F413863

General Info

Members Datasets Scaffolds Average Seq Length
339 202 678 270

Family's Representative Sequence

Representative Sequence 3300006237|Ga0097621_100094158|Ga0097621_1000941582
Length 304
Sequence MKVGSAGWSHMKHDINRICLFQLRMITSMKELRYVFLILSIVLTGVCHSQTVPSKKKHLLVIGEEKGYRHESVSHAMSTIEQLGKQTGLWDTTIRTDTEALTKKKLEYNAKNLTNFDAVFLFTGGDLEMDTQQKADLLSFVHEDGKGFVGVHSAAITWAKWPEFVDMIGGTFDEHPWGTFDAPIVVEDPSFPGMGKWPKAFVLRDEIYQMKSFSRDKVRVMMSLDASKLDLANPKVHRTDHDFAVTWAKMYGNGRVYYSTLGHPEENWDDPRLQQMYVEAIKWAMGLVNADVTPLPAHSSTAAH

Samples

Sample ID Description Type Environment
1 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
95 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
96 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
97 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
98 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
99 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
150 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
151 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
152 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
153 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
154 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
155 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
156 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
157 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
158 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
159 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
160 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
161 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
162 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
163 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
164 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
165 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
166 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
167 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
168 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
169 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
170 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
171 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
172 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
173 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
174 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
175 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
176 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
177 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
178 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
179 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
180 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
181 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
182 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
183 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
184 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
185 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
186 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
187 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
188 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
189 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
190 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
191 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
192 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
193 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
194 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
195 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
196 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
197 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
198 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
199 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
