 Ga0500597_000037
675 Ga0501084_0031037
676 Ga0501084_0319291
677 Ga0500661_002907
678 Ga0501082_0028450
679 Ga0501082_0112153
680 Ga0501082_0233031

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01168

Ala_racemase_N

Alanine racemase, N-terminal domain

4

221

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3sy1-assembly1.cif.gz_A crystal structure of engineered protein. northeast structural genomics consortium target or70 0.9653 1 218
7ub8-assembly2.cif.gz_B the crystal structure of the k38a/k137a/k233a/k234a quadruple mutant of e. coli yggs in complex with plp 0.9647 4 217
7uau-assembly1.cif.gz_A the crystal structure of the k137a mutant of e. coli yggs in complex with plp 0.9645 4 218
7uat-assembly1.cif.gz_A the crystal structure of the k36a mutant of e. coli yggs in complex with plp 0.9624 4 218
7ubp-assembly1.cif.gz_A the crystal structure of the k36a/k137a double mutant of e. coli yggs in complex with plp 0.9619 3 218
ID Description Score Start End Superfamily
1w8gA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9614 3 218 3.20.20.10
af_Q9P6Q1_1_232_3.20.20.10 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9317 1 223 3.20.20.10
1w8gA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9278 3 218 3.20.20.10
af_Q9P6Q1_1_232_3.20.20.10 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9277 1 223 3.20.20.10
af_P9WFQ7_2_257_3.20.20.10 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9209 2 220 3.20.20.10
ID Description Score Start End GO Terms
AF-A0A351SF88-F1-model_v4 YggS family pyridoxal phosphate-dependent enzyme 0.9934 22 163 GO:0030170
AF-A0A5C8KRI1-F1-model_v4 Pyridoxal phosphate homeostasis protein (PLP homeostasis protein) 0.9924 3 223 GO:0030170
AF-T1BA90-F1-model_v4 Pyridoxal phosphate enzyme, YggS family 0.992 37 182 GO:0030170
AF-M5CUJ6-F1-model_v4 deleted 0.9892 53 223
AF-A0A5C4RXC4-F1-model_v4 Pyridoxal phosphate homeostasis protein (PLP homeostasis protein) 0.9888 3 220 GO:0030170

Map