F413719

General Info

Members Datasets Scaffolds Average Seq Length
338 202 676 342

Family's Representative Sequence

Representative Sequence 3300050507|nmdc:mga05p37_49779_c1|nmdc:mga05p37_49779_c1_71_1186
Length 371
Sequence MDFYVILGVERGATVADVKRAYKRLARRYHPDINPGDRMAEAHFRQIAQAYETLIDPDRRRRYDATGTTDQTPPGPTVGFEGFDFTVSVHGSEASTFGDLFADVFRQRDHPPADTVERGVDLHQTVTLTLEDAIRGGAPAVTITRQEHCRMCRGVGWMNVNETRCSPCHGTGVVKSARGHMVFSRPCAHCGGSGRLSRTRCPTXGGQQVEMRTETLTITLPPGLADEARIRVQSKGHVGRHGGENGDLFITVRVQPHPVFSRHGDDLHVTIPIAIHEAGLGAKVEVPSLDGPARLRVPPGTQSGQRFRVRERGAPSPRDGRRGDLVVEVKLVLPKQLDERSKELLREFGRINGDDVRQAPFPDRGHDGRER

Samples

Sample ID Description Type Environment
1 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
129 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
130 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
131 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
132 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
135 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
136 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
137 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
138 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
139 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
140 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
141 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
142 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
143 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
144 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
145 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
146 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
147 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
148 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
149 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
150 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
151 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
152 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
153 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
154 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
155 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
156 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
158 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
159 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
160 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
161 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
162 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
163 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
164 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
165 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
166 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
167 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
168 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
169 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
170 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
171 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
172 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
173 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
174 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
175 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
176 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
177 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
178 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
179 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
180 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
181 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
182 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
183 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
184 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
185 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
188 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
189 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
190 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
191 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
192 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
193 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