200 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
201 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
202 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.42
Rhizosphere 94.99
Stem 0
Stem Tuber 0
Unclassified 16.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0097621_100094158 3300006237 Bacteria 2511
2 MRS1b_contig_6848229 2162886011 Eukaryota 1170
3 Ga0065712_10117500 3300005290 Unclassified 1692
4 Ga0065707_10253969 3300005295 Unclassified 1116
5 Ga0070676_10087706 3300005328 Bacteria 1900
6 Ga0070683_100004437 3300005329 Bacteria 11568
7 Ga0070690_100033904 3300005330 Bacteria 3197
8 Ga0070670_100011167 3300005331 Bacteria 7675
9 Ga0068869_100002789 3300005334 Bacteria 10585
10 Ga0070666_10023142 3300005335 Bacteria 4041
11 Ga0070680_100018326 3300005336 Bacteria 5530
12 Ga0070682_100017042 3300005337 Bacteria 4231
13 Ga0068868_100003502 3300005338 Bacteria 10931
14 Ga0068868_100015076 3300005338 Bacteria 5709
15 Ga0070660_100007818 3300005339 Bacteria 7456
16 Ga0070660_100007917 3300005339 Bacteria 7414
17 Ga0070660_100149067 3300005339 Bacteria 1880
18 Ga0070661_100027572 3300005344 Bacteria 4091
19 Ga0070661_100033601 3300005344 Unclassified 3716
20 Ga0070661_100036644 3300005344 Bacteria 3565
21 Ga0070669_100075382 3300005353 Bacteria 2502
22 Ga0070675_100230277 3300005354 Unclassified 1616
23 Ga0070671_100519301 3300005355 Bacteria 1025
24 Ga0070673_100471340 3300005364 Bacteria 1132
25 Ga0070659_100020414 3300005366 Bacteria 5031
26 Ga0070667_100072694 3300005367 Unclassified 2931
27 Ga0070709_10017167 3300005434 Bacteria 4145
28 Ga0070709_10266708 3300005434 Unclassified 1239
29 Ga0070709_10299547 3300005434 Bacteria 1174
30 Ga0070714_100208238 3300005435 Bacteria 1792
31 Ga0070713_100000164 3300005436 Bacteria 44269
32 Ga0070713_100065589 3300005436 Bacteria 3051
33 Ga0070713_100198024 3300005436 Bacteria 1813
34 Ga0070711_100000108 3300005439 Bacteria 43211
35 Ga0070711_100384007 3300005439 Bacteria 1136
36 Ga0070705_100097472 3300005440 Unclassified 1848
37 Ga0070708_100032908 3300005445 Unclassified 4500
38 Ga0070663_100381827 3300005455 Bacteria 1148
39 Ga0070678_100244939 3300005456 Bacteria 1501
40 Ga0070662_100000987 3300005457 Bacteria 17397
41 Ga0070662_100199434 3300005457 Bacteria 1587
42 Ga0070681_10025051 3300005458 Bacteria 6003
43 Ga0070681_10031785 3300005458 Bacteria 5298
44 Ga0070681_10034090 3300005458 Bacteria 5112
45 Ga0070681_10359796 3300005458 Bacteria 1365
46 Ga0068867_100009202 3300005459 Bacteria 6973
47 Ga0068867_100021799 3300005459 Bacteria 4574
48 Ga0070685_10050713 3300005466 Bacteria 2398
49 Ga0070706_100045645 3300005467 Unclassified 4047
50 Ga0070706_100088480 3300005467 Unclassified 2871
51 Ga0070707_100017707 3300005468 Bacteria 6700
52 Ga0070698_100014710 3300005471 Bacteria 8264
53 Ga0070698_100329077 3300005471 Unclassified 1459
54 Ga0070699_100041456 3300005518 Unclassified 3985
55 Ga0070679_100021418 3300005530 Bacteria 6310
56 Ga0070679_100112063 3300005530 Bacteria 2714
57 Ga0070679_100122184 3300005530 Bacteria 2588
58 Ga0070684_100172562 3300005535 Unclassified 1964
59 Ga0070697_100003422 3300005536 Bacteria 12205
60 Ga0070697_100399282 3300005536 Bacteria 1193
61 Ga0068853_100232960 3300005539 Bacteria 1685
62 Ga0070672_100364548 3300005543 Bacteria 1234
63 Ga0070686_100113709 3300005544 Bacteria 1848
64 Ga0070695_100029801 3300005545 Bacteria 3393
65 Ga0070665_100071764 3300005548 Unclassified 3469
66 Ga0070665_100497769 3300005548 Unclassified 1230
67 Ga0068855_100002751 3300005563 Bacteria 21648
68 Ga0068855_100098453 3300005563 Unclassified 3369
69 Ga0070664_100004725 3300005564 Bacteria 10922
70 Ga0068857_100001025 3300005577 Bacteria 21569
71 Ga0068854_100148719 3300005578 Bacteria 1804
72 Ga0068856_100012971 3300005614 Bacteria 8068
