F414277

General Info

Members Datasets Scaffolds Average Seq Length
340 213 680 325

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10035904|Ga0081455_100359045
Length 324
Sequence VSETTYLHAITTALAEAMRADERVLVLGEDVAEGGPWGATAGLADEFGAERVRNTPISEAAITGIAIGAAQSGLRPVVEIMFIDFLTLALDQLVNQAAKAHFMSGGQLEVPLVVRTQGGAGQRGGAQHSQSLEAWLTHVPGLKVVMPSTAADAAGLLTAAIADPNPVVFVENKSLYFRREPASDASAAIGSARVRRQGRDVTVVALSRLVPESLAAADELAEEGIDVEVIDPRSLVPLDLETIVDSVAKTHRLVIAHEAVEHGGFGAELAAQVQAAAFDELDAPIVRVGAPFTPIPFTPPLEDAYLPGRTDVIAAVRRVLGSAS

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
33 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
35 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
52 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
61 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
62 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
95 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
99 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
100 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
101 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
102 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
103 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
104 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
105 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
106 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
107 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
108 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
109 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
110 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
111 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
112 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
113 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
114 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
115 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
116 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
117 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
118 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
119 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
120 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
121 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
122 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
123 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
124 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
125 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
126 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
127 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
128 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
129 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
130 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
131 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
132 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
133 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
134 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
135 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
136 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
137 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
138 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
139 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
140 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
141 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
142 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
143 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
144 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
145 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
146 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
147 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
148 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
149 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
150 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
151 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
152 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
153 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
154 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
155 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
156 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
157 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
158 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
159 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
