F413624

General Info

Members Datasets Scaffolds Average Seq Length
338 202 316 223

Family's Representative Sequence

Representative Sequence 3300041511|Ga0451855_0279592|Ga0451855_0279592_969_1757
Length 262
Sequence MKIYDRAGFPNPSRIRIVLAEKGVESQIEFVSVDLIAAEHKQSAFLLKNVSGVVPILELDDGTFLAECTAITEYLDNLDGNPTLTGRTPLEKGLIHMMQKRADNMLIDNIGIFFHHGTPGLGSALEAHKSPEWAHRKEWGLRHRELAIEGLRYFDDVLATRPYVAGGTFSMADITVFAALLFAGAAGIEIPDGCAALKAWHARVSELPSVKNRSGQNLEAEDLRRLGFSCIGSKIGIDFRKADAWIERVRAPFGRLKGRTAL

Samples

Sample ID Description Type Environment
1 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
2 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
3 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
4 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
5 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
6 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
7 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
8 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
9 2738541293 Rhizobium sp. GV031 Isolate Unclassified
10 2802429634 Rhizobium anhuiense S10 Isolate Nodule
11 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
12 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
13 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
14 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
15 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
16 2821131069 Duganella sp. 1224 Isolate Unclassified
17 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
18 2857558681 Duganella sp. R-74565 Isolate Unclassified
19 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
20 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
21 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
22 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
23 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
24 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
25 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
26 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
27 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
28 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
29 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
30 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
31 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
32 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
38 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
39 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
40 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
41 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
42 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
43 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
50 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
51 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
52 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
55 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
56 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
57 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
59 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
60 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
63 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
64 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
72 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
73 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
74 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
75 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
76 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
77 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
78 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
79 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
80 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
81 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
82 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
83 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
84 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
85 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
86 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
87 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
88 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
89 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
90 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
91 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
92 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
93 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
94 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
95 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
96 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
97 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
98 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
99 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
100 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
101 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
102 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
103 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
104 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
105 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