73 Ga0068856_100026326 3300005614 Bacteria 5672
74 Ga0068856_100272449 3300005614 Bacteria 1709
75 Ga0068859_100023639 3300005617 Bacteria 6169
76 Ga0068859_100038340 3300005617 Bacteria 4808
77 Ga0068864_100004146 3300005618 Bacteria 11897
78 Ga0068864_100077559 3300005618 Bacteria 2906
79 Ga0068864_100110059 3300005618 Unclassified 2453
80 Ga0068866_10005420 3300005718 Bacteria 5266
81 Ga0068861_100179350 3300005719 Bacteria 1762
82 Ga0068851_10019820 3300005834 Bacteria 3250
83 Ga0068851_10087062 3300005834 Unclassified 1640
84 Ga0068851_10099571 3300005834 Bacteria 1541
85 Ga0068863_100008235 3300005841 Bacteria 10185
86 Ga0068863_100042742 3300005841 Unclassified 4306
87 Ga0068863_100061040 3300005841 Bacteria 3565
88 Ga0068863_100292201 3300005841 Bacteria 1580
89 Ga0068863_100610783 3300005841 Bacteria 1080
90 Ga0068858_100019898 3300005842 Bacteria 6274
91 Ga0068858_100062834 3300005842 Unclassified 3434
92 Ga0068860_100091838 3300005843 Bacteria 2892
93 Ga0068860_100393884 3300005843 Unclassified 1369
94 Ga0068862_100070931 3300005844 Bacteria 3008
95 Ga0070717_10011599 3300006028 Bacteria 6700
96 Ga0070717_10021911 3300006028 Bacteria 5041
97 Ga0070717_10177356 3300006028 Bacteria 1856
98 Ga0070716_100000477 3300006173 Bacteria 16574
99 Ga0070712_100000226 3300006175 Bacteria 31684
100 Ga0070712_100018682 3300006175 Bacteria 4508
101 Ga0097621_100024686 3300006237 Unclassified 4697
102 Ga0068871_100031290 3300006358 Bacteria 4196
103 Ga0068871_100034274 3300006358 Unclassified 4028
104 Ga0068871_100114482 3300006358 Bacteria 2272
105 Ga0075433_10012174 3300006852 Bacteria 6937
106 Ga0075433_10216468 3300006852 Bacteria 1702
107 Ga0075433_10325326 3300006852 Bacteria 1360
108 Ga0075434_100011194 3300006871 Bacteria 8443
109 Ga0075434_100205585 3300006871 Unclassified 1989
110 Ga0068865_100027448 3300006881 Bacteria 3762
111 Ga0075436_100007326 3300006914 Bacteria 7542
112 Ga0075436_100127245 3300006914 Unclassified 1785
113 Ga0075436_100329216 3300006914 Bacteria 1098
114 Ga0097620_100023639 3300006931 Bacteria 6169
115 Ga0097620_100038338 3300006931 Bacteria 4808
116 Ga0075435_100109023 3300007076 Unclassified 2301
117 Ga0099794_10012208 3300007265 Bacteria 3698
118 Ga0099794_10034176 3300007265 Bacteria 2394
119 Ga0105240_10014763 3300009093 Bacteria 10650
120 Ga0105240_10033170 3300009093 Bacteria 6674
121 Ga0105240_10214917 3300009093 Unclassified 2244
122 Ga0105240_10509724 3300009093 Bacteria 1337
123 Ga0105240_10888977 3300009093 Bacteria 959
124 Ga0105245_10039601 3300009098 Bacteria 4195
125 Ga0105247_10003744 3300009101 Bacteria 9863
126 Ga0105241_10012524 3300009174 Bacteria 6219
127 Ga0105241_10019813 3300009174 Bacteria 4965
128 Ga0105241_10076621 3300009174 Unclassified 2608
129 Ga0105241_10301666 3300009174 Unclassified 1375
130 Ga0105242_10002289 3300009176 Bacteria 15129
131 Ga0105242_10093125 3300009176 Bacteria 2540
132 Ga0105242_10098240 3300009176 Bacteria 2476
133 Ga0105242_10450889 3300009176 Bacteria 1213
134 Ga0105248_10017111 3300009177 Bacteria 7987
135 Ga0105248_10028156 3300009177 Bacteria 6258
136 Ga0105248_10118461 3300009177 Bacteria 2987
137 Ga0105237_10053116 3300009545 Bacteria 4065
138 Ga0105237_10081388 3300009545 Bacteria 3229
139 Ga0105237_10092168 3300009545 Bacteria 3020
140 Ga0105237_10144960 3300009545 Unclassified 2369
141 Ga0105237_10276923 3300009545 Bacteria 1680
142 Ga0105237_10455154 3300009545 Unclassified 1286
143 Ga0105238_10135615 3300009551 Bacteria 2439
144 Ga0105238_10182262 3300009551 Bacteria 2077
145 Ga0105249_10000639 3300009553 Bacteria 31964
146 Ga0105249_10470746 3300009553 Unclassified 1298
147 Ga0105239_10017057 3300010375 Bacteria 8027
148 Ga0105239_10034315 3300010375 Bacteria 5570
149 Ga0105239_10259932 3300010375 Bacteria 1951