160 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
161 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
162 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
163 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
164 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
165 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
166 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
167 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
168 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
169 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
170 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
171 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
172 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
173 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
174 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
175 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
176 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
177 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
178 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
179 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
180 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
181 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
191 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
192 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
193 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
194 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
195 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
196 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
197 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
198 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
199 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
200 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
201 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
202 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
204 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
205 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
206 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
207 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
208 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
209 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
210 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
211 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
212 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
213 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.88
Nodule 0
Rhizoplane 7.06
Rhizosphere 86.47
Stem 0
Stem Tuber 0
Unclassified 2.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10035904 3300005937 Bacteria 4420
2 JGI25406J46586_10008662 3300003203 Bacteria 4591
3 rootL2_10243079 3300003322 Bacteria 2256
4 Ga0070683_100004742 3300005329 Bacteria 11249
5 Ga0070683_100063776 3300005329 Bacteria 3428
6 Ga0070683_100355231 3300005329 Bacteria 1395
7 Ga0070670_100300646 3300005331 Bacteria 1404
8 Ga0068868_100016453 3300005338 Bacteria 5492
9 Ga0070668_100035857 3300005347 Bacteria 3785
10 Ga0070671_100000201 3300005355 Bacteria 39892
11 Ga0070671_100248258 3300005355 Bacteria 1511
12 Ga0070674_100074698 3300005356 Bacteria 2406
13 Ga0070667_100000564 3300005367 Bacteria 36686
14 Ga0070667_100007339 3300005367 Bacteria 9164
15 Ga0070713_100348997 3300005436 Bacteria 1372
16 Ga0070713_100349698 3300005436 Bacteria 1371
17 Ga0070711_100048372 3300005439 Bacteria 2907
18 Ga0070711_100093744 3300005439 Bacteria 2169
19 Ga0070705_100008817 3300005440 Bacteria 4998
20 Ga0070700_100023795 3300005441 Bacteria 3587
21 Ga0070678_100032756 3300005456 Bacteria 3600
22 Ga0070662_100004054 3300005457 Bacteria 9200
23 Ga0068867_100012510 3300005459 Bacteria 6005
24 Ga0070684_100066167 3300005535 Bacteria 3172
25 Ga0070684_100160629 3300005535 Bacteria 2038
26 Ga0070686_100006605 3300005544 Bacteria 6456
27 Ga0070696_100028845 3300005546 Bacteria 3788
28 Ga0070665_100044032 3300005548 Bacteria 4483
29 Ga0070665_100062686 3300005548 Bacteria 3727
30 Ga0070702_100007327 3300005615 Bacteria 5277
31 Ga0068859_100000238 3300005617 Bacteria 54568
32 Ga0068859_100432221 3300005617 Bacteria 1413
33 Ga0068864_100026558 3300005618 Bacteria 4883
34 Ga0068864_100271943 3300005618 Bacteria 1579
35 Ga0068866_10010114 3300005718 Bacteria 4034
36 Ga0068861_100029196 3300005719 Bacteria 4032
37 Ga0068870_10006317 3300005840 Bacteria 5218