106 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
107 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
108 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
109 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
110 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
111 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
112 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
113 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
114 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
115 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
116 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
117 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
118 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
119 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
120 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
121 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
122 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
123 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
124 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
125 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
126 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
127 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
128 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
129 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
130 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
131 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
132 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
133 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
134 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
135 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
136 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
137 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
138 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
139 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
140 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
141 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
142 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
143 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
144 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
145 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
146 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
147 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
148 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
149 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
150 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
151 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
152 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
153 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
154 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
155 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
156 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
157 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
158 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
159 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
160 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
161 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
162 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
163 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
164 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
165 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
166 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
167 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
168 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
169 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
170 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
171 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
172 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
173 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
174 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
175 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
176 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
177 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
178 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
179 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
180 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
181 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
182 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
183 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
184 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
185 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
186 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
187 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
188 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
189 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
190 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
191 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
192 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
193 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
194 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
195 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
196 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
197 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
198 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
199 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
200 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
201 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
202 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.49
Metatranscriptomes 0
Isolates 6.51

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.19
Nodule 1.48
Rhizoplane 1.78
Rhizosphere 59.47
Stem 0
Stem Tuber 0
Unclassified 15.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000109 3300002704 Bacteria 43954
2 JGI25156J39149_1000106 3300002705 Bacteria 60506
3 JGI25156J39149_1002595 3300002705 Bacteria 6373
4 JGI25154J39366_1000038 3300002738 Bacteria 155793
5 JGI25154J39366_1000128 3300002738 Bacteria 59551
6 JGI25157J39369_1000676 3300002741 Bacteria 18747
7 JGI25150J39212_1002809 3300002774 Bacteria 4223
8 JGI25151J46595_10043502 3300003187 Bacteria 1606
9 Ga0055539_1000955 3300003752 Bacteria 6391
10 Ga0055532_1000023 3300003758 Bacteria 248212
11 Ga0055535_1004221 3300003761 Bacteria 3602
12 Ga0065165_1002832 3300005262 Bacteria 13534
13 Ga0070658_10140789 3300005327 Bacteria 2015
14 Ga0070673_100205668 3300005364 Bacteria 1697
15 Ga0070663_100103172 3300005455 Bacteria 2131
16 Ga0068857_100013617 3300005577 Bacteria 7086
17 Ga0068856_101052905 3300005614 Unclassified 831
18 Ga0075363_100142055 3300006048 Bacteria 1352
19 Ga0075362_10095870 3300006177 Unclassified 1382
20 Ga0075367_10431914 3300006178 Bacteria 834
21 Ga0075369_10030492 3300006186 Bacteria 2272
22 Ga0075366_10001229 3300006195 Bacteria 12705
23 Ga0075366_10096954 3300006195 Bacteria 1768
24 Ga0075370_10024576 3300006353 Bacteria 3329
25 Ga0105251_10000884 3300009011 Bacteria 26850
26 Ga0105240_10007957 3300009093 Bacteria 15295
27 Ga0105240_10154449 3300009093 Unclassified 2731
28 Ga0105243_10303498 3300009148 Bacteria 1448
29 Ga0105237_10119545 3300009545 Bacteria 2629
30 Ga0105239_10145365 3300010375 Bacteria 2644
31 Ga0163162_10042922 3300013306 Bacteria 4527
32 Ga0163162_10220698 3300013306 Bacteria 2025
33 Ga0163162_10282744 3300013306 Bacteria 1791
34 Ga0182007_10002879 3300015262 Bacteria 8370
35 Ga0163161_10044182 3300017792 Bacteria 3209
36 Ga0163161_10070969 3300017792 Bacteria 2547
37 Ga0163161_10228047 3300017792 Bacteria 1445
38 Ga0209435_100013 3300025206 Bacteria 366789
39 Ga0209435_100131 3300025206 Bacteria 25636
40 Ga0209147_100030 3300025229 Bacteria 366789
41 Ga0209258_100429 3300025242 Bacteria 49055
42 Ga0207425_1003391 3300025245 Bacteria 5115
43 Ga0209646_1000034 3300025246 Bacteria 366789
44 Ga0209646_1000155 3300025246 Bacteria 95204
45 Ga0209026_1000022 3300025250 Bacteria 366789
46 Ga0209026_1001247 3300025250 Bacteria 11646
47 Ga0209677_100060 3300025253 Bacteria 155728
48 Ga0209759_1000018 3300025256 Bacteria 366789
49 Ga0209759_1000375 3300025256 Bacteria 55963
50 Ga0209129_1018704 3300025258 Bacteria 1326
51 Ga0209565_1004917 3300025263 Bacteria 3981
52 Ga0209455_1005934 3300025272 Bacteria 3683
53 Ga0209025_1039763 3300025294 Bacteria 2046
54 Ga0209256_1018872 3300025299 Bacteria 2220
55 Ga0209051_1018612 3300025303 Bacteria 3067
56 Ga0207655_1030989 3300025728 Bacteria 2474
57 Ga0207713_1000705 3300025735 Bacteria 31261
58 Ga0207695_10002671 3300025913 Bacteria 26049
59 Ga0207695_10252121 3300025913 Bacteria 1664
60 Ga0207651_10153714 3300025960 Bacteria 1795
61 Ga0207674_10032960 3300026116 Bacteria 5428
62 Ga0207674_10581832 3300026116 Bacteria 1081
63 Ga0207675_100000041 3300026118 Bacteria 90476
64 Ga0307515_10083127 3300028794 Bacteria 4131
65 Ga0307509_10425165 3300031507 Bacteria 1028
66 Ga0307408_100276554 3300031548 Bacteria 1396
67 Ga0307405_10091030 3300031731 Bacteria 2020
68 Ga0307405_10268722 3300031731 Bacteria 1278
69 Ga0307412_10005928 3300031911 Bacteria 6888
70 Ga0307414_10104166 3300032004 Bacteria 2142
71 Ga0307510_10105668 3300033180 Bacteria 2582
72 Ga0373931_0006607 3300035691 Bacteria 5429
73 Ga0439438_000450 3300041405 Bacteria 18562
74 Ga0439447_015924 3300041407 Bacteria 2075
75 Ga0439466_0009809 3300041411 Bacteria 3567
76 Ga0439465_0009028 3300041413 Bacteria 3142
77 Ga0451789_0620400 3300041443 Bacteria 3429
78 Ga0451798_0315603 3300041458 Bacteria 2012
79 Ga0451800_0782159 3300041459 Bacteria 2160
80 Ga0451802_1222012 3300041460 Bacteria 2857
81 Ga0451807_1172974 3300041486 Bacteria 2708
82 Ga0451833_1351731 3300041491 Bacteria 1618
83 Ga0451835_0281586 3300041492 Bacteria 1953
84 Ga0451837_1739032 3300041494 Bacteria 1469
85 Ga0451839_0436899 3300041496 Bacteria 1341
86 Ga0451841_0511162 3300041498 Bacteria 2036
87 Ga0451845_0127159 3300041501 Bacteria 2588
88 Ga0451847_0529332 3300041503 Bacteria 2367
89 Ga0451849_0316777 3300041505 Bacteria 1239
90 Ga0451851_1003024 3300041507 Bacteria 2268
91 Ga0451843_0146066 3300041509 Bacteria 1474
92 Ga0451855_0279592 3300041511 Bacteria 2085
93 Ga0451853_0222309 3300041512 Bacteria 1431
94 Ga0451853_0647994 3300041512 Bacteria 1215
95 Ga0451853_0911215 3300041512 Bacteria 2472
96 Ga0439432_000556 3300042006 Bacteria 13905
97 Ga0439432_017976 3300042006 Bacteria 2368
98 Ga0439451_000424 3300042009 Bacteria 8247