150 Ga0105246_10005133 3300011119 Bacteria 7961
151 Ga0157373_10011005 3300013100 Bacteria 6662
152 Ga0157373_10031423 3300013100 Bacteria 3823
153 Ga0157373_10033364 3300013100 Bacteria 3704
154 Ga0157373_10057260 3300013100 Bacteria 2765
155 Ga0157371_10008507 3300013102 Bacteria 8169
156 Ga0157371_10020772 3300013102 Bacteria 4830
157 Ga0157371_10031185 3300013102 Unclassified 3841
158 Ga0157370_10077579 3300013104 Bacteria 3129
159 Ga0157370_10186101 3300013104 Unclassified 1928
160 Ga0157369_10084718 3300013105 Bacteria 3388
161 Ga0157369_10170005 3300013105 Bacteria 2297
162 Ga0157374_10000817 3300013296 Bacteria 27316
163 Ga0157374_10002265 3300013296 Bacteria 16205
164 Ga0157374_10004724 3300013296 Bacteria 11423
165 Ga0157374_10068746 3300013296 Bacteria 3333
166 Ga0157374_10322577 3300013296 Bacteria 1531
167 Ga0157378_10003467 3300013297 Bacteria 13995
168 Ga0157378_10004421 3300013297 Bacteria 12372
169 Ga0157378_10015612 3300013297 Bacteria 6651
170 Ga0157378_10447784 3300013297 Bacteria 1281
171 Ga0157378_10584627 3300013297 Bacteria 1126
172 Ga0163162_10003787 3300013306 Bacteria 14501
173 Ga0163162_10157048 3300013306 Bacteria 2395
174 Ga0157372_10004458 3300013307 Bacteria 14934
175 Ga0157372_10166654 3300013307 Bacteria 2548
176 Ga0157375_10044440 3300013308 Unclassified 4317
177 Ga0157375_10267036 3300013308 Bacteria 1873
178 Ga0157375_10292279 3300013308 Bacteria 1793
179 Ga0157375_10305055 3300013308 Unclassified 1756
180 Ga0163163_10002544 3300014325 Bacteria 15446
181 Ga0163163_10067277 3300014325 Bacteria 3562
182 Ga0163163_10610330 3300014325 Unclassified 1154
183 Ga0157379_10071746 3300014968 Unclassified 3098
184 Ga0157376_10007473 3300014969 Bacteria 7805
185 Ga0157376_10007539 3300014969 Bacteria 7778
186 Ga0182007_10049843 3300015262 Bacteria 1383
187 Ga0182005_1006213 3300015265 Bacteria 3668
188 Ga0224569_100132 3300022732 Bacteria 5531
189 Ga0224571_100028 3300022734 Bacteria 4466
190 Ga0228598_1000108 3300024227 Bacteria 13833
191 Ga0207656_10073617 3300025321 Bacteria 1523
192 Ga0207642_10010434 3300025899 Unclassified 3275
193 Ga0207680_10090901 3300025903 Bacteria 1941
194 Ga0207680_10179591 3300025903 Unclassified 1430
195 Ga0207647_10005629 3300025904 Bacteria 9148
196 Ga0207647_10018577 3300025904 Bacteria 4697
197 Ga0207699_10391331 3300025906 Bacteria 988
198 Ga0207645_10038748 3300025907 Bacteria 3055
199 Ga0207684_10002354 3300025910 Bacteria 19127
200 Ga0207654_10004687 3300025911 Bacteria 6917
201 Ga0207654_10040915 3300025911 Unclassified 2614
202 Ga0207707_10022613 3300025912 Bacteria 5497
203 Ga0207707_10098151 3300025912 Bacteria 2561
204 Ga0207695_10000988 3300025913 Bacteria 50418
205 Ga0207671_10146226 3300025914 Bacteria 1824
206 Ga0207663_10021234 3300025916 Bacteria 3694
207 Ga0207663_10283073 3300025916 Bacteria 1232
208 Ga0207660_10076633 3300025917 Bacteria 2446
209 Ga0207657_10002016 3300025919 Bacteria 21946
210 Ga0207657_10111129 3300025919 Bacteria 2263
211 Ga0207657_10129929 3300025919 Bacteria 2065
212 Ga0207652_10020665 3300025921 Bacteria 5425
213 Ga0207652_10211934 3300025921 Bacteria 1744
214 Ga0207652_10288809 3300025921 Bacteria 1480
215 Ga0207652_10364557 3300025921 Bacteria 1304
216 Ga0207694_10169805 3300025924 Bacteria 1766
217 Ga0207650_10021759 3300025925 Bacteria 4534
218 Ga0207687_10003718 3300025927 Bacteria 10269
219 Ga0207700_10009020 3300025928 Bacteria 6209
220 Ga0207700_10097904 3300025928 Bacteria 2332
221 Ga0207644_10007053 3300025931 Bacteria 7320
222 Ga0207690_10044450 3300025932 Bacteria 2928
223 Ga0207690_10085205 3300025932 Bacteria 2217
224 Ga0207706_10000242 3300025933 Bacteria 60281
225 Ga0207706_10004480 3300025933 Bacteria 13126
226 Ga0207686_10138431 3300025934 Bacteria 1679
227 Ga0207686_10326565 3300025934 Bacteria 1148