38 Ga0068870_10121817 3300005840 Bacteria 1504
39 Ga0068863_100002417 3300005841 Bacteria 18551
40 Ga0068863_100003577 3300005841 Bacteria 15332
41 Ga0068858_100000661 3300005842 Bacteria 35996
42 Ga0068858_100034929 3300005842 Bacteria 4663
43 Ga0068860_100008417 3300005843 Bacteria 10274
44 Ga0068860_100011199 3300005843 Bacteria 8838
45 Ga0068860_100025814 3300005843 Bacteria 5667
46 Ga0068860_100135310 3300005843 Bacteria 2366
47 Ga0068862_100017142 3300005844 Bacteria 6027
48 Ga0081455_10000066 3300005937 Bacteria 115221
49 Ga0081455_10217060 3300005937 Unclassified 1420
50 Ga0081538_10003610 3300005981 Bacteria 14536
51 Ga0081539_10000455 3300005985 Bacteria 87222
52 Ga0075364_10052158 3300006051 Bacteria 2672
53 Ga0070712_100015432 3300006175 Bacteria 4922
54 Ga0097621_100002184 3300006237 Bacteria 13386
55 Ga0097621_100173920 3300006237 Bacteria 1858
56 Ga0068871_100003712 3300006358 Bacteria 10499
57 Ga0068871_100006008 3300006358 Bacteria 8549
58 Ga0068871_100292751 3300006358 Bacteria 1427
59 Ga0075428_100144349 3300006844 Bacteria 2587
60 Ga0075430_100141642 3300006846 Bacteria 2002
61 Ga0075431_100119011 3300006847 Bacteria 2725
62 Ga0075429_100132067 3300006880 Bacteria 2184
63 Ga0068865_100072077 3300006881 Bacteria 2453
64 Ga0097620_100000238 3300006931 Bacteria 54568
65 Ga0097620_100432211 3300006931 Bacteria 1413
66 Ga0097620_100737204 3300006931 Bacteria 1075
67 Ga0105240_10022295 3300009093 Bacteria 8399
68 Ga0105245_10000946 3300009098 Bacteria 26415
69 Ga0105247_10000157 3300009101 Bacteria 66480
70 Ga0105241_10003413 3300009174 Bacteria 11826
71 Ga0105241_10083904 3300009174 Bacteria 2500
72 Ga0105242_10005339 3300009176 Bacteria 9930
73 Ga0105242_10005696 3300009176 Bacteria 9609
74 Ga0105242_10029921 3300009176 Bacteria 4347
75 Ga0105248_10000520 3300009177 Bacteria 43711
76 Ga0105248_10005152 3300009177 Bacteria 14414
77 Ga0105249_10017703 3300009553 Bacteria 6328
78 Ga0105249_10339389 3300009553 Unclassified 1519
79 Ga0105032_101097 3300009979 Bacteria 2514
80 Ga0105246_10005745 3300011119 Bacteria 7571
81 Ga0157378_10014122 3300013297 Bacteria 6989
82 Ga0157378_10370281 3300013297 Unclassified 1404
83 Ga0163162_10025520 3300013306 Bacteria 5840
84 Ga0163162_10653284 3300013306 Bacteria 1175
85 Ga0157375_10001616 3300013308 Bacteria 19371
86 Ga0163163_10011134 3300014325 Bacteria 8142
87 Ga0163163_10044624 3300014325 Bacteria 4349
88 Ga0157380_10010668 3300014326 Bacteria 6617
89 Ga0157380_10101952 3300014326 Bacteria 2393
90 Ga0157380_10232063 3300014326 Bacteria 1658
91 Ga0157379_10000485 3300014968 Bacteria 32242
92 Ga0157379_10008677 3300014968 Bacteria 8852
93 Ga0157379_10031016 3300014968 Bacteria 4763
94 Ga0157376_10001451 3300014969 Bacteria 15618
95 Ga0157376_10113253 3300014969 Bacteria 2391
96 Ga0213876_10025274 3300021384 Bacteria 3134
97 Ga0213875_10000245 3300021388 Bacteria 54419
98 Ga0213875_10008247 3300021388 Bacteria 5344
99 Ga0213875_10045982 3300021388 Bacteria 2048
100 Ga0207682_10095016 3300025893 Bacteria 1297
101 Ga0207692_10086204 3300025898 Bacteria 1692
102 Ga0207642_10017759 3300025899 Bacteria 2714
103 Ga0207710_10000708 3300025900 Bacteria 18657
104 Ga0207688_10058865 3300025901 Bacteria 2163
105 Ga0207643_10010451 3300025908 Bacteria 5000
106 Ga0207643_10017781 3300025908 Bacteria 3892
107 Ga0207654_10260255 3300025911 Bacteria 1166
108 Ga0207695_10087647 3300025913 Bacteria 3135
109 Ga0207663_10063944 3300025916 Unclassified 2346
110 Ga0207681_10249341 3300025923 Bacteria 1385
111 Ga0207650_10216888 3300025925 Bacteria 1539
112 Ga0207644_10001631 3300025931 Bacteria 14453
113 Ga0207644_10036144 3300025931 Bacteria 3466
114 Ga0207644_10143481 3300025931 Bacteria 1841
115 Ga0207706_10002945 3300025933 Bacteria 16446
116 Ga0207686_10012878 3300025934 Bacteria 4612
117 Ga0207704_10169385 3300025938 Bacteria 1564
118 Ga0207665_10020646 3300025939 Bacteria 4329
119 Ga0207665_10155637 3300025939 Unclassified 1640
120 Ga0207691_10006638 3300025940 Bacteria 11166
121 Ga0207711_10007115 3300025941 Bacteria 9376
122 Ga0207711_10163803 3300025941 Bacteria 2014
123 Ga0207711_10518311 3300025941 Bacteria 1112
124 Ga0207661_10073692 3300025944 Bacteria 2797
125 Ga0207661_10402888 3300025944 Bacteria 1241
126 Ga0207712_10109435 3300025961 Bacteria 2070
127 Ga0207668_10134402 3300025972 Bacteria 1893
128 Ga0207658_10005980 3300025986 Bacteria 8317
129 Ga0207658_10016648 3300025986 Bacteria 5060