194 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
195 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
196 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
197 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
198 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
199 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
200 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
201 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
202 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.7
Metatranscriptomes 0
Isolates 0.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.07
Rhizosphere 97.63
Stem 0
Stem Tuber 0
Unclassified 5.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga05p37_49779_c1 3300050507 Bacteria 5154
2 JGI24751J29686_10020344 3300002459 Bacteria 1374
3 rootH1_10101391 3300003323 Bacteria 4193
4 Ga0070676_10050171 3300005328 Bacteria 2446
5 Ga0070683_100383242 3300005329 Unclassified 1340
6 Ga0070683_100408109 3300005329 Bacteria 1296
7 Ga0070690_100013497 3300005330 Bacteria 4830
8 Ga0070670_100003970 3300005331 Bacteria 12351
9 Ga0070670_100065339 3300005331 Bacteria 3122
10 Ga0070670_100130608 3300005331 Bacteria 2169
11 Ga0068869_100088223 3300005334 Bacteria 2328
12 Ga0070666_10027768 3300005335 Bacteria 3709
13 Ga0070666_10179914 3300005335 Bacteria 1483
14 Ga0070680_100059574 3300005336 Bacteria 3124
15 Ga0068868_100045787 3300005338 Bacteria 3423
16 Ga0068868_100212333 3300005338 Bacteria 1618
17 Ga0070660_100016133 3300005339 Bacteria 5416
18 Ga0070689_100008981 3300005340 Bacteria 7074
19 Ga0070689_100080792 3300005340 Bacteria 2552
20 Ga0070691_10143411 3300005341 Bacteria 1219
21 Ga0070668_100028600 3300005347 Bacteria 4231
22 Ga0070668_100072809 3300005347 Bacteria 2678
23 Ga0070669_100013548 3300005353 Bacteria 5797
24 Ga0070669_100043398 3300005353 Bacteria 3275
25 Ga0070669_100049148 3300005353 Bacteria 3079
26 Ga0070671_100113916 3300005355 Bacteria 2273
27 Ga0070674_100002883 3300005356 Bacteria 9514
28 Ga0070674_100120209 3300005356 Bacteria 1944
29 Ga0070673_100005867 3300005364 Bacteria 7918
30 Ga0070673_100196191 3300005364 Bacteria 1737
31 Ga0070673_100265103 3300005364 Bacteria 1502
32 Ga0070688_100081234 3300005365 Bacteria 2099
33 Ga0070667_100003497 3300005367 Bacteria 13388
34 Ga0070667_100141866 3300005367 Bacteria 2105
35 Ga0070709_10025935 3300005434 Bacteria 3468
36 Ga0070713_100027259 3300005436 Bacteria 4496
37 Ga0070701_10001903 3300005438 Bacteria 7908
38 Ga0070701_10079871 3300005438 Bacteria 1768
39 Ga0070705_100034807 3300005440 Bacteria 2818
40 Ga0070700_100063162 3300005441 Bacteria 2342
41 Ga0070694_100040099 3300005444 Bacteria 3120
42 Ga0070694_100041920 3300005444 Bacteria 3056
43 Ga0070694_100192083 3300005444 Bacteria 1517
44 Ga0070662_100181052 3300005457 Bacteria 1661
45 Ga0070681_10402612 3300005458 Bacteria 1280
46 Ga0068867_100031737 3300005459 Bacteria 3816
47 Ga0068867_100080524 3300005459 Bacteria 2452
48 Ga0070685_10077424 3300005466 Bacteria 1986
49 Ga0070706_100143560 3300005467 Bacteria 2229
50 Ga0070698_100067754 3300005471 Bacteria 3588
51 Ga0070699_100026866 3300005518 Bacteria 4966
52 Ga0070699_100225663 3300005518 Bacteria 1670
53 Ga0070679_100009698 3300005530 Bacteria 9108
54 Ga0070679_100031462 3300005530 Bacteria 5242
55 Ga0070679_100039623 3300005530 Bacteria 4682
56 Ga0070679_100061778 3300005530 Bacteria 3734
57 Ga0070679_100103632 3300005530 Bacteria 2831
58 Ga0070679_100130204 3300005530 Bacteria 2497
59 Ga0070684_100075979 3300005535 Bacteria 2964
60 Ga0070697_100033233 3300005536 Bacteria 4153
61 Ga0070672_100027302 3300005543 Bacteria 4256
62 Ga0070672_100166961 3300005543 Bacteria 1829
63 Ga0070686_100001161 3300005544 Bacteria 15057
64 Ga0070686_100012355 3300005544 Bacteria 4860
65 Ga0070695_100053676 3300005545 Bacteria 2592
66 Ga0070696_100017164 3300005546 Bacteria 4885
67 Ga0070696_100078902 3300005546 Bacteria 2329
68 Ga0070696_100120583 3300005546 Bacteria 1898
69 Ga0070665_100001935 3300005548 Bacteria 23347
70 Ga0070665_100005091 3300005548 Bacteria 13635
71 Ga0070704_100022842 3300005549 Bacteria 4075
72 Ga0070704_100259619 3300005549 Bacteria 1431