228 Ga0207709_10324142 3300025935 Bacteria 1154
229 Ga0207670_10084388 3300025936 Bacteria 2230
230 Ga0207704_10405549 3300025938 Bacteria 1077
231 Ga0207711_10004255 3300025941 Bacteria 12235
232 Ga0207711_10245159 3300025941 Unclassified 1644
233 Ga0207689_10007294 3300025942 Bacteria 9705
234 Ga0207689_10035006 3300025942 Bacteria 4172
235 Ga0207661_10333483 3300025944 Bacteria 1366
236 Ga0207679_10048608 3300025945 Unclassified 3089
237 Ga0207667_10004976 3300025949 Bacteria 16234
238 Ga0207667_10025892 3300025949 Bacteria 6417
239 Ga0207651_10025929 3300025960 Bacteria 3652
240 Ga0207712_10002102 3300025961 Bacteria 13044
241 Ga0207668_10002339 3300025972 Bacteria 11068
242 Ga0207640_10063001 3300025981 Bacteria 2462
243 Ga0207640_10065614 3300025981 Bacteria 2422
244 Ga0207658_10122676 3300025986 Bacteria 2074
245 Ga0207677_10177344 3300026023 Bacteria 1673
246 Ga0207677_10179394 3300026023 Bacteria 1664
247 Ga0207677_10204088 3300026023 Bacteria 1573
248 Ga0207639_10467996 3300026041 Unclassified 1147
249 Ga0207678_10000959 3300026067 Bacteria 26385
250 Ga0207678_10249182 3300026067 Bacteria 1521
251 Ga0207702_10002802 3300026078 Bacteria 16323
252 Ga0207641_10009008 3300026088 Bacteria 8243
253 Ga0207641_10250206 3300026088 Bacteria 1655
254 Ga0207648_10004587 3300026089 Bacteria 14164
255 Ga0207648_10007209 3300026089 Bacteria 10963
256 Ga0207676_10567130 3300026095 Unclassified 1086
257 Ga0207674_10008486 3300026116 Bacteria 11865
258 Ga0207674_10095260 3300026116 Bacteria 2963
259 Ga0207683_10154850 3300026121 Bacteria 2070
260 Ga0207683_10275389 3300026121 Bacteria 1538
261 Ga0207698_10300975 3300026142 Bacteria 1493
262 Ga0209588_1010031 3300027671 Bacteria 2842
263 Ga0209588_1052559 3300027671 Bacteria 1318
264 Ga0268266_10106236 3300028379 Unclassified 2481
265 Ga0268266_10370951 3300028379 Unclassified 1348
266 Ga0268265_10014616 3300028380 Bacteria 5352
267 Ga0268264_10353007 3300028381 Bacteria 1400
268 Ga0265338_10007371 3300028800 Bacteria 13677
269 Ga0265325_10088626 3300031241 Bacteria 1529
270 Ga0265342_10062520 3300031712 Bacteria 2191
271 Ga0373939_0087969 3300035114 Bacteria 1045
272 Ga0373931_0018104 3300035691 Bacteria 3498
273 Ga0373927_0000431 3300035695 Bacteria 32131
274 Ga0373927_0002611 3300035695 Bacteria 13131
275 Ga0373925_0571554 3300037068 Bacteria 930
276 Ga0495638_0205831 3300046460 Bacteria 1108
277 Ga0495651_0069552 3300046462 Unclassified 2681
278 Ga0495653_0066440 3300046463 Bacteria 2713
279 Ga0495580_0002731 3300046472 Bacteria 15225
280 Ga0495580_0055777 3300046472 Bacteria 2783
281 Ga0495580_0206980 3300046472 Bacteria 1351
282 Ga0495582_0004517 3300046473 Bacteria 7822
283 Ga0495582_0115463 3300046473 Bacteria 1509
284 Ga0495662_0000473 3300046476 Bacteria 18250
285 Ga0495664_0012654 3300046477 Bacteria 4778
286 Ga0495594_0000064 3300046499 Bacteria 45387
287 Ga0495594_0001650 3300046499 Bacteria 11598
288 Ga0495596_0023707 3300046500 Bacteria 2489
289 Ga0495606_0015803 3300046507 Bacteria 5793
290 Ga0495606_0121296 3300046507 Bacteria 1565
291 Ga0495628_0044790 3300046516 Bacteria 3518
292 Ga0495644_0000014 3300046523 Bacteria 90737
293 Ga0495666_0001324 3300046526 Bacteria 11996
294 Ga0495652_0420102 3300046529 Unclassified 942
295 Ga0495665_0003131 3300046531 Bacteria 8948
296 Ga0495640_0043678 3300046533 Bacteria 3120
297 Ga0495640_0078349 3300046533 Unclassified 2201
298 Ga0495586_0004667 3300046535 Bacteria 7327
299 Ga0495609_0135166 3300046538 Bacteria 1054
300 Ga0495645_0002268 3300046543 Bacteria 13086
301 Ga0495667_0000823 3300046559 Bacteria 20015
302 Ga0495634_0004569 3300046642 Bacteria 10809
303 Ga0495657_0207151 3300046675 Bacteria 1193
304 Ga0495599_0004787 3300046678 Bacteria 8047
305 Ga0495658_0101018 3300046683 Bacteria 1722
306 Ga0495613_0000700 3300046689 Bacteria 26428