99 Ga0439452_001012 3300042010 Bacteria 12440
100 Ga0439452_009334 3300042010 Bacteria 2893
101 Ga0450911_003919 3300042115 Bacteria 2520
102 Ga0450905_000011 3300042142 Bacteria 19765
103 Ga0495617_000888 3300046452 Bacteria 14042
104 Ga0495617_024900 3300046452 Bacteria 2018
105 Ga0495617_124665 3300046452 Bacteria 828
106 Ga0495627_113245 3300046453 Bacteria 769
107 Ga0495590_0000004 3300046457 Bacteria 402091
108 Ga0495590_0026469 3300046457 Bacteria 2036
109 Ga0495590_0045119 3300046457 Bacteria 1537
110 Ga0495591_018723 3300046458 Bacteria 2341
111 Ga0495638_0000023 3300046460 Bacteria 363063
112 Ga0495638_0000301 3300046460 Bacteria 63603
113 Ga0495638_0000629 3300046460 Bacteria 38947
114 Ga0495638_0002285 3300046460 Bacteria 15813
115 Ga0495638_0012644 3300046460 Bacteria 5776
116 Ga0495638_0018793 3300046460 Bacteria 4584
117 Ga0495638_0051019 3300046460 Bacteria 2582
118 Ga0495650_0000169 3300046471 Bacteria 145238
119 Ga0495650_0001357 3300046471 Bacteria 24310
120 Ga0495650_0022091 3300046471 Bacteria 3058
121 Ga0495605_0000148 3300046474 Bacteria 90877
122 Ga0495605_0002755 3300046474 Bacteria 10731
123 Ga0495605_0010497 3300046474 Bacteria 5180
124 Ga0495605_0018105 3300046474 Bacteria 3782
125 Ga0495639_0073316 3300046475 Bacteria 1585
126 Ga0495584_0028391 3300046491 Bacteria 2835
127 Ga0495584_0071113 3300046491 Bacteria 1748
128 Ga0495585_0007857 3300046492 Bacteria 6489
129 Ga0495594_0001248 3300046499 Bacteria 13335
130 Ga0495607_0000047 3300046501 Bacteria 121696
131 Ga0495607_0001338 3300046501 Bacteria 21995
132 Ga0495607_0001437 3300046501 Bacteria 21228
133 Ga0495607_0006062 3300046501 Bacteria 8561
134 Ga0495607_0048013 3300046501 Bacteria 2497
135 Ga0495607_0108435 3300046501 Bacteria 1475
136 Ga0495583_0000021 3300046506 Bacteria 287046
137 Ga0495583_0000606 3300046506 Bacteria 48615
138 Ga0495583_0003911 3300046506 Bacteria 11025
139 Ga0495606_0000043 3300046507 Bacteria 214367
140 Ga0495606_0000713 3300046507 Bacteria 51369
141 Ga0495606_0000972 3300046507 Bacteria 41909
142 Ga0495606_0002409 3300046507 Bacteria 21851
143 Ga0495606_0002464 3300046507 Bacteria 21461
144 Ga0495606_0005955 3300046507 Bacteria 11442
145 Ga0495606_0015819 3300046507 Bacteria 5788
146 Ga0495606_0066785 3300046507 Bacteria 2279
147 Ga0495610_0002408 3300046512 Bacteria 15754
148 Ga0495610_0003661 3300046512 Bacteria 11825
149 Ga0495610_0024117 3300046512 Bacteria 3288
150 Ga0495610_0024943 3300046512 Bacteria 3219
151 Ga0495610_0045187 3300046512 Bacteria 2180
152 Ga0495610_0056986 3300046512 Bacteria 1876
153 Ga0495616_0000150 3300046513 Bacteria 60876
154 Ga0495616_0007406 3300046513 Bacteria 6567
155 Ga0495616_0207120 3300046513 Bacteria 859
156 Ga0495620_0005152 3300046515 Bacteria 7317
157 Ga0495628_0035202 3300046516 Bacteria 4025
158 Ga0495631_0000337 3300046518 Bacteria 32281
159 Ga0495632_0005519 3300046519 Bacteria 8344
160 Ga0495632_0035275 3300046519 Bacteria 2554
161 Ga0495637_0004374 3300046520 Bacteria 7328
162 Ga0495637_0078507 3300046520 Bacteria 1319
163 Ga0495637_0142034 3300046520 Bacteria 910
164 Ga0495643_0000134 3300046522 Bacteria 119143
165 Ga0495643_0000182 3300046522 Bacteria 100196
166 Ga0495643_0000496 3300046522 Bacteria 49653
167 Ga0495644_0000347 3300046523 Bacteria 21047
168 Ga0495644_0011918 3300046523 Bacteria 3343
169 Ga0495648_0000084 3300046524 Bacteria 120611
170 Ga0495648_0000326 3300046524 Bacteria 52532
171 Ga0495648_0021064 3300046524 Bacteria 4526
172 Ga0495648_0049194 3300046524 Bacteria 2586
173 Ga0495663_0178262 3300046525 Bacteria 735
174 Ga0495654_0001816 3300046530 Bacteria 14212
175 Ga0495609_0012432 3300046538 Bacteria 4038
176 Ga0495609_0048693 3300046538 Bacteria 1893
177 Ga0495609_0075077 3300046538 Bacteria 1482
178 Ga0495597_0000022 3300046542 Bacteria 150986
179 Ga0495597_0000339 3300046542 Bacteria 41939
180 Ga0495622_0000454 3300046557 Bacteria 26304
181 Ga0495622_0020962 3300046557 Bacteria 3043
182 Ga0495633_0000113 3300046558 Bacteria 109307
183 Ga0495633_0000421 3300046558 Bacteria 44029
184 Ga0495633_0006119 3300046558 Bacteria 7205
185 Ga0495656_0003608 3300046615 Bacteria 5243
186 Ga0495656_0037932 3300046615 Unclassified 1993
187 Ga0495668_0000369 3300046616 Bacteria 59509
188 Ga0495668_0096415 3300046616 Bacteria 1618
189 Ga0495668_0290331 3300046616 Bacteria 896
190 Ga0495611_0002187 3300046648 Bacteria 9108
191 Ga0495611_0009567 3300046648 Bacteria 4094
192 Ga0495625_0004936 3300046660 Bacteria 12404
193 Ga0495625_0008678 3300046660 Bacteria 8634
194 Ga0495625_0069717 3300046660 Bacteria 2469
195 Ga0495625_0181743 3300046660 Bacteria 1398
196 Ga0495625_0298642 3300046660 Bacteria 1031
197 Ga0495659_0000414 3300046664 Bacteria 16287
198 Ga0495661_0001046 3300046665 Bacteria 24531
199 Ga0495661_0093228 3300046665 Bacteria 1709
200 Ga0495661_0135001 3300046665 Bacteria 1348
201 Ga0495588_0125226 3300046674 Bacteria 1355
202 Ga0495624_0117803 3300046690 Bacteria 1632
203 Ga0495670_0003476 3300046691 Bacteria 7737
204 Ga0495670_0006733 3300046691 Bacteria 5653
205 Ga0495671_0000374 3300046692 Bacteria 36687
206 Ga0495671_0008605 3300046692 Bacteria 5731
207 Ga0495671_0012309 3300046692 Bacteria 4676
208 Ga0495649_0121150 3300046694 Bacteria 1383