73 Ga0070704_100333738 3300005549 Bacteria 1274
74 Ga0068855_100030978 3300005563 Bacteria 6392
75 Ga0068855_100352572 3300005563 Bacteria 1621
76 Ga0070664_100023341 3300005564 Bacteria 5109
77 Ga0068854_100007115 3300005578 Bacteria 7145
78 Ga0068856_100045953 3300005614 Bacteria 4300
79 Ga0070702_100105561 3300005615 Bacteria 1736
80 Ga0068859_100091143 3300005617 Bacteria 3099
81 Ga0068859_100147996 3300005617 Unclassified 2424
82 Ga0068864_100008199 3300005618 Bacteria 8614
83 Ga0068864_100047325 3300005618 Bacteria 3693
84 Ga0068861_100012640 3300005719 Bacteria 5891
85 Ga0068863_100082036 3300005841 Bacteria 3055
86 Ga0068858_100004357 3300005842 Bacteria 13886
87 Ga0068858_100017788 3300005842 Bacteria 6656
88 Ga0068858_100043352 3300005842 Bacteria 4172
89 Ga0068858_100224242 3300005842 Bacteria 1781
90 Ga0068858_100348423 3300005842 Unclassified 1418
91 Ga0068862_100012427 3300005844 Bacteria 7044
92 Ga0068862_100289134 3300005844 Bacteria 1505
93 Ga0070717_10077708 3300006028 Bacteria 2780
94 Ga0097621_100001628 3300006237 Bacteria 15402
95 Ga0097621_100001862 3300006237 Bacteria 14468
96 Ga0097621_100035394 3300006237 Bacteria 3990
97 Ga0097621_100043794 3300006237 Bacteria 3609
98 Ga0068871_100000536 3300006358 Bacteria 25860
99 Ga0068871_100064035 3300006358 Bacteria 3009
100 Ga0075431_100278211 3300006847 Bacteria 1695
101 Ga0075433_10015043 3300006852 Bacteria 6334
102 Ga0075433_10087984 3300006852 Bacteria 2744
103 Ga0075433_10146183 3300006852 Bacteria 2101
104 Ga0075433_10167562 3300006852 Bacteria 1955
105 Ga0075434_100001809 3300006871 Bacteria 18491
106 Ga0075434_100015681 3300006871 Bacteria 7272
107 Ga0075434_100035870 3300006871 Bacteria 4903
108 Ga0075434_100148009 3300006871 Bacteria 2368
109 Ga0075434_100219385 3300006871 Bacteria 1921
110 Ga0075429_100037738 3300006880 Bacteria 4206
111 Ga0068865_100007952 3300006881 Bacteria 6547
112 Ga0068865_100062697 3300006881 Bacteria 2610
113 Ga0068865_100274060 3300006881 Bacteria 1341
114 Ga0075436_100000578 3300006914 Bacteria 23933
115 Ga0075436_100005483 3300006914 Bacteria 8722
116 Ga0075436_100031182 3300006914 Bacteria 3670
117 Ga0075436_100125614 3300006914 Bacteria 1797
118 Ga0097620_100091144 3300006931 Bacteria 3099
119 Ga0097620_100147989 3300006931 Unclassified 2424
120 Ga0075435_100000084 3300007076 Bacteria 49470
121 Ga0075435_100003819 3300007076 Bacteria 10277
122 Ga0075435_100005610 3300007076 Bacteria 8789
123 Ga0075435_100011927 3300007076 Bacteria 6418
124 Ga0075435_100015182 3300007076 Bacteria 5784
125 Ga0075435_100056742 3300007076 Bacteria 3166
126 Ga0105240_10499920 3300009093 Bacteria 1352
127 Ga0111539_10094373 3300009094 Bacteria 3515
128 Ga0105245_10009333 3300009098 Bacteria 8556
129 Ga0105247_10043166 3300009101 Bacteria 2762
130 Ga0114129_10004308 3300009147 Bacteria 20111
131 Ga0114129_10004440 3300009147 Bacteria 19795
132 Ga0114129_10029657 3300009147 Bacteria 7748
133 Ga0114129_10088307 3300009147 Bacteria 4298
134 Ga0105243_10010296 3300009148 Bacteria 7103
135 Ga0105243_10068241 3300009148 Bacteria 2865
136 Ga0105242_10011093 3300009176 Bacteria 6924
137 Ga0105242_10012776 3300009176 Bacteria 6468
138 Ga0105248_10004279 3300009177 Bacteria 15796
139 Ga0105248_10011760 3300009177 Bacteria 9654
140 Ga0105248_10031722 3300009177 Bacteria 5903
141 Ga0105248_10311687 3300009177 Bacteria 1772
142 Ga0105248_10328636 3300009177 Bacteria 1722
143 Ga0105248_10376550 3300009177 Bacteria 1598
144 Ga0157374_10114864 3300013296 Bacteria 2593
145 Ga0163162_10428756 3300013306 Unclassified 1454
146 Ga0157372_10163894 3300013307 Bacteria 2570
147 Ga0157375_10056919 3300013308 Bacteria 3863
148 Ga0163163_10084587 3300014325 Bacteria 3179
149 Ga0163163_10166596 3300014325 Bacteria 2250
150 Ga0163163_10301367 3300014325 Bacteria 1655
151 Ga0157377_10028327 3300014745 Bacteria 3015
152 Ga0157379_10073152 3300014968 Bacteria 3068
153 Ga0157376_10125588 3300014969 Unclassified 2281
154 Ga0157376_10160322 3300014969 Bacteria 2038
155 Ga0207710_10013277 3300025900 Bacteria 3470
156 Ga0207680_10025258 3300025903 Bacteria 3275
157 Ga0207680_10057058 3300025903 Bacteria 2361
158 Ga0207699_10019165 3300025906 Bacteria 3642