307 Ga0495613_0027507 3300046689 Bacteria 4231
308 Ga0495624_0030702 3300046690 Bacteria 3498
309 Ga0495600_0053399 3300046809 Bacteria 2639
310 Ga0495581_0090851 3300047315 Bacteria 1771
311 Ga0495636_0069196 3300047318 Bacteria 1504
312 Ga0495674_0017067 3300047319 Bacteria 6762
313 Ga0495675_0027671 3300047444 Bacteria 3613
314 Ga0495686_0012998 3300047472 Bacteria 5800
315 Ga0496100_0035382 3300048903 Bacteria 3141
316 Ga0496100_0309760 3300048903 Bacteria 1184
317 Ga0496102_0021416 3300048905 Bacteria 5717
318 Ga0496102_0150565 3300048905 Bacteria 2186
319 Ga0496102_0568535 3300048905 Bacteria 1056
320 Ga0496103_0021236 3300048906 Bacteria 3906
321 Ga0496103_0072443 3300048906 Unclassified 2158
322 Ga0496104_0082433 3300048907 Bacteria 3067
323 Ga0496104_0365120 3300048907 Bacteria 1356
324 Ga0496106_0392613 3300048909 Bacteria 1115
325 Ga0496110_0015368 3300048913 Bacteria 6369
326 Ga0496111_0012463 3300048914 Bacteria 5757
327 Ga0496112_0106195 3300048915 Unclassified 2778
328 Ga0496112_0411429 3300048915 Bacteria 1291
329 Ga0496113_0419094 3300048916 Bacteria 1075
330 Ga0496124_0182629 3300048927 Unclassified 1613
331 Ga0496126_0001799 3300048929 Bacteria 31424
332 nmdc:mga0n895_144293_c1 3300050512 Unclassified 2410
333 nmdc:mga0n895_9188_c1 3300050512 Bacteria 8636
334 nmdc:mga0rr50_48548_c1 3300050513 Bacteria 3138
335 nmdc:mga0rr50_67520_c1 3300050513 Unclassified 2716
336 nmdc:mga08x19_284605_c1 3300050514 Bacteria 1146
337 nmdc:mga08x19_473_c1 3300050514 Bacteria 27166
338 nmdc:mga0a205_17554_c1 3300050515 Bacteria 6713
339 nmdc:mga0a205_65068_c1 3300050515 Bacteria 3522
340 Ga0097621_100094158
341 MRS1b_contig_6848229
342 Ga0065712_10117500
343 Ga0065707_10253969
344 Ga0070676_10087706
345 Ga0070683_100004437
346 Ga0070690_100033904
347 Ga0070670_100011167
348 Ga0068869_100002789
349 Ga0070666_10023142
350 Ga0070680_100018326
351 Ga0070682_100017042
352 Ga0068868_100003502
353 Ga0068868_100015076
354 Ga0070660_100007818
355 Ga0070660_100007917
356 Ga0070660_100149067
357 Ga0070661_100027572
358 Ga0070661_100033601
359 Ga0070661_100036644
360 Ga0070669_100075382
361 Ga0070675_100230277
362 Ga0070671_100519301
363 Ga0070673_100471340
364 Ga0070659_100020414
365 Ga0070667_100072694
366 Ga0070709_10017167
367 Ga0070709_10266708
368 Ga0070709_10299547
369 Ga0070714_100208238
370 Ga0070713_100000164
371 Ga0070713_100065589
372 Ga0070713_100198024
373 Ga0070711_100000108
374 Ga0070711_100384007
375 Ga0070705_100097472
376 Ga0070708_100032908
377 Ga0070663_100381827
378 Ga0070678_100244939
379 Ga0070662_100000987
380 Ga0070662_100199434
381 Ga0070681_10025051
382 Ga0070681_10031785
383 Ga0070681_10034090
384 Ga0070681_10359796
385 Ga0068867_100009202
386 Ga0068867_100021799
387 Ga0070685_10050713
388 Ga0070706_100045645
389 Ga0070706_100088480
390 Ga0070707_100017707
391 Ga0070698_100014710
392 Ga0070698_100329077
393 Ga0070699_100041456
394 Ga0070679_100021418
395 Ga0070679_100112063
396 Ga0070679_100122184
397 Ga0070684_100172562
398 Ga0070697_100003422
399 Ga0070697_100399282
400 Ga0068853_100232960
401 Ga0070672_100364548
402 Ga0070686_100113709
403 Ga0070695_100029801
404 Ga0070665_100071764
405 Ga0070665_100497769
406 Ga0068855_100002751
407 Ga0068855_100098453
408 Ga0070664_100004725
409 Ga0068857_100001025
410 Ga0068854_100148719
411 Ga0068856_100012971
412 Ga0068856_100026326
413 Ga0068856_100272449
414 Ga0068859_100023639
415 Ga0068859_100038340
416 Ga0068864_100004146
417 Ga0068864_100077559
418 Ga0068864_100110059
419 Ga0068866_10005420
420 Ga0068861_100179350
421 Ga0068851_10019820
422 Ga0068851_10087062
423 Ga0068851_10099571
424 Ga0068863_100008235
425 Ga0068863_100042742
426 Ga0068863_100061040
427 Ga0068863_100292201
428 Ga0068863_100610783
429 Ga0068858_100019898
430 Ga0068858_100062834