209 Ga0495649_0134243 3300046694 Bacteria 1305
210 Ga0495649_0150880 3300046694 Bacteria 1221
211 Ga0495589_0000046 3300046794 Bacteria 122544
212 Ga0495660_0000040 3300046810 Bacteria 172614
213 Ga0495660_0011935 3300046810 Bacteria 5039
214 Ga0495660_0068430 3300046810 Bacteria 1889
215 Ga0495636_0000430 3300047318 Bacteria 15568
216 Ga0495672_0000154 3300047320 Bacteria 100095
217 Ga0495672_0003962 3300047320 Bacteria 12393
218 Ga0495672_0010999 3300047320 Bacteria 6411
219 Ga0495672_0059185 3300047320 Bacteria 2217
220 Ga0495672_0133779 3300047320 Bacteria 1302
221 Ga0495683_0000006 3300047323 Bacteria 272409
222 Ga0495683_0000479 3300047323 Bacteria 31100
223 Ga0495683_0001547 3300047323 Bacteria 14899
224 Ga0495683_0007540 3300047323 Bacteria 5871
225 Ga0495683_0010325 3300047323 Bacteria 4940
226 Ga0495687_000100 3300047443 Bacteria 130324
227 Ga0495687_000245 3300047443 Bacteria 73990
228 Ga0495687_002038 3300047443 Bacteria 17054
229 Ga0495677_0000371 3300047445 Bacteria 19395
230 Ga0495677_0002770 3300047445 Bacteria 6835
231 Ga0495677_0088854 3300047445 Bacteria 1163
232 Ga0495679_004903 3300047446 Bacteria 6040
233 Ga0495685_000045 3300047447 Bacteria 50520
234 Ga0495673_0000997 3300047469 Bacteria 25163
235 Ga0495673_0006271 3300047469 Bacteria 7013
236 Ga0495673_0012864 3300047469 Bacteria 4414
237 Ga0495673_0082410 3300047469 Bacteria 1330
238 Ga0495673_0156584 3300047469 Unclassified 877
239 Ga0495681_0001998 3300047470 Bacteria 14903
240 Ga0495686_0000143 3300047472 Bacteria 143037
241 Ga0495686_0002474 3300047472 Bacteria 17399
242 Ga0495686_0004696 3300047472 Bacteria 11081
243 Ga0495626_0000328 3300048091 Bacteria 50162
244 Ga0495626_0023261 3300048091 Bacteria 3054
245 Ga0495626_0033078 3300048091 Bacteria 2479
246 Ga0496117_0125211 3300048920 Bacteria 1570
247 Ga0496118_0001619 3300048921 Bacteria 33260
248 Ga0496121_0000987 3300048924 Bacteria 50954
249 Ga0496121_0085346 3300048924 Unclassified 2486
250 Ga0496121_0105606 3300048924 Bacteria 2161
251 Ga0496121_0414871 3300048924 Bacteria 878
252 Ga0496122_0001360 3300048925 Bacteria 39792
253 Ga0496123_0000262 3300048926 Bacteria 106366
254 Ga0496123_0005973 3300048926 Bacteria 11981
255 Ga0496123_0050585 3300048926 Bacteria 2775
256 Ga0496124_0054122 3300048927 Bacteria 3398
257 Ga0495678_000060 3300049459 Bacteria 142851
258 Ga0495678_000301 3300049459 Bacteria 53830
259 Ga0495678_008053 3300049459 Bacteria 5374
260 Ga0495678_011142 3300049459 Bacteria 4321
261 Ga0495682_0000035 3300049460 Bacteria 126349
262 Ga0495682_0000416 3300049460 Bacteria 30208
263 Ga0495682_0003421 3300049460 Bacteria 7058
264 Ga0501238_000911 3300049671 Bacteria 3373
265 nmdc:mga03683_36921_c1 3300050489 Bacteria 1989
266 nmdc:mga0k408_25746_c1 3300050493 Bacteria 3334
267 nmdc:mga0k408_413832_c1 3300050493 Bacteria 802
268 nmdc:mga0k408_5843_c1 3300050493 Bacteria 6557
269 nmdc:mga0k408_79922_c1 3300050493 Bacteria 1913
270 nmdc:mga07m45_10302_c1 3300050496 Bacteria 4878
271 nmdc:mga0sz30_13469_c2 3300050516 Bacteria 1558
272 nmdc:mga0sz30_55483_c1 3300050516 Bacteria 1686
273 Ga0500610_0212487 3300053079 Bacteria 923
274 Ga0500578_0078290 3300053086 Bacteria 2104
275 Ga0500643_000042 3300053087 Bacteria 158933
276 Ga0500644_0001702 3300053088 Bacteria 5728
277 Ga0500646_0026175 3300053090 Bacteria 1580
278 Ga0500583_0018820 3300053092 Bacteria 2816
279 Ga0500583_0238014 3300053092 Unclassified 900
280 Ga0500651_0012504 3300053093 Bacteria 5148
281 Ga0500651_0036165 3300053093 Bacteria 3112
282 Ga0500651_0073966 3300053093 Bacteria 2117
283 Ga0500651_0078415 3300053093 Bacteria 2048
284 Ga0500566_0109159 3300053094 Bacteria 1506
285 Ga0500650_0171711 3300053098 Bacteria 996
286 Ga0500555_002881 3300053103 Bacteria 4927
287 Ga0500569_003912 3300053109 Bacteria 3089
288 Ga0500569_006588 3300053109 Bacteria 2558
289 Ga0500592_003805 3300053116 Bacteria 2410
290 Ga0500593_000704 3300053117 Bacteria 12741
291 Ga0500594_0007848 3300053118 Bacteria 2421
292 Ga0500594_0091148 3300053118 Bacteria 926
293 Ga0500607_033969 3300053121 Bacteria 2793
294 Ga0500614_006547 3300053123 Bacteria 2447
295 Ga0500618_000087 3300053125 Bacteria 75294
296 Ga0500618_001006 3300053125 Bacteria 14215
297 Ga0500642_0006472 3300053130 Bacteria 3861
298 Ga0500652_000076 3300053131 Bacteria 42942
299 Ga0500655_048755 3300053133 Bacteria 841
300 Ga0500658_0129383 3300053134 Bacteria 1125
301 Ga0500559_0004128 3300053136 Bacteria 6963
302 Ga0500559_0053457 3300053136 Bacteria 1788
303 Ga0500559_0147933 3300053136 Bacteria 1102
304 Ga0500568_0009262 3300053139 Bacteria 4692
305 Ga0500568_0048748 3300053139 Bacteria 1673
306 Ga0500588_0036517 3300053146 Bacteria 1454
307 Ga0500588_0066251 3300053146 Bacteria 1172
308 Ga0500604_0004357 3300053151 Bacteria 3761
309 Ga0500604_0020265 3300053151 Bacteria 1870
310 Ga0500604_0032683 3300053151 Bacteria 1534
311 Ga0500619_032605 3300053154 Bacteria 1598
312 Ga0500622_0000236 3300053156 Bacteria 57393
313 Ga0500622_0039202 3300053156 Bacteria 2470
314 Ga0500627_0015672 3300053158 Bacteria 2937
315 Ga0500636_0007385 3300053177 Bacteria 6356
316 Ga0500601_000355 3300053737 Bacteria 8336

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2582581279 2585147861 210