159 Ga0207645_10155081 3300025907 Bacteria 1496
160 Ga0207705_10157608 3300025909 Bacteria 1704
161 Ga0207705_10175406 3300025909 Bacteria 1615
162 Ga0207707_10086374 3300025912 Bacteria 2741
163 Ga0207707_10139221 3300025912 Bacteria 2122
164 Ga0207707_10208512 3300025912 Unclassified 1703
165 Ga0207695_10279905 3300025913 Bacteria 1562
166 Ga0207671_10322701 3300025914 Bacteria 1222
167 Ga0207660_10009782 3300025917 Bacteria 6208
168 Ga0207660_10033572 3300025917 Bacteria 3551
169 Ga0207662_10001782 3300025918 Bacteria 10567
170 Ga0207662_10045567 3300025918 Bacteria 2592
171 Ga0207662_10110926 3300025918 Bacteria 1710
172 Ga0207657_10001951 3300025919 Bacteria 22271
173 Ga0207652_10014646 3300025921 Bacteria 6355
174 Ga0207652_10026329 3300025921 Bacteria 4843
175 Ga0207652_10127087 3300025921 Bacteria 2271
176 Ga0207646_10108815 3300025922 Bacteria 2487
177 Ga0207681_10003888 3300025923 Bacteria 9274
178 Ga0207681_10029516 3300025923 Bacteria 3563
179 Ga0207650_10078477 3300025925 Bacteria 2498
180 Ga0207650_10101012 3300025925 Bacteria 2220
181 Ga0207659_10227488 3300025926 Bacteria 1503
182 Ga0207687_10072633 3300025927 Bacteria 2462
183 Ga0207644_10055346 3300025931 Bacteria 2859
184 Ga0207644_10055795 3300025931 Bacteria 2849
185 Ga0207690_10176186 3300025932 Bacteria 1606
186 Ga0207706_10080961 3300025933 Bacteria 2854
187 Ga0207706_10156955 3300025933 Bacteria 2000
188 Ga0207686_10005375 3300025934 Bacteria 6868
189 Ga0207686_10069000 3300025934 Bacteria 2266
190 Ga0207709_10061317 3300025935 Bacteria 2350
191 Ga0207670_10061824 3300025936 Bacteria 2557
192 Ga0207669_10008531 3300025937 Bacteria 4818
193 Ga0207669_10086947 3300025937 Bacteria 2023
194 Ga0207704_10007536 3300025938 Bacteria 5148
195 Ga0207704_10072773 3300025938 Unclassified 2186
196 Ga0207691_10016627 3300025940 Bacteria 6985
197 Ga0207711_10022856 3300025941 Bacteria 5233
198 Ga0207711_10030595 3300025941 Bacteria 4542
199 Ga0207711_10264670 3300025941 Bacteria 1581
200 Ga0207711_10286083 3300025941 Bacteria 1519
201 Ga0207711_10355500 3300025941 Bacteria 1357
202 Ga0207689_10053432 3300025942 Bacteria 3328
203 Ga0207689_10184201 3300025942 Bacteria 1722
204 Ga0207661_10129845 3300025944 Bacteria 2157
205 Ga0207661_10269436 3300025944 Bacteria 1519
206 Ga0207661_10504775 3300025944 Unclassified 1105
207 Ga0207667_10336698 3300025949 Bacteria 1540
208 Ga0207667_10364351 3300025949 Bacteria 1474
209 Ga0207651_10218808 3300025960 Bacteria 1538
210 Ga0207668_10020707 3300025972 Bacteria 4185
211 Ga0207668_10067297 3300025972 Bacteria 2543
212 Ga0207640_10002905 3300025981 Bacteria 9199
213 Ga0207658_10058752 3300025986 Bacteria 2863
214 Ga0207677_10045015 3300026023 Bacteria 2945
215 Ga0207677_10251490 3300026023 Bacteria 1435
216 Ga0207703_10027980 3300026035 Bacteria 4439
217 Ga0207703_10095784 3300026035 Bacteria 2504
218 Ga0207708_10021535 3300026075 Bacteria 4862
219 Ga0207708_10135345 3300026075 Bacteria 1930
220 Ga0207702_10064673 3300026078 Bacteria 3131
221 Ga0207641_10013328 3300026088 Bacteria 6742
222 Ga0207641_10482359 3300026088 Bacteria 1202
223 Ga0207648_10032245 3300026089 Bacteria 4627
224 Ga0207648_10050565 3300026089 Bacteria 3634
225 Ga0207648_10106445 3300026089 Bacteria 2461
226 Ga0207676_10044657 3300026095 Bacteria 3420
227 Ga0207676_10059065 3300026095 Bacteria 3027
228 Ga0207676_10061316 3300026095 Bacteria 2977
229 Ga0207675_100008422 3300026118 Bacteria 9721
230 Ga0207675_100011959 3300026118 Bacteria 8110
231 Ga0207675_100183120 3300026118 Bacteria 2007
232 Ga0207428_10021117 3300027907 Bacteria 5516
233 Ga0268266_10015385 3300028379 Bacteria 6565
234 Ga0268266_10091413 3300028379 Bacteria 2668
235 Ga0268265_10003692 3300028380 Bacteria 10922
236 Ga0268265_10244998 3300028380 Bacteria 1584
237 Ga0268264_10100340 3300028381 Bacteria 2514
238 Ga0268264_10251370 3300028381 Bacteria 1642
239 Ga0265332_10056163 3300031238 Unclassified 1687
240 Ga0307408_100007202 3300031548 Bacteria 7357
241 Ga0307410_10030365 3300031852 Bacteria 3453
242 Ga0307407_10017367 3300031903 Bacteria 3608
243 Ga0307409_100008473 3300031995 Bacteria 6244
244 Ga0307416_100118160 3300032002 Bacteria 2355