130 Ga0207677_10105582 3300026023 Bacteria 2085
131 Ga0207703_10010952 3300026035 Bacteria 7067
132 Ga0207703_10164677 3300026035 Bacteria 1945
133 Ga0207702_10439999 3300026078 Bacteria 1263
134 Ga0207641_10035473 3300026088 Bacteria 4155
135 Ga0207641_10116064 3300026088 Bacteria 2381
136 Ga0207648_10007166 3300026089 Bacteria 10993
137 Ga0207676_10049221 3300026095 Bacteria 3277
138 Ga0207676_10271402 3300026095 Bacteria 1536
139 Ga0207675_100005306 3300026118 Bacteria 12389
140 Ga0207683_10002333 3300026121 Bacteria 16636
141 Ga0207683_10024183 3300026121 Bacteria 5228
142 Ga0209971_1000533 3300027682 Bacteria 10029
143 Ga0209998_10001296 3300027717 Bacteria 6111
144 Ga0207428_10195036 3300027907 Bacteria 1525
145 Ga0268266_10017039 3300028379 Bacteria 6204
146 Ga0268265_10128648 3300028380 Bacteria 2100
147 Ga0268264_10007389 3300028381 Bacteria 9175
148 Ga0268264_10019538 3300028381 Bacteria 5534
149 Ga0265337_1010891 3300028556 Bacteria 3162
150 Ga0265319_1009409 3300028563 Bacteria 4165
151 Ga0265319_1029510 3300028563 Bacteria 1925
152 Ga0265334_10002066 3300028573 Bacteria 9504
153 Ga0265334_10039467 3300028573 Bacteria 1853
154 Ga0265318_10003481 3300028577 Bacteria 7895
155 Ga0265318_10005511 3300028577 Bacteria 5939
156 Ga0265338_10071230 3300028800 Bacteria 2975
157 Ga0265338_10107238 3300028800 Bacteria 2259
158 Ga0265338_10118577 3300028800 Bacteria 2114
159 Ga0307511_10000052 3300030521 Bacteria 96724
160 Ga0265332_10029224 3300031238 Bacteria 2410
161 Ga0265328_10009226 3300031239 Bacteria 4025
162 Ga0265328_10064203 3300031239 Bacteria 1349
163 Ga0265325_10007619 3300031241 Bacteria 6473
164 Ga0265329_10010047 3300031242 Bacteria 3496
165 Ga0265340_10015083 3300031247 Bacteria 4021
166 Ga0265339_10027260 3300031249 Bacteria 3262
167 Ga0265339_10076651 3300031249 Bacteria 1772
168 Ga0265331_10005090 3300031250 Bacteria 8022
169 Ga0265331_10071831 3300031250 Bacteria 1618
170 Ga0265327_10015333 3300031251 Bacteria 4954
171 Ga0265313_10010062 3300031595 Bacteria 6049
172 Ga0265314_10134489 3300031711 Bacteria 1537
173 Ga0265342_10164728 3300031712 Bacteria 1223
174 Ga0307516_10000012 3300031730 Bacteria 224120
175 Ga0373936_0123101 3300035113 Bacteria 1109
176 Ga0373955_0007313 3300035172 Bacteria 5072
177 Ga0373955_0127885 3300035172 Bacteria 1481
178 Ga0373955_0284898 3300035172 Bacteria 994
179 Ga0373924_0022882 3300035410 Bacteria 2446
180 Ga0373947_0092336 3300035725 Bacteria 1890
181 Ga0373937_0022140 3300036401 Bacteria 5710
182 Ga0373937_0529209 3300036401 Unclassified 1120
183 Ga0373925_0111179 3300037068 Bacteria 2117
184 Ga0436364_0074535 3300037853 Bacteria 5344
185 Ga0436364_0260343 3300037853 Bacteria 2896
186 Ga0436364_1176730 3300037853 Bacteria 110313
187 Ga0436364_1377911 3300037853 Bacteria 3241
188 Ga0436365_0004968 3300039437 Bacteria 4431
189 Ga0436365_1079775 3300039437 Bacteria 3232
190 Ga0436365_1411278 3300039437 Bacteria 2901
191 Ga0436363_0682804 3300039450 Bacteria 4607
192 Ga0436363_1407252 3300039450 Bacteria 1874
193 Ga0466966_0006217 3300044684 Bacteria 7894
194 Ga0466961_0000872 3300044693 Bacteria 18787
195 Ga0466963_0037255 3300044694 Bacteria 3174
196 Ga0466963_0045116 3300044694 Bacteria 2903
197 Ga0466964_0001916 3300044706 Bacteria 7276
198 Ga0466964_0057841 3300044706 Bacteria 1606
199 Ga0466971_0000169 3300044719 Bacteria 24473
200 Ga0466971_0012733 3300044719 Bacteria 3689
201 Ga0466970_0000667 3300044765 Bacteria 16818
202 Ga0466960_0009974 3300044901 Unclassified 3932
203 Ga0466959_0000314 3300045049 Bacteria 28807
204 Ga0466959_0096431 3300045049 Bacteria 2120
205 Ga0451576_0126988 3300045051 Bacteria 2657
206 Ga0466958_0001703 3300045836 Bacteria 10606
207 Ga0466967_0006283 3300045976 Bacteria 8380
208 Ga0495603_0021287 3300046455 Bacteria 3927
209 Ga0495641_0028064 3300046461 Bacteria 2728
210 Ga0495651_0024626 3300046462 Bacteria 4681
211 Ga0495651_0142260 3300046462 Bacteria 1738
212 Ga0495653_0008215 3300046463 Bacteria 8551
213 Ga0495653_0045434 3300046463 Bacteria 3405
214 Ga0495653_0133048 3300046463 Bacteria 1758
215 Ga0495582_0061463 3300046473 Bacteria 2074
216 Ga0495662_0104001 3300046476 Bacteria 1389
217 Ga0495664_0038022 3300046477 Bacteria 2841
218 Ga0495664_0045156 3300046477 Bacteria 2613
219 Ga0495608_0008864 3300046511 Bacteria 7033
220 Ga0495608_0028746 3300046511 Bacteria 3778
221 Ga0495618_0008085 3300046514 Bacteria 6370
222 Ga0495618_0067554 3300046514 Bacteria 2273