2 iso_pu_bacteria 2600255283 2601624116 210
3 iso_pu_bacteria 2878029506 2878030501 210
4 iso_pu_bacteria 2821131069 2821131685 213
5 iso_pu_bacteria 2857558681 2857560256 213
6 3300009011 Ga0105251_10000884 Ga0105251_1000088412 214
7 3300013306 Ga0163162_10282744 Ga0163162_102827443 214
8 3300015262 Ga0182007_10002879 Ga0182007_100028795 214
9 3300017792 Ga0163161_10070969 Ga0163161_100709694 214
10 3300025735 Ga0207713_1000705 Ga0207713_100070512 214
11 3300031548 Ga0307408_100276554 Ga0307408_1002765541 214
12 3300032004 Ga0307414_10104166 Ga0307414_101041663 214
13 3300041405 Ga0439438_000450 Ga0439438_000450_3210_3854 214
14 3300041407 Ga0439447_015924 Ga0439447_015924_1367_2011 214
15 3300041411 Ga0439466_0009809 Ga0439466_0009809_2383_3027 214
16 3300042006 Ga0439432_000556 Ga0439432_000556_3257_3901 214
17 3300042006 Ga0439432_017976 Ga0439432_017976_971_1615 214
18 3300042009 Ga0439451_000424 Ga0439451_000424_2787_3431 214
19 3300042010 Ga0439452_001012 Ga0439452_001012_408_1052 214
20 3300042010 Ga0439452_009334 Ga0439452_009334_746_1390 214
21 3300042115 Ga0450911_003919 Ga0450911_003919_302_946 214
22 3300042142 Ga0450905_000011 Ga0450905_000011_7526_8170 214
23 3300046452 Ga0495617_024900 Ga0495617_024900_1175_1819 214
24 3300046453 Ga0495627_113245 Ga0495627_113245_50_694 214
25 3300046458 Ga0495591_018723 Ga0495591_018723_1145_1789 214
26 3300046460 Ga0495638_0018793 Ga0495638_0018793_543_1187 214
27 3300046471 Ga0495650_0022091 Ga0495650_0022091_1638_2282 214
28 3300046474 Ga0495605_0002755 Ga0495605_0002755_2714_3358 214
29 3300046474 Ga0495605_0010497 Ga0495605_0010497_4205_4849 214
30 3300046475 Ga0495639_0073316 Ga0495639_0073316_121_765 214
31 3300046491 Ga0495584_0071113 Ga0495584_0071113_353_997 214
32 3300046499 Ga0495594_0001248 Ga0495594_0001248_11027_11671 214
33 3300046501 Ga0495607_0000047 Ga0495607_0000047_114909_115553 214
34 3300046501 Ga0495607_0001437 Ga0495607_0001437_19709_20353 214
35 3300046501 Ga0495607_0006062 Ga0495607_0006062_2658_3302 214
36 3300046501 Ga0495607_0048013 Ga0495607_0048013_352_996 214
37 3300046507 Ga0495606_0005955 Ga0495606_0005955_4456_5100 214
38 3300046507 Ga0495606_0015819 Ga0495606_0015819_3374_4018 214
39 3300046512 Ga0495610_0056986 Ga0495610_0056986_1036_1680 214
40 3300046513 Ga0495616_0007406 Ga0495616_0007406_2385_3029 214
41 3300046515 Ga0495620_0005152 Ga0495620_0005152_5207_5851 214
42 3300046519 Ga0495632_0035275 Ga0495632_0035275_1612_2256 214
43 3300046520 Ga0495637_0078507 Ga0495637_0078507_458_1102 214
44 3300046520 Ga0495637_0142034 Ga0495637_0142034_217_861 214
45 3300046524 Ga0495648_0021064 Ga0495648_0021064_1946_2590 214
46 3300046530 Ga0495654_0001816 Ga0495654_0001816_3470_4114 214
47 3300046538 Ga0495609_0048693 Ga0495609_0048693_1238_1882 214
48 3300046557 Ga0495622_0020962 Ga0495622_0020962_821_1465 214
49 3300046558 Ga0495633_0006119 Ga0495633_0006119_1129_1773 214
50 3300046660 Ga0495625_0004936 Ga0495625_0004936_3982_4626 214
51 3300046665 Ga0495661_0093228 Ga0495661_0093228_818_1462 214
52 3300046674 Ga0495588_0125226 Ga0495588_0125226_469_1113 214
53 3300046691 Ga0495670_0003476 Ga0495670_0003476_2716_3360 214
54 3300046692 Ga0495671_0008605 Ga0495671_0008605_2412_3056 214
55 3300046694 Ga0495649_0134243 Ga0495649_0134243_481_1125 214
56 3300046810 Ga0495660_0068430 Ga0495660_0068430_516_1160 214
57 3300047320 Ga0495672_0059185 Ga0495672_0059185_870_1514 214
58 3300047320 Ga0495672_0133779 Ga0495672_0133779_85_729 214
59 3300047323 Ga0495683_0000006 Ga0495683_0000006_270777_271421 214
60 3300047323 Ga0495683_0000479 Ga0495683_0000479_5420_6064 214
61 3300047469 Ga0495673_0000997 Ga0495673_0000997_6664_7308 214
62 3300047469 Ga0495673_0006271 Ga0495673_0006271_5473_6117 214
63 3300047469 Ga0495673_0156584 Ga0495673_0156584_148_792 214
64 3300047470 Ga0495681_0001998 Ga0495681_0001998_3345_3989 214
65 3300048924 Ga0496121_0000987 Ga0496121_0000987_28396_29040 214
66 3300048924 Ga0496121_0105606 Ga0496121_0105606_1457_2101 214
67 3300049460 Ga0495682_0003421 Ga0495682_0003421_5784_6428 214
68 3300049671 Ga0501238_000911 Ga0501238_000911_851_1495 214
69 3300046460 Ga0495638_0000301 Ga0495638_0000301_1187_1834 215
70 3300047446 Ga0495679_004903 Ga0495679_004903_5053_5700 215
71 3300005262 Ga0065165_1002832 Ga0065165_100283211 216
72 3300025728 Ga0207655_1030989 Ga0207655_10309893 216
73 3300028794 Ga0307515_10083127 Ga0307515_100831274 216
74 3300046452 Ga0495617_000888 Ga0495617_000888_13001_13651 216
75 3300046452 Ga0495617_124665 Ga0495617_124665_31_681 216
76 3300046457 Ga0495590_0000004 Ga0495590_0000004_286106_286756 216
77 3300046460 Ga0495638_0000023 Ga0495638_0000023_337433_338083 216
78 3300046460 Ga0495638_0012644 Ga0495638_0012644_4828_5478 216
79 3300046471 Ga0495650_0000169 Ga0495650_0000169_83770_84420 216
80 3300046471 Ga0495650_0001357 Ga0495650_0001357_22921_23571 216
81 3300046501 Ga0495607_0001338 Ga0495607_0001338_5742_6392 216
82 3300046506 Ga0495583_0000606 Ga0495583_0000606_23049_23699 216
83 3300046507 Ga0495606_0000972 Ga0495606_0000972_36321_36971 216
84 3300046507 Ga0495606_0002464 Ga0495606_0002464_18187_18837 216
85 3300046512 Ga0495610_0002408 Ga0495610_0002408_3230_3880 216