245 Ga0307415_100084467 3300032126 Bacteria 2278
246 Ga0373930_0006788 3300034816 Bacteria 1949
247 Ga0373948_0000680 3300034817 Bacteria 4419
248 Ga0373958_0000413 3300034819 Bacteria 5205
249 Ga0373938_0004017 3300034957 Bacteria 2433
250 Ga0373926_0060535 3300035083 Unclassified 1380
251 Ga0373929_0000346 3300035085 Bacteria 8663
252 Ga0373940_0002899 3300035088 Bacteria 3416
253 Ga0373944_0056037 3300035089 Unclassified 1253
254 Ga0373951_0000272 3300035091 Bacteria 16526
255 Ga0373932_0000163 3300035112 Bacteria 19481
256 Ga0373941_0014045 3300035115 Bacteria 2131
257 Ga0373945_0015825 3300035116 Bacteria 2541
258 Ga0373960_0000236 3300035121 Bacteria 10271
259 Ga0373946_0047200 3300035171 Unclassified 1788
260 Ga0373955_0157205 3300035172 Bacteria 1340
261 Ga0373942_0000021 3300035207 Bacteria 30804
262 Ga0373961_0001361 3300035241 Bacteria 7334
263 Ga0373931_0000446 3300035691 Bacteria 16799
264 Ga0373935_0097794 3300035692 Bacteria 1931
265 Ga0373927_0192623 3300035695 Bacteria 1338
266 Ga0373947_0007831 3300035725 Bacteria 6172
267 Ga0373937_0033640 3300036401 Bacteria 4657
268 Ga0373937_0109819 3300036401 Bacteria 2565
269 Ga0373925_0051860 3300037068 Bacteria 3063
270 Ga0439433_0014730 3300041999 Bacteria 1724
271 Ga0451576_0047660 3300045051 Bacteria 4504
272 Ga0495592_0032144 3300046454 Bacteria 3963
273 Ga0495580_0024198 3300046472 Bacteria 4450
274 Ga0495580_0093690 3300046472 Bacteria 2090
275 Ga0495639_0056473 3300046475 Bacteria 1792
276 Ga0495608_0005249 3300046511 Bacteria 9255
277 Ga0495628_0030841 3300046516 Bacteria 4339
278 Ga0495652_0126290 3300046529 Bacteria 2032
279 Ga0495587_0085433 3300046536 Unclassified 1827
280 Ga0495621_0005852 3300046539 Bacteria 3560
281 Ga0495645_0008769 3300046543 Bacteria 7063
282 Ga0495667_0007402 3300046559 Bacteria 7444
283 Ga0495635_0198684 3300046663 Unclassified 1360
284 Ga0495623_0087616 3300046679 Bacteria 1918
285 Ga0495658_0037260 3300046683 Bacteria 2687
286 Ga0495669_0003757 3300046684 Bacteria 6239
287 Ga0495613_0000291 3300046689 Bacteria 46041
288 Ga0495604_0011462 3300047317 Bacteria 7039
289 Ga0495604_0111398 3300047317 Bacteria 1995
290 Ga0495674_0095160 3300047319 Bacteria 2540
291 Ga0495674_0160382 3300047319 Unclassified 1882
292 Ga0495684_0000138 3300047471 Bacteria 53459
293 Ga0495602_0134904 3300048088 Bacteria 1963
294 Ga0496102_0062452 3300048905 Bacteria 3411
295 Ga0496104_0209707 3300048907 Bacteria 1860
296 Ga0496108_0088096 3300048911 Bacteria 2637
297 Ga0496112_0011967 3300048915 Bacteria 7952
298 Ga0496112_0024484 3300048915 Bacteria 5781
299 Ga0496113_0022650 3300048916 Bacteria 4448
300 Ga0496114_0128907 3300048917 Bacteria 2183
301 Ga0501038_0420007 3300049574 Unclassified 1032
302 Ga0501040_0019375 3300049576 Bacteria 4525
303 Ga0501068_0195693 3300049584 Unclassified 1282
304 Ga0501072_0023213 3300049588 Bacteria 4817
305 Ga0501076_0003984 3300049592 Bacteria 10429
306 Ga0501080_0059223 3300049742 Bacteria 3565
307 Ga0501045_0029116 3300049824 Bacteria 3989
308 nmdc:mga05p37_10122_c1 3300050507 Bacteria 11196
309 nmdc:mga05p37_12993_c1 3300050507 Bacteria 9963
310 nmdc:mga05p37_9851_c1 3300050507 Bacteria 11343
311 nmdc:mga09592_190113_c1 3300050508 Bacteria 1777
312 nmdc:mga06r32_158517_c1 3300050510 Bacteria 2245
313 nmdc:mga08y16_16542_c1 3300050511 Bacteria 7760
314 nmdc:mga08y16_187735_c1 3300050511 Bacteria 2145
315 nmdc:mga08y16_75876_c1 3300050511 Bacteria 3504
316 nmdc:mga0n895_179053_c1 3300050512 Unclassified 2151
317 nmdc:mga0n895_25903_c1 3300050512 Bacteria 5546
318 nmdc:mga0n895_343332_c1 3300050512 Bacteria 1512
319 nmdc:mga0n895_399_c1 3300050512 Bacteria 29189
320 nmdc:mga0n895_45507_c1 3300050512 Bacteria 4283
321 nmdc:mga0n895_8819_c1 3300050512 Bacteria 8774
322 nmdc:mga0rr50_12715_c1 3300050513 Bacteria 5453
323 nmdc:mga0rr50_2_c1 3300050513 Bacteria 373938
324 nmdc:mga0rr50_351481_c1 3300050513 Unclassified 1240
325 nmdc:mga0rr50_369497_c1 3300050513 Bacteria 1208
326 nmdc:mga0rr50_5023_c1 3300050513 Bacteria 7839
327 nmdc:mga08x19_103735_c1 3300050514 Bacteria 1889
328 nmdc:mga08x19_11974_c1 3300050514 Bacteria 5220
329 nmdc:mga08x19_19527_c1 3300050514 Bacteria 4160
330 nmdc:mga08x19_289277_c1 3300050514 Bacteria 1137