223 Ga0495628_0019481 3300046516 Bacteria 5609
224 Ga0495628_0037664 3300046516 Bacteria 3877
225 Ga0495630_0015916 3300046517 Bacteria 5497
226 Ga0495630_0055182 3300046517 Bacteria 2977
227 Ga0495630_0059598 3300046517 Bacteria 2864
228 Ga0495652_0031848 3300046529 Bacteria 4616
229 Ga0495652_0208251 3300046529 Bacteria 1478
230 Ga0495665_0129418 3300046531 Bacteria 1321
231 Ga0495640_0020142 3300046533 Bacteria 4914
232 Ga0495667_0006751 3300046559 Bacteria 7789
233 Ga0495667_0013689 3300046559 Bacteria 5482
234 Ga0495667_0083222 3300046559 Bacteria 2078
235 Ga0495656_0171267 3300046615 Bacteria 1062
236 Ga0495634_0097484 3300046642 Bacteria 1903
237 Ga0495657_0024321 3300046675 Bacteria 4316
238 Ga0495646_0047335 3300046680 Bacteria 2618
239 Ga0495647_0113477 3300046681 Bacteria 1133
240 Ga0495613_0086042 3300046689 Bacteria 2280
241 Ga0495613_0213436 3300046689 Bacteria 1357
242 Ga0495600_0002727 3300046809 Bacteria 10224
243 Ga0495600_0052779 3300046809 Bacteria 2655
244 Ga0495600_0077903 3300046809 Bacteria 2165
245 Ga0495604_0102556 3300047317 Bacteria 2100
246 Ga0495604_0151469 3300047317 Bacteria 1647
247 Ga0495674_0001040 3300047319 Bacteria 26667
248 Ga0495674_0022774 3300047319 Bacteria 5774
249 Ga0495680_0004785 3300047322 Bacteria 12850
250 Ga0495680_0010863 3300047322 Bacteria 8096
251 Ga0495680_0061559 3300047322 Bacteria 2887
252 Ga0495675_0120576 3300047444 Bacteria 1633
253 Ga0495684_0042960 3300047471 Bacteria 3460
254 Ga0495684_0056761 3300047471 Bacteria 2984
255 Ga0495593_0112879 3300047673 Bacteria 1387
256 Ga0495602_0010272 3300048088 Bacteria 9719
257 Ga0496101_0016742 3300048904 Bacteria 4962
258 Ga0496101_0040938 3300048904 Bacteria 3301
259 Ga0496101_0188420 3300048904 Bacteria 1591
260 Ga0496101_0355935 3300048904 Bacteria 1151
261 Ga0496102_0005547 3300048905 Bacteria 10716
262 Ga0496103_0072785 3300048906 Bacteria 2153
263 Ga0496104_0007466 3300048907 Bacteria 9663
264 Ga0496104_0009505 3300048907 Bacteria 8654
265 Ga0496105_0008499 3300048908 Bacteria 7975
266 Ga0496105_0018890 3300048908 Bacteria 5551
267 Ga0496105_0036794 3300048908 Bacteria 4033
268 Ga0496106_0035862 3300048909 Bacteria 3709
269 Ga0496108_0002342 3300048911 Bacteria 15174
270 Ga0496109_0012236 3300048912 Bacteria 7404
271 Ga0496109_0031900 3300048912 Bacteria 4733
272 Ga0496110_0015543 3300048913 Bacteria 6338
273 Ga0496110_0080177 3300048913 Bacteria 2908
274 Ga0496111_0005972 3300048914 Bacteria 7860
275 Ga0496111_0284577 3300048914 Bacteria 1226
276 Ga0496112_0023231 3300048915 Bacteria 5920
277 Ga0496114_0002051 3300048917 Bacteria 15351
278 Ga0496114_0006355 3300048917 Bacteria 9296
279 Ga0496115_0013689 3300048918 Bacteria 6142
280 Ga0496115_0205587 3300048918 Bacteria 1626
281 Ga0496121_0001266 3300048924 Bacteria 43597
282 Ga0496125_0005301 3300048928 Bacteria 14421
283 Ga0496126_0015404 3300048929 Bacteria 7692
284 Ga0501036_0017912 3300049572 Bacteria 5930
285 Ga0501036_0028652 3300049572 Bacteria 4706
286 Ga0501036_0270789 3300049572 Bacteria 1422
287 Ga0501037_0170890 3300049573 Bacteria 1545
288 Ga0501038_0009334 3300049574 Bacteria 8999
289 Ga0501038_0060897 3300049574 Bacteria 3229
290 Ga0501038_0345854 3300049574 Unclassified 1159
291 Ga0501039_0009244 3300049575 Bacteria 7509
292 Ga0501040_0003452 3300049576 Bacteria 10200
293 Ga0501040_0004809 3300049576 Bacteria 8752
294 Ga0501040_0143051 3300049576 Bacteria 1685
295 Ga0501041_0003768 3300049577 Bacteria 8720
296 Ga0501042_0000564 3300049578 Bacteria 19568
297 Ga0501046_0051755 3300049580 Bacteria 3239
298 Ga0501046_0054098 3300049580 Bacteria 3159
299 Ga0501048_0008164 3300049582 Bacteria 7918
300 Ga0501048_0036134 3300049582 Bacteria 3552
301 Ga0501048_0054961 3300049582 Bacteria 2828
302 Ga0501067_0038723 3300049583 Bacteria 2648
303 Ga0501068_0044559 3300049584 Bacteria 2671
304 Ga0501071_0001955 3300049587 Bacteria 12289
305 Ga0501071_0011553 3300049587 Bacteria 5958
306 Ga0501072_0001294 3300049588 Bacteria 18717
307 Ga0501072_0244143 3300049588 Bacteria 1430
308 Ga0501074_0014847 3300049590 Bacteria 5663
309 Ga0501075_0001400 3300049591 Bacteria 15703
310 Ga0501075_0012216 3300049591 Bacteria 6095
311 Ga0501076_0000466 3300049592 Bacteria 25548
312 Ga0501076_0035950 3300049592 Bacteria 3878
313 Ga0501076_0135297 3300049592 Bacteria 2001
314 Ga0501076_0147247 3300049592 Unclassified 1915
315 Ga0501077_0003837 3300049593 Bacteria 9055
316 Ga0501079_0002698 3300049741 Bacteria 12923