86 3300046512 Ga0495610_0024117 Ga0495610_0024117_2552_3202 216
87 3300046520 Ga0495637_0004374 Ga0495637_0004374_6275_6925 216
88 3300046522 Ga0495643_0000182 Ga0495643_0000182_15300_15950 216
89 3300046522 Ga0495643_0000496 Ga0495643_0000496_24307_24957 216
90 3300046524 Ga0495648_0000084 Ga0495648_0000084_94981_95631 216
91 3300046524 Ga0495648_0049194 Ga0495648_0049194_955_1605 216
92 3300046538 Ga0495609_0075077 Ga0495609_0075077_135_785 216
93 3300046542 Ga0495597_0000022 Ga0495597_0000022_125621_126271 216
94 3300046542 Ga0495597_0000339 Ga0495597_0000339_27709_28359 216
95 3300046557 Ga0495622_0000454 Ga0495622_0000454_2606_3256 216
96 3300046558 Ga0495633_0000113 Ga0495633_0000113_78478_79149 216
97 3300046558 Ga0495633_0000421 Ga0495633_0000421_2624_3274 216
98 3300046616 Ga0495668_0000369 Ga0495668_0000369_41841_42491 216
99 3300046692 Ga0495671_0000374 Ga0495671_0000374_34839_35489 216
100 3300046694 Ga0495649_0150880 Ga0495649_0150880_497_1147 216
101 3300046810 Ga0495660_0011935 Ga0495660_0011935_3204_3854 216
102 3300047320 Ga0495672_0000154 Ga0495672_0000154_15297_15947 216
103 3300047443 Ga0495687_002038 Ga0495687_002038_5431_6081 216
104 3300047445 Ga0495677_0088854 Ga0495677_0088854_184_834 216
105 3300048924 Ga0496121_0414871 Ga0496121_0414871_73_723 216
106 3300048926 Ga0496123_0005973 Ga0496123_0005973_4598_5248 216
107 3300048927 Ga0496124_0054122 Ga0496124_0054122_2148_2798 216
108 3300049459 Ga0495678_000301 Ga0495678_000301_39833_40483 216
109 3300049459 Ga0495678_011142 Ga0495678_011142_1075_1725 216
110 3300050489 nmdc:mga03683_36921_c1 nmdc:mga03683_36921_c1_95_745 216
111 3300053118 Ga0500594_0007848 Ga0500594_0007848_1250_1900 216
112 3300053118 Ga0500594_0091148 Ga0500594_0091148_157_807 216
113 3300005327 Ga0070658_10140789 Ga0070658_101407893 217
114 3300013306 Ga0163162_10042922 Ga0163162_100429226 217
115 3300017792 Ga0163161_10228047 Ga0163161_102280472 217
116 3300046507 Ga0495606_0000713 Ga0495606_0000713_12017_12670 217
117 3300046507 Ga0495606_0002409 Ga0495606_0002409_15007_15660 217
118 3300046512 Ga0495610_0045187 Ga0495610_0045187_472_1125 217
119 3300046516 Ga0495628_0035202 Ga0495628_0035202_2378_3031 217
120 3300047472 Ga0495686_0000143 Ga0495686_0000143_74472_75131 217
121 3300031731 Ga0307405_10268722 Ga0307405_102687222 218
122 3300047320 Ga0495672_0010999 Ga0495672_0010999_5306_5965 218
123 3300046457 Ga0495590_0045119 Ga0495590_0045119_831_1499 222
124 3300046460 Ga0495638_0002285 Ga0495638_0002285_9338_10006 222
125 3300046474 Ga0495605_0018105 Ga0495605_0018105_1293_1961 222
126 3300046491 Ga0495584_0028391 Ga0495584_0028391_1973_2641 222
127 3300046492 Ga0495585_0007857 Ga0495585_0007857_5214_5882 222
128 3300046501 Ga0495607_0108435 Ga0495607_0108435_772_1440 222
129 3300046506 Ga0495583_0000021 Ga0495583_0000021_263243_263911 222
130 3300046523 Ga0495644_0000347 Ga0495644_0000347_19912_20580 222
131 3300046524 Ga0495648_0000326 Ga0495648_0000326_50922_51590 222
132 3300046525 Ga0495663_0178262 Ga0495663_0178262_30_698 222
133 3300046538 Ga0495609_0012432 Ga0495609_0012432_2428_3096 222
134 3300046615 Ga0495656_0003608 Ga0495656_0003608_468_1136 222
135 3300046615 Ga0495656_0037932 Ga0495656_0037932_1244_1912 222
136 3300046648 Ga0495611_0009567 Ga0495611_0009567_468_1136 222
137 3300046660 Ga0495625_0069717 Ga0495625_0069717_1532_2200 222
138 3300046664 Ga0495659_0000414 Ga0495659_0000414_2269_2937 222
139 3300046691 Ga0495670_0006733 Ga0495670_0006733_1080_1748 222
140 3300046692 Ga0495671_0012309 Ga0495671_0012309_3447_4115 222
141 3300047318 Ga0495636_0000430 Ga0495636_0000430_5755_6423 222
142 3300047323 Ga0495683_0001547 Ga0495683_0001547_11428_12096 222
143 3300047443 Ga0495687_000245 Ga0495687_000245_53764_54432 222
144 3300047445 Ga0495677_0002770 Ga0495677_0002770_5192_5860 222
145 3300047447 Ga0495685_000045 Ga0495685_000045_6136_6804 222
146 3300049459 Ga0495678_008053 Ga0495678_008053_135_803 222
147 3300049460 Ga0495682_0000416 Ga0495682_0000416_837_1505 222
148 3300053093 Ga0500651_0078415 Ga0500651_0078415_85_753 222
149 3300053130 Ga0500642_0006472 Ga0500642_0006472_1775_2443 222
150 3300053146 Ga0500588_0066251 Ga0500588_0066251_316_984 222
151 3300053136 Ga0500559_0004128 Ga0500559_0004128_5685_6371 223
152 iso_pu_bacteria 2511231003 2511250408 224
153 iso_pu_bacteria 2582581299 2585233142 224
154 iso_pu_bacteria 2585428057 2587727633 224
155 iso_pu_bacteria 2585428058 2587733007 224
156 iso_pu_bacteria 2724679232 2725949704 224
157 iso_pu_bacteria 2738541293 2738805476 224
158 iso_pu_bacteria 2802429634 2806055798 224
159 iso_pu_bacteria 2802429635 2806061247 224
160 iso_pu_bacteria 2818991445 2819591690 224
161 iso_pu_bacteria 2818991449 2819615826 224
162 iso_pu_bacteria 2818991461 2819687556 224
163 iso_pu_bacteria 2821123053 2821130825 224
164 iso_pu_bacteria 2842110456 2842113906 224
165 iso_pu_bacteria 2919046199 2919047919 224
166 iso_pu_bacteria 2933586486 2933589458 224
167 iso_pu_bacteria 8024486573 8024493110 224
168 3300006178 Ga0075367_10431914 Ga0075367_104319141 225
169 3300003752 Ga0055539_1000955 Ga0055539_10009558 227
170 3300025253 Ga0209677_100060 Ga0209677_10006074 227
171 3300047472 Ga0495686_0004696 Ga0495686_0004696_7012_7698 227