331 nmdc:mga08x19_29173_c1 3300050514 Bacteria 3459
332 nmdc:mga08x19_340_c1 3300050514 Bacteria 33767
333 nmdc:mga0a205_11803_c1 3300050515 Bacteria 8062
334 nmdc:mga0a205_118661_c1 3300050515 Bacteria 2544
335 Ga0495619_0000690 3300053085 Bacteria 22103
336 Ga0501082_0095742 3300060353 Bacteria 2566
337 Ga0530510_0091493 3300061734 Bacteria 2219
338 8011352843 8011350971 Bacteria 6158957
339 nmdc:mga05p37_49779_c1
340 JGI24751J29686_10020344
341 rootH1_10101391
342 Ga0070676_10050171
343 Ga0070683_100383242
344 Ga0070683_100408109
345 Ga0070690_100013497
346 Ga0070670_100003970
347 Ga0070670_100065339
348 Ga0070670_100130608
349 Ga0068869_100088223
350 Ga0070666_10027768
351 Ga0070666_10179914
352 Ga0070680_100059574
353 Ga0068868_100045787
354 Ga0068868_100212333
355 Ga0070660_100016133
356 Ga0070689_100008981
357 Ga0070689_100080792
358 Ga0070691_10143411
359 Ga0070668_100028600
360 Ga0070668_100072809
361 Ga0070669_100013548
362 Ga0070669_100043398
363 Ga0070669_100049148
364 Ga0070671_100113916
365 Ga0070674_100002883
366 Ga0070674_100120209
367 Ga0070673_100005867
368 Ga0070673_100196191
369 Ga0070673_100265103
370 Ga0070688_100081234
371 Ga0070667_100003497
372 Ga0070667_100141866
373 Ga0070709_10025935
374 Ga0070713_100027259
375 Ga0070701_10001903
376 Ga0070701_10079871
377 Ga0070705_100034807
378 Ga0070700_100063162
379 Ga0070694_100040099
380 Ga0070694_100041920
381 Ga0070694_100192083
382 Ga0070662_100181052
383 Ga0070681_10402612
384 Ga0068867_100031737
385 Ga0068867_100080524
386 Ga0070685_10077424
387 Ga0070706_100143560
388 Ga0070698_100067754
389 Ga0070699_100026866
390 Ga0070699_100225663
391 Ga0070679_100009698
392 Ga0070679_100031462
393 Ga0070679_100039623
394 Ga0070679_100061778
395 Ga0070679_100103632
396 Ga0070679_100130204
397 Ga0070684_100075979
398 Ga0070697_100033233
399 Ga0070672_100027302
400 Ga0070672_100166961
401 Ga0070686_100001161
402 Ga0070686_100012355
403 Ga0070695_100053676
404 Ga0070696_100017164
405 Ga0070696_100078902
406 Ga0070696_100120583
407 Ga0070665_100001935
408 Ga0070665_100005091
409 Ga0070704_100022842
410 Ga0070704_100259619
411 Ga0070704_100333738
412 Ga0068855_100030978
413 Ga0068855_100352572
414 Ga0070664_100023341
415 Ga0068854_100007115
416 Ga0068856_100045953
417 Ga0070702_100105561
418 Ga0068859_100091143
419 Ga0068859_100147996
420 Ga0068864_100008199
421 Ga0068864_100047325
422 Ga0068861_100012640
423 Ga0068863_100082036
424 Ga0068858_100004357
425 Ga0068858_100017788
426 Ga0068858_100043352
427 Ga0068858_100224242
428 Ga0068858_100348423
429 Ga0068862_100012427
430 Ga0068862_100289134
431 Ga0070717_10077708
432 Ga0097621_100001628
433 Ga0097621_100001862
434 Ga0097621_100035394
435 Ga0097621_100043794
436 Ga0068871_100000536
437 Ga0068871_100064035
438 Ga0075431_100278211
439 Ga0075433_10015043
440 Ga0075433_10087984
441 Ga0075433_10146183
442 Ga0075433_10167562
443 Ga0075434_100001809
444 Ga0075434_100015681
445 Ga0075434_100035870
446 Ga0075434_100148009
447 Ga0075434_100219385
448 Ga0075429_100037738
449 Ga0068865_100007952
450 Ga0068865_100062697
451 Ga0068865_100274060
452 Ga0075436_100000578
453 Ga0075436_100005483
454 Ga0075436_100031182
455 Ga0075436_100125614
456 Ga0097620_100091144
457 Ga0097620_100147989
458 Ga0075435_100000084
459 Ga0075435_100003819
460 Ga0075435_100005610
461 Ga0075435_100011927
462 Ga0075435_100015182
463 Ga0075435_100056742
464 Ga0105240_10499920
465 Ga0111539_10094373
466 Ga0105245_10009333
467 Ga0105247_10043166
468 Ga0114129_10004308
469 Ga0114129_10004440
470 Ga0114129_10029657
471 Ga0114129_10088307
472 Ga0105243_10010296
473 Ga0105243_10068241
474 Ga0105242_10011093
475 Ga0105242_10012776
476 Ga0105248_10004279
477 Ga0105248_10011760
478 Ga0105248_10031722
479 Ga0105248_10311687
480 Ga0105248_10328636
481 Ga0105248_10376550
482 Ga0157374_10114864
483 Ga0163162_10428756
484 Ga0157372_10163894
485 Ga0157375_10056919
486 Ga0163163_10084587
487 Ga0163163_10166596
488 Ga0163163_10301367
489 Ga0157377_10028327
490 Ga0157379_10073152
491 Ga0157376_10125588
492 Ga0157376_10160322
493 Ga0207710_10013277
494 Ga0207680_10025258
495 Ga0207680_10057058
496 Ga0207699_10019165