431 Ga0068860_100091838
432 Ga0068860_100393884
433 Ga0068862_100070931
434 Ga0070717_10011599
435 Ga0070717_10021911
436 Ga0070717_10177356
437 Ga0070716_100000477
438 Ga0070712_100000226
439 Ga0070712_100018682
440 Ga0097621_100024686
441 Ga0068871_100031290
442 Ga0068871_100034274
443 Ga0068871_100114482
444 Ga0075433_10012174
445 Ga0075433_10216468
446 Ga0075433_10325326
447 Ga0075434_100011194
448 Ga0075434_100205585
449 Ga0068865_100027448
450 Ga0075436_100007326
451 Ga0075436_100127245
452 Ga0075436_100329216
453 Ga0097620_100023639
454 Ga0097620_100038338
455 Ga0075435_100109023
456 Ga0099794_10012208
457 Ga0099794_10034176
458 Ga0105240_10014763
459 Ga0105240_10033170
460 Ga0105240_10214917
461 Ga0105240_10509724
462 Ga0105240_10888977
463 Ga0105245_10039601
464 Ga0105247_10003744
465 Ga0105241_10012524
466 Ga0105241_10019813
467 Ga0105241_10076621
468 Ga0105241_10301666
469 Ga0105242_10002289
470 Ga0105242_10093125
471 Ga0105242_10098240
472 Ga0105242_10450889
473 Ga0105248_10017111
474 Ga0105248_10028156
475 Ga0105248_10118461
476 Ga0105237_10053116
477 Ga0105237_10081388
478 Ga0105237_10092168
479 Ga0105237_10144960
480 Ga0105237_10276923
481 Ga0105237_10455154
482 Ga0105238_10135615
483 Ga0105238_10182262
484 Ga0105249_10000639
485 Ga0105249_10470746
486 Ga0105239_10017057
487 Ga0105239_10034315
488 Ga0105239_10259932
489 Ga0105246_10005133
490 Ga0157373_10011005
491 Ga0157373_10031423
492 Ga0157373_10033364
493 Ga0157373_10057260
494 Ga0157371_10008507
495 Ga0157371_10020772
496 Ga0157371_10031185
497 Ga0157370_10077579
498 Ga0157370_10186101
499 Ga0157369_10084718
500 Ga0157369_10170005
501 Ga0157374_10000817
502 Ga0157374_10002265
503 Ga0157374_10004724
504 Ga0157374_10068746
505 Ga0157374_10322577
506 Ga0157378_10003467
507 Ga0157378_10004421
508 Ga0157378_10015612
509 Ga0157378_10447784
510 Ga0157378_10584627
511 Ga0163162_10003787
512 Ga0163162_10157048
513 Ga0157372_10004458
514 Ga0157372_10166654
515 Ga0157375_10044440
516 Ga0157375_10267036
517 Ga0157375_10292279
518 Ga0157375_10305055
519 Ga0163163_10002544
520 Ga0163163_10067277
521 Ga0163163_10610330
522 Ga0157379_10071746
523 Ga0157376_10007473
524 Ga0157376_10007539
525 Ga0182007_10049843
526 Ga0182005_1006213
527 Ga0224569_100132
528 Ga0224571_100028
529 Ga0228598_1000108
530 Ga0207656_10073617
531 Ga0207642_10010434
532 Ga0207680_10090901
533 Ga0207680_10179591
534 Ga0207647_10005629
535 Ga0207647_10018577
536 Ga0207699_10391331
537 Ga0207645_10038748
538 Ga0207684_10002354
539 Ga0207654_10004687
540 Ga0207654_10040915
541 Ga0207707_10022613
542 Ga0207707_10098151
543 Ga0207695_10000988
544 Ga0207671_10146226
545 Ga0207663_10021234
546 Ga0207663_10283073
547 Ga0207660_10076633
548 Ga0207657_10002016
549 Ga0207657_10111129
550 Ga0207657_10129929
551 Ga0207652_10020665
552 Ga0207652_10211934
553 Ga0207652_10288809
554 Ga0207652_10364557
555 Ga0207694_10169805
556 Ga0207650_10021759
557 Ga0207687_10003718
558 Ga0207700_10009020
559 Ga0207700_10097904
560 Ga0207644_10007053
561 Ga0207690_10044450
562 Ga0207690_10085205
563 Ga0207706_10000242
564 Ga0207706_10004480
565 Ga0207686_10138431
566 Ga0207686_10326565
567 Ga0207709_10324142
568 Ga0207670_10084388
569 Ga0207704_10405549
570 Ga0207711_10004255
571 Ga0207711_10245159
572 Ga0207689_10007294
573 Ga0207689_10035006
574 Ga0207661_10333483
575 Ga0207679_10048608
576 Ga0207667_10004976
577 Ga0207667_10025892
578 Ga0207651_10025929
579 Ga0207712_10002102
580 Ga0207668_10002339
581 Ga0207640_10063001
582 Ga0207640_10065614
583 Ga0207658_10122676
584 Ga0207677_10177344
585 Ga0207677_10179394
586 Ga0207677_10204088
587 Ga0207639_10467996
588 Ga0207678_10000959
589 Ga0207678_10249182
590 Ga0207702_10002802
591 Ga0207641_10009008
592 Ga0207641_10250206
593 Ga0207648_10004587
594 Ga0207648_10007209