317 Ga0501079_0104060 3300049741 Bacteria 2202
318 Ga0501080_0007647 3300049742 Bacteria 9773
319 Ga0501081_0001438 3300049743 Bacteria 14554
320 Ga0501081_0005727 3300049743 Bacteria 8042
321 Ga0501083_0081242 3300049744 Bacteria 2149
322 Ga0501035_0015172 3300049822 Bacteria 7112
323 Ga0501045_0034619 3300049824 Bacteria 3666
324 Ga0501045_0064558 3300049824 Bacteria 2687
325 nmdc:mga0qj67_75638_c1 3300050509 Bacteria 2692
326 nmdc:mga06r32_134213_c1 3300050510 Bacteria 2450
327 Ga0495601_0144781 3300053077 Bacteria 1551
328 Ga0495619_0003781 3300053085 Bacteria 9737
329 Ga0495619_0007349 3300053085 Bacteria 6979
330 Ga0495619_0026706 3300053085 Bacteria 3716
331 Ga0495619_0085511 3300053085 Bacteria 2130
332 Ga0500616_0076477 3300053153 Bacteria 1692
333 Ga0500637_0007415 3300053178 Bacteria 5481
334 Ga0501084_0003768 3300054114 Bacteria 12328
335 Ga0501084_0008092 3300054114 Bacteria 8660
336 Ga0501082_0001175 3300060353 Bacteria 22993
337 Ga0501082_0070497 3300060353 Bacteria 3009
338 Ga0466962_0009538 3300061719 Bacteria 4655
339 Ga0530510_0000736 3300061734 Bacteria 21277
340 Ga0530510_0147397 3300061734 Bacteria 1736
341 Ga0081455_10035904
342 JGI25406J46586_10008662
343 rootL2_10243079
344 Ga0070683_100004742
345 Ga0070683_100063776
346 Ga0070683_100355231
347 Ga0070670_100300646
348 Ga0068868_100016453
349 Ga0070668_100035857
350 Ga0070671_100000201
351 Ga0070671_100248258
352 Ga0070674_100074698
353 Ga0070667_100000564
354 Ga0070667_100007339
355 Ga0070713_100348997
356 Ga0070713_100349698
357 Ga0070711_100048372
358 Ga0070711_100093744
359 Ga0070705_100008817
360 Ga0070700_100023795
361 Ga0070678_100032756
362 Ga0070662_100004054
363 Ga0068867_100012510
364 Ga0070684_100066167
365 Ga0070684_100160629
366 Ga0070686_100006605
367 Ga0070696_100028845
368 Ga0070665_100044032
369 Ga0070665_100062686
370 Ga0070702_100007327
371 Ga0068859_100000238
372 Ga0068859_100432221
373 Ga0068864_100026558
374 Ga0068864_100271943
375 Ga0068866_10010114
376 Ga0068861_100029196
377 Ga0068870_10006317
378 Ga0068870_10121817
379 Ga0068863_100002417
380 Ga0068863_100003577
381 Ga0068858_100000661
382 Ga0068858_100034929
383 Ga0068860_100008417
384 Ga0068860_100011199
385 Ga0068860_100025814
386 Ga0068860_100135310
387 Ga0068862_100017142
388 Ga0081455_10000066
389 Ga0081455_10217060
390 Ga0081538_10003610
391 Ga0081539_10000455
392 Ga0075364_10052158
393 Ga0070712_100015432
394 Ga0097621_100002184
395 Ga0097621_100173920
396 Ga0068871_100003712
397 Ga0068871_100006008
398 Ga0068871_100292751
399 Ga0075428_100144349
400 Ga0075430_100141642
401 Ga0075431_100119011
402 Ga0075429_100132067
403 Ga0068865_100072077
404 Ga0097620_100000238
405 Ga0097620_100432211
406 Ga0097620_100737204
407 Ga0105240_10022295
408 Ga0105245_10000946
409 Ga0105247_10000157
410 Ga0105241_10003413
411 Ga0105241_10083904
412 Ga0105242_10005339
413 Ga0105242_10005696
414 Ga0105242_10029921
415 Ga0105248_10000520
416 Ga0105248_10005152
417 Ga0105249_10017703
418 Ga0105249_10339389
419 Ga0105032_101097
420 Ga0105246_10005745
421 Ga0157378_10014122
422 Ga0157378_10370281
423 Ga0163162_10025520
424 Ga0163162_10653284
425 Ga0157375_10001616
426 Ga0163163_10011134
427 Ga0163163_10044624
428 Ga0157380_10010668
429 Ga0157380_10101952
430 Ga0157380_10232063
431 Ga0157379_10000485
432 Ga0157379_10008677
433 Ga0157379_10031016
434 Ga0157376_10001451
435 Ga0157376_10113253
436 Ga0213876_10025274
437 Ga0213875_10000245
438 Ga0213875_10008247
439 Ga0213875_10045982
440 Ga0207682_10095016
441 Ga0207692_10086204
442 Ga0207642_10017759
443 Ga0207710_10000708
444 Ga0207688_10058865
445 Ga0207643_10010451
446 Ga0207643_10017781
447 Ga0207654_10260255
448 Ga0207695_10087647
449 Ga0207663_10063944
450 Ga0207681_10249341
451 Ga0207650_10216888
452 Ga0207644_10001631
453 Ga0207644_10036144
454 Ga0207644_10143481
455 Ga0207706_10002945
456 Ga0207686_10012878
457 Ga0207704_10169385
458 Ga0207665_10020646
459 Ga0207665_10155637
460 Ga0207691_10006638
461 Ga0207711_10007115
462 Ga0207711_10163803
463 Ga0207711_10518311
464 Ga0207661_10073692
465 Ga0207661_10402888
466 Ga0207712_10109435
467 Ga0207668_10134402
468 Ga0207658_10005980
469 Ga0207658_10016648
470 Ga0207677_10105582
471 Ga0207703_10010952
472 Ga0207703_10164677
473 Ga0207702_10439999
474 Ga0207641_10035473
475 Ga0207641_10116064
476 Ga0207648_10007166
477 Ga0207676_10049221
478 Ga0207676_10271402
479 Ga0207675_100005306
480 Ga0207683_10002333