497 Ga0207645_10155081
498 Ga0207705_10157608
499 Ga0207705_10175406
500 Ga0207707_10086374
501 Ga0207707_10139221
502 Ga0207707_10208512
503 Ga0207695_10279905
504 Ga0207671_10322701
505 Ga0207660_10009782
506 Ga0207660_10033572
507 Ga0207662_10001782
508 Ga0207662_10045567
509 Ga0207662_10110926
510 Ga0207657_10001951
511 Ga0207652_10014646
512 Ga0207652_10026329
513 Ga0207652_10127087
514 Ga0207646_10108815
515 Ga0207681_10003888
516 Ga0207681_10029516
517 Ga0207650_10078477
518 Ga0207650_10101012
519 Ga0207659_10227488
520 Ga0207687_10072633
521 Ga0207644_10055346
522 Ga0207644_10055795
523 Ga0207690_10176186
524 Ga0207706_10080961
525 Ga0207706_10156955
526 Ga0207686_10005375
527 Ga0207686_10069000
528 Ga0207709_10061317
529 Ga0207670_10061824
530 Ga0207669_10008531
531 Ga0207669_10086947
532 Ga0207704_10007536
533 Ga0207704_10072773
534 Ga0207691_10016627
535 Ga0207711_10022856
536 Ga0207711_10030595
537 Ga0207711_10264670
538 Ga0207711_10286083
539 Ga0207711_10355500
540 Ga0207689_10053432
541 Ga0207689_10184201
542 Ga0207661_10129845
543 Ga0207661_10269436
544 Ga0207661_10504775
545 Ga0207667_10336698
546 Ga0207667_10364351
547 Ga0207651_10218808
548 Ga0207668_10020707
549 Ga0207668_10067297
550 Ga0207640_10002905
551 Ga0207658_10058752
552 Ga0207677_10045015
553 Ga0207677_10251490
554 Ga0207703_10027980
555 Ga0207703_10095784
556 Ga0207708_10021535
557 Ga0207708_10135345
558 Ga0207702_10064673
559 Ga0207641_10013328
560 Ga0207641_10482359
561 Ga0207648_10032245
562 Ga0207648_10050565
563 Ga0207648_10106445
564 Ga0207676_10044657
565 Ga0207676_10059065
566 Ga0207676_10061316
567 Ga0207675_100008422
568 Ga0207675_100011959
569 Ga0207675_100183120
570 Ga0207428_10021117
571 Ga0268266_10015385
572 Ga0268266_10091413
573 Ga0268265_10003692
574 Ga0268265_10244998
575 Ga0268264_10100340
576 Ga0268264_10251370
577 Ga0265332_10056163
578 Ga0307408_100007202
579 Ga0307410_10030365
580 Ga0307407_10017367
581 Ga0307409_100008473
582 Ga0307416_100118160
583 Ga0307415_100084467
584 Ga0373930_0006788
585 Ga0373948_0000680
586 Ga0373958_0000413
587 Ga0373938_0004017
588 Ga0373926_0060535
589 Ga0373929_0000346
590 Ga0373940_0002899
591 Ga0373944_0056037
592 Ga0373951_0000272
593 Ga0373932_0000163
594 Ga0373941_0014045
595 Ga0373945_0015825
596 Ga0373960_0000236
597 Ga0373946_0047200
598 Ga0373955_0157205
599 Ga0373942_0000021
600 Ga0373961_0001361
601 Ga0373931_0000446
602 Ga0373935_0097794
603 Ga0373927_0192623
604 Ga0373947_0007831
605 Ga0373937_0033640
606 Ga0373937_0109819
607 Ga0373925_0051860
608 Ga0439433_0014730
609 Ga0451576_0047660
610 Ga0495592_0032144
611 Ga0495580_0024198
612 Ga0495580_0093690
613 Ga0495639_0056473
614 Ga0495608_0005249
615 Ga0495628_0030841
616 Ga0495652_0126290
617 Ga0495587_0085433
618 Ga0495621_0005852
619 Ga0495645_0008769
620 Ga0495667_0007402
621 Ga0495635_0198684
622 Ga0495623_0087616
623 Ga0495658_0037260
624 Ga0495669_0003757
625 Ga0495613_0000291
626 Ga0495604_0011462
627 Ga0495604_0111398
628 Ga0495674_0095160
629 Ga0495674_0160382
630 Ga0495684_0000138
631 Ga0495602_0134904
632 Ga0496102_0062452
633 Ga0496104_0209707
634 Ga0496108_0088096
635 Ga0496112_0011967
636 Ga0496112_0024484
637 Ga0496113_0022650
638 Ga0496114_0128907
639 Ga0501038_0420007
640 Ga0501040_0019375
641 Ga0501068_0195693
642 Ga0501072_0023213
643 Ga0501076_0003984
644 Ga0501080_0059223
645 Ga0501045_0029116
646 nmdc:mga05p37_10122_c1
647 nmdc:mga05p37_12993_c1
648 nmdc:mga05p37_9851_c1
649 nmdc:mga09592_190113_c1
650 nmdc:mga06r32_158517_c1
651 nmdc:mga08y16_16542_c1
652 nmdc:mga08y16_187735_c1
653 nmdc:mga08y16_75876_c1
654 nmdc:mga0n895_179053_c1
655 nmdc:mga0n895_25903_c1
656 nmdc:mga0n895_343332_c1
657 nmdc:mga0n895_399_c1
658 nmdc:mga0n895_45507_c1
659 nmdc:mga0n895_8819_c1
660 nmdc:mga0rr50_12715_c1
661 nmdc:mga0rr50_2_c1
662 nmdc:mga0rr50_351481_c1
663 nmdc:mga0rr50_369497_c1
664 nmdc:mga0rr50_5023_c1
665 nmdc:mga08x19_103735_c1
666 nmdc:mga08x19_11974_c1
667 nmdc:mga08x19_19527_c1
668 nmdc:mga08x19_289277_c1
669 nmdc:mga08x19_29173_c1
670 nmdc:mga08x19_340_c1
671 nmdc:mga0a205_11803_c1
672 nmdc:mga0a205_118661_c1
673 Ga0495619_0000690
674 Ga0501082_0095742
675 Ga0530510_0091493
676 8011352843