595 Ga0207676_10567130
596 Ga0207674_10008486
597 Ga0207674_10095260
598 Ga0207683_10154850
599 Ga0207683_10275389
600 Ga0207698_10300975
601 Ga0209588_1010031
602 Ga0209588_1052559
603 Ga0268266_10106236
604 Ga0268266_10370951
605 Ga0268265_10014616
606 Ga0268264_10353007
607 Ga0265338_10007371
608 Ga0265325_10088626
609 Ga0265342_10062520
610 Ga0373939_0087969
611 Ga0373931_0018104
612 Ga0373927_0000431
613 Ga0373927_0002611
614 Ga0373925_0571554
615 Ga0495638_0205831
616 Ga0495651_0069552
617 Ga0495653_0066440
618 Ga0495580_0002731
619 Ga0495580_0055777
620 Ga0495580_0206980
621 Ga0495582_0004517
622 Ga0495582_0115463
623 Ga0495662_0000473
624 Ga0495664_0012654
625 Ga0495594_0000064
626 Ga0495594_0001650
627 Ga0495596_0023707
628 Ga0495606_0015803
629 Ga0495606_0121296
630 Ga0495628_0044790
631 Ga0495644_0000014
632 Ga0495666_0001324
633 Ga0495652_0420102
634 Ga0495665_0003131
635 Ga0495640_0043678
636 Ga0495640_0078349
637 Ga0495586_0004667
638 Ga0495609_0135166
639 Ga0495645_0002268
640 Ga0495667_0000823
641 Ga0495634_0004569
642 Ga0495657_0207151
643 Ga0495599_0004787
644 Ga0495658_0101018
645 Ga0495613_0000700
646 Ga0495613_0027507
647 Ga0495624_0030702
648 Ga0495600_0053399
649 Ga0495581_0090851
650 Ga0495636_0069196
651 Ga0495674_0017067
652 Ga0495675_0027671
653 Ga0495686_0012998
654 Ga0496100_0035382
655 Ga0496100_0309760
656 Ga0496102_0021416
657 Ga0496102_0150565
658 Ga0496102_0568535
659 Ga0496103_0021236
660 Ga0496103_0072443
661 Ga0496104_0082433
662 Ga0496104_0365120
663 Ga0496106_0392613
664 Ga0496110_0015368
665 Ga0496111_0012463
666 Ga0496112_0106195
667 Ga0496112_0411429
668 Ga0496113_0419094
669 Ga0496124_0182629
670 Ga0496126_0001799
671 nmdc:mga0n895_144293_c1
672 nmdc:mga0n895_9188_c1
673 nmdc:mga0rr50_48548_c1
674 nmdc:mga0rr50_67520_c1
675 nmdc:mga08x19_284605_c1
676 nmdc:mga08x19_473_c1
677 nmdc:mga0a205_17554_c1
678 nmdc:mga0a205_65068_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06283

ThuA

Trehalose utilisation

58

284

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4pxy-assembly1.cif.gz_A crystal structure of a putative thua-like protein (bacuni_01602) from bacteroides uniformis atcc 8492 at 1.50 a resolution 0.8049 17 250
4pxy-assembly1.cif.gz_A crystal structure of a putative thua-like protein (bacuni_01602) from bacteroides uniformis atcc 8492 at 1.50 a resolution 0.7538 17 250
4e5v-assembly2.cif.gz_B crystal structure of a putative thua-like protein (parmer_02418) from parabacteroides merdae atcc 43184 at 1.75 a resolution 0.7092 20 264
7vc3-assembly1.cif.gz_A-2 toxoplasma gondii prolyl-trna synthetase (tgprs) in complex with inhibitor l97 and l-proline at 1.97 a resolution 0.6791 21 60
4rk1-assembly1.cif.gz_A crystal structure of laci family transcriptional regulator from enterococcus faecium, target efi-512930, with bound ribose 0.666 22 116
ID Description Score Start End Superfamily
4pxyB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.8159 17 250 3.40.50.880
4pxyB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.7629 17 250 3.40.50.880
4e5vA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.7023 21 264 3.40.50.880
af_A0A144A0G8_533_653_3.40.50.800 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Anticodon-binding domain 0.6568 21 61 3.40.50.800
3a31A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Anticodon-binding domain 0.6541 19 60 3.40.50.800
ID Description Score Start End GO Terms
AF-A0A2V9X0X7-F1-model_v4 ThuA domain-containing protein 0.9938 11 266
AF-A0A2V5XVZ3-F1-model_v4 ThuA domain-containing protein 0.9922 115 265
AF-A0A4Q7YVT7-F1-model_v4 ThuA-like domain-containing protein 0.9897 13 256 GO:0016020
AF-A0A2V5WWS4-F1-model_v4 ThuA domain-containing protein 0.9894 93 265
AF-A0A2V7X6W3-F1-model_v4 ThuA domain-containing protein 0.9872 20 265

Map