481 Ga0207683_10024183
482 Ga0209971_1000533
483 Ga0209998_10001296
484 Ga0207428_10195036
485 Ga0268266_10017039
486 Ga0268265_10128648
487 Ga0268264_10007389
488 Ga0268264_10019538
489 Ga0265337_1010891
490 Ga0265319_1009409
491 Ga0265319_1029510
492 Ga0265334_10002066
493 Ga0265334_10039467
494 Ga0265318_10003481
495 Ga0265318_10005511
496 Ga0265338_10071230
497 Ga0265338_10107238
498 Ga0265338_10118577
499 Ga0307511_10000052
500 Ga0265332_10029224
501 Ga0265328_10009226
502 Ga0265328_10064203
503 Ga0265325_10007619
504 Ga0265329_10010047
505 Ga0265340_10015083
506 Ga0265339_10027260
507 Ga0265339_10076651
508 Ga0265331_10005090
509 Ga0265331_10071831
510 Ga0265327_10015333
511 Ga0265313_10010062
512 Ga0265314_10134489
513 Ga0265342_10164728
514 Ga0307516_10000012
515 Ga0373936_0123101
516 Ga0373955_0007313
517 Ga0373955_0127885
518 Ga0373955_0284898
519 Ga0373924_0022882
520 Ga0373947_0092336
521 Ga0373937_0022140
522 Ga0373937_0529209
523 Ga0373925_0111179
524 Ga0436364_0074535
525 Ga0436364_0260343
526 Ga0436364_1176730
527 Ga0436364_1377911
528 Ga0436365_0004968
529 Ga0436365_1079775
530 Ga0436365_1411278
531 Ga0436363_0682804
532 Ga0436363_1407252
533 Ga0466966_0006217
534 Ga0466961_0000872
535 Ga0466963_0037255
536 Ga0466963_0045116
537 Ga0466964_0001916
538 Ga0466964_0057841
539 Ga0466971_0000169
540 Ga0466971_0012733
541 Ga0466970_0000667
542 Ga0466960_0009974
543 Ga0466959_0000314
544 Ga0466959_0096431
545 Ga0451576_0126988
546 Ga0466958_0001703
547 Ga0466967_0006283
548 Ga0495603_0021287
549 Ga0495641_0028064
550 Ga0495651_0024626
551 Ga0495651_0142260
552 Ga0495653_0008215
553 Ga0495653_0045434
554 Ga0495653_0133048
555 Ga0495582_0061463
556 Ga0495662_0104001
557 Ga0495664_0038022
558 Ga0495664_0045156
559 Ga0495608_0008864
560 Ga0495608_0028746
561 Ga0495618_0008085
562 Ga0495618_0067554
563 Ga0495628_0019481
564 Ga0495628_0037664
565 Ga0495630_0015916
566 Ga0495630_0055182
567 Ga0495630_0059598
568 Ga0495652_0031848
569 Ga0495652_0208251
570 Ga0495665_0129418
571 Ga0495640_0020142
572 Ga0495667_0006751
573 Ga0495667_0013689
574 Ga0495667_0083222
575 Ga0495656_0171267
576 Ga0495634_0097484
577 Ga0495657_0024321
578 Ga0495646_0047335
579 Ga0495647_0113477
580 Ga0495613_0086042
581 Ga0495613_0213436
582 Ga0495600_0002727
583 Ga0495600_0052779
584 Ga0495600_0077903
585 Ga0495604_0102556
586 Ga0495604_0151469
587 Ga0495674_0001040
588 Ga0495674_0022774
589 Ga0495680_0004785
590 Ga0495680_0010863
591 Ga0495680_0061559
592 Ga0495675_0120576
593 Ga0495684_0042960
594 Ga0495684_0056761
595 Ga0495593_0112879
596 Ga0495602_0010272
597 Ga0496101_0016742
598 Ga0496101_0040938
599 Ga0496101_0188420
600 Ga0496101_0355935
601 Ga0496102_0005547
602 Ga0496103_0072785
603 Ga0496104_0007466
604 Ga0496104_0009505
605 Ga0496105_0008499
606 Ga0496105_0018890
607 Ga0496105_0036794
608 Ga0496106_0035862
609 Ga0496108_0002342
610 Ga0496109_0012236
611 Ga0496109_0031900
612 Ga0496110_0015543
613 Ga0496110_0080177
614 Ga0496111_0005972
615 Ga0496111_0284577
616 Ga0496112_0023231
617 Ga0496114_0002051
618 Ga0496114_0006355
619 Ga0496115_0013689
620 Ga0496115_0205587
621 Ga0496121_0001266
622 Ga0496125_0005301
623 Ga0496126_0015404
624 Ga0501036_0017912
625 Ga0501036_0028652
626 Ga0501036_0270789
627 Ga0501037_0170890
628 Ga0501038_0009334
629 Ga0501038_0060897
630 Ga0501038_0345854
631 Ga0501039_0009244
632 Ga0501040_0003452
633 Ga0501040_0004809
634 Ga0501040_0143051
635 Ga0501041_0003768
636 Ga0501042_0000564
637 Ga0501046_0051755
638 Ga0501046_0054098
639 Ga0501048_0008164
640 Ga0501048_0036134
641 Ga0501048_0054961
642 Ga0501067_0038723
643 Ga0501068_0044559
644 Ga0501071_0001955
645 Ga0501071_0011553
646 Ga0501072_0001294
647 Ga0501072_0244143
648 Ga0501074_0014847
649 Ga0501075_0001400
650 Ga0501075_0012216
651 Ga0501076_0000466
652 Ga0501076_0035950
653 Ga0501076_0135297
654 Ga0501076_0147247
655 Ga0501077_0003837
656 Ga0501079_0002698
657 Ga0501079_0104060
658 Ga0501080_0007647
659 Ga0501081_0001438
660 Ga0501081_0005727
661 Ga0501083_0081242
662 Ga0501035_0015172
663 Ga0501045_0034619
664 Ga0501045_0064558
665 nmdc:mga0qj67_75638_c1
666 nmdc:mga06r32_134213_c1
667 Ga0495601_0144781
668 Ga0495619_0003781
669 Ga0495619_0007349
670 Ga0495619_0026706
671 Ga0495619_0085511
672 Ga0500616_0076477
673 Ga0500637_0007415
674 Ga0501084_0003768
675 Ga0501084_0008092
676 Ga0501082_0001175
677 Ga0501082_0070497
678 Ga0466962_0009538
679 Ga0530510_0000736
680 Ga0530510_0147397