172 3300053090 Ga0500646_0026175 Ga0500646_0026175_84_767 227
173 3300002704 JGI25155J39150_1000109 JGI25155J39150_100010937 228
174 3300002705 JGI25156J39149_1000106 JGI25156J39149_100010612 228
175 3300002705 JGI25156J39149_1002595 JGI25156J39149_10025952 228
176 3300002738 JGI25154J39366_1000038 JGI25154J39366_100003862 228
177 3300002738 JGI25154J39366_1000128 JGI25154J39366_100012812 228
178 3300002741 JGI25157J39369_1000676 JGI25157J39369_100067614 228
179 3300002774 JGI25150J39212_1002809 JGI25150J39212_10028094 228
180 3300003187 JGI25151J46595_10043502 JGI25151J46595_100435022 228
181 3300003758 Ga0055532_1000023 Ga0055532_1000023101 228
182 3300003761 Ga0055535_1004221 Ga0055535_10042212 228
183 3300005364 Ga0070673_100205668 Ga0070673_1002056682 228
184 3300005455 Ga0070663_100103172 Ga0070663_1001031722 228
185 3300005577 Ga0068857_100013617 Ga0068857_1000136173 228
186 3300005614 Ga0068856_101052905 Ga0068856_1010529051 228
187 3300006048 Ga0075363_100142055 Ga0075363_1001420552 228
188 3300006177 Ga0075362_10095870 Ga0075362_100958702 228
189 3300006186 Ga0075369_10030492 Ga0075369_100304923 228
190 3300006195 Ga0075366_10001229 Ga0075366_100012293 228
191 3300006195 Ga0075366_10096954 Ga0075366_100969541 228
192 3300006353 Ga0075370_10024576 Ga0075370_100245763 228
193 3300009093 Ga0105240_10007957 Ga0105240_1000795714 228
194 3300009093 Ga0105240_10154449 Ga0105240_101544492 228
195 3300009148 Ga0105243_10303498 Ga0105243_103034982 228
196 3300009545 Ga0105237_10119545 Ga0105237_101195452 228
197 3300010375 Ga0105239_10145365 Ga0105239_101453651 228
198 3300013306 Ga0163162_10220698 Ga0163162_102206982 228
199 3300017792 Ga0163161_10044182 Ga0163161_100441824 228
200 3300025206 Ga0209435_100013 Ga0209435_100013216 228
201 3300025206 Ga0209435_100131 Ga0209435_1001318 228
202 3300025229 Ga0209147_100030 Ga0209147_100030139 228
203 3300025242 Ga0209258_100429 Ga0209258_10042924 228
204 3300025245 Ga0207425_1003391 Ga0207425_10033916 228
205 3300025246 Ga0209646_1000034 Ga0209646_1000034216 228
206 3300025246 Ga0209646_1000155 Ga0209646_100015562 228
207 3300025250 Ga0209026_1000022 Ga0209026_1000022216 228
208 3300025250 Ga0209026_1001247 Ga0209026_100124712 228
209 3300025256 Ga0209759_1000018 Ga0209759_1000018216 228
210 3300025256 Ga0209759_1000375 Ga0209759_100037551 228
211 3300025258 Ga0209129_1018704 Ga0209129_10187042 228
212 3300025263 Ga0209565_1004917 Ga0209565_10049174 228
213 3300025272 Ga0209455_1005934 Ga0209455_10059345 228
214 3300025294 Ga0209025_1039763 Ga0209025_10397634 228
215 3300025299 Ga0209256_1018872 Ga0209256_10188721 228
216 3300025303 Ga0209051_1018612 Ga0209051_10186123 228
217 3300025913 Ga0207695_10002671 Ga0207695_1000267113 228
218 3300025913 Ga0207695_10252121 Ga0207695_102521212 228
219 3300025960 Ga0207651_10153714 Ga0207651_101537141 228
220 3300026116 Ga0207674_10032960 Ga0207674_100329603 228
221 3300026116 Ga0207674_10581832 Ga0207674_105818321 228
222 3300026118 Ga0207675_100000041 Ga0207675_1000000416 228
223 3300031507 Ga0307509_10425165 Ga0307509_104251651 228
224 3300031731 Ga0307405_10091030 Ga0307405_100910302 228
225 3300031911 Ga0307412_10005928 Ga0307412_100059284 228
226 3300033180 Ga0307510_10105668 Ga0307510_101056684 228
227 3300035691 Ga0373931_0006607 Ga0373931_0006607_903_1589 228
228 3300041413 Ga0439465_0009028 Ga0439465_0009028_145_831 228
229 3300041443 Ga0451789_0620400 Ga0451789_0620400_1228_1929 228
230 3300041458 Ga0451798_0315603 Ga0451798_0315603_726_1427 228
231 3300041459 Ga0451800_0782159 Ga0451800_0782159_47_748 228
232 3300041460 Ga0451802_1222012 Ga0451802_1222012_1020_1721 228
233 3300041486 Ga0451807_1172974 Ga0451807_1172974_945_1646 228
234 3300041491 Ga0451833_1351731 Ga0451833_1351731_893_1579 228
235 3300041492 Ga0451835_0281586 Ga0451835_0281586_1149_1835 228
236 3300041494 Ga0451837_1739032 Ga0451837_1739032_742_1428 228
237 3300041496 Ga0451839_0436899 Ga0451839_0436899_614_1300 228
238 3300041498 Ga0451841_0511162 Ga0451841_0511162_458_1144 228
239 3300041501 Ga0451845_0127159 Ga0451845_0127159_1068_1754 228
240 3300041503 Ga0451847_0529332 Ga0451847_0529332_1068_1754 228
241 3300041505 Ga0451849_0316777 Ga0451849_0316777_514_1200 228
242 3300041507 Ga0451851_1003024 Ga0451851_1003024_969_1655 228
243 3300041509 Ga0451843_0146066 Ga0451843_0146066_751_1437 228
244 3300041511 Ga0451855_0279592 Ga0451855_0279592_969_1757 228
245 3300041512 Ga0451853_0222309 Ga0451853_0222309_708_1394 228
246 3300041512 Ga0451853_0647994 Ga0451853_0647994_292_993 228
247 3300041512 Ga0451853_0911215 Ga0451853_0911215_391_1077 228
248 3300046457 Ga0495590_0026469 Ga0495590_0026469_593_1279 228
249 3300046460 Ga0495638_0000629 Ga0495638_0000629_34862_35548 228
250 3300046460 Ga0495638_0051019 Ga0495638_0051019_16_702 228
251 3300046474 Ga0495605_0000148 Ga0495605_0000148_73582_74268 228
252 3300046506 Ga0495583_0003911 Ga0495583_0003911_2862_3548 228
253 3300046507 Ga0495606_0000043 Ga0495606_0000043_76273_76959 228
254 3300046507 Ga0495606_0066785 Ga0495606_0066785_1206_1892 228
255 3300046512 Ga0495610_0003661 Ga0495610_0003661_5875_6561 228
256 3300046512 Ga0495610_0024943 Ga0495610_0024943_2330_3016 228
257 3300046513 Ga0