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00226

DnaJ

DnaJ domain

2

64

0.99

PF01556

DnaJ_C

DnaJ C terminal domain

122

334

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5nro-assembly1.cif.gz_B structure of full-length dnak with bound j-domain 0.9597 1 61
7jtk-assembly1.cif.gz_y radial spoke 1 isolated from chlamydomonas reinhardtii 0.9417 2 65
3i38-assembly7.cif.gz_B structure of a putative chaperone protein dnaj from klebsiella pneumoniae subsp. pneumoniae mgh 78578 0.9407 240 337
3i38-assembly5.cif.gz_J structure of a putative chaperone protein dnaj from klebsiella pneumoniae subsp. pneumoniae mgh 78578 0.9374 240 337
2qsa-assembly1.cif.gz_A crystal structure of j-domain of dnaj homolog dnj-2 precursor from c.elegans. 0.9343 1 68
ID Description Score Start End Superfamily
af_Q8GUN6_21_122_1.10.287.110 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain 0.9879 1 68 1.10.287.110
af_Q9P7C6_2_100_1.10.287.110 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain 0.9825 1 69 1.10.287.110
af_P36659_200_276_2.60.260.20 Mainly Beta;Sandwich;HSP40/DNAj peptide-binding domain;Urease metallochaperone UreE, N-terminal domain 0.9822 239 317 2.60.260.20
af_I1NG96_25_126_1.10.287.110 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain 0.9812 1 68 1.10.287.110
af_I1LJ46_11_102_1.10.287.110 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain 0.9784 2 69 1.10.287.110
ID Description Score Start End GO Terms
AF-A0A1B6HNX1-F1-model_v4 Chaperone DnaJ C-terminal domain-containing protein 0.9739 229 333 GO:0005737
GO:0042026
GO:0051082
GO:0051085
AF-A0A6V8NMM0-F1-model_v4 Molecular chaperone DnaJ 0.9729 225 313 GO:0005737
GO:0042026
GO:0051082
GO:0051085
AF-M4CWL0-F1-model_v4 J domain-containing protein 0.9712 1 69
AF-A0A1S3RBH6-F1-model_v4 DnaJ homolog subfamily A member 3, mitochondrial-like isoform X2 0.9685 236 332 GO:0005739
GO:0006457
GO:0007005
GO:0019901
GO:0043066
GO:0051082
AF-A0A7J6SCU4-F1-model_v4 DnaJ sub C member 21 0.9681 1 69 GO:0005737
GO:0046872

Map