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02779

Transket_pyr

Transketolase, pyrimidine binding domain

2

178

0.98

PF02780

Transketolase_C

Transketolase, C-terminal domain

190

312

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6cer-assembly1.cif.gz_D human pyruvate dehydrogenase complex e1 component v138m mutation 0.9374 1 321
3duf-assembly2.cif.gz_H snapshots of catalysis in the e1 subunit of the pyruvate dehydrogenase multi-enzyme complex 0.9349 1 321
1ik6-assembly1.cif.gz_A 3d structure of the e1beta subunit of pyruvate dehydrogenase from the archeon pyrobaculum aerophilum 0.9349 1 321
2bew-assembly1.cif.gz_B reactivity modulation of human branched-chain alpha-ketoacid dehydrogenase by an internal molecular switch 0.9333 1 321
2beu-assembly1.cif.gz_B reactivity modulation of human branched-chain alpha-ketoacid dehydrogenase by an internal molecular switch 0.9323 1 319
ID Description Score Start End Superfamily
1ik6A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.964 186 290 3.40.50.920
1w85B02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9574 190 321 3.40.50.920
af_Q10G39_79_267_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9546 3 184 3.40.50.970
af_B4FUC1_232_362_3.40.50.920 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9536 191 319 3.40.50.920
af_Q8IL09_280_409_3.40.50.920 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9448 190 315 3.40.50.920
ID Description Score Start End GO Terms
AF-D3JWS9-F1-model_v4 Pyruvate dehydrogenase (EC 1.2.4.1) 1.003 188 256 GO:0004739
AF-A0A227J0R1-F1-model_v4 Alpha-ketoacid dehydrogenase subunit beta 0.98 199 290 GO:0003824
AF-A0A7X9CIE5-F1-model_v4 Alpha-ketoacid dehydrogenase subunit beta 0.9781 3 118
AF-A0A453MUU2-F1-model_v4 Transketolase C-terminal domain-containing protein 0.9739 188 281 GO:0003824
GO:0007584
GO:0009083
AF-A0A1Y1JTQ4-F1-model_v4 Pyruvate dehydrogenase E1 component subunit beta (EC 1.2.4.1) 0.9672 1 115 GO:0004739
GO:0006086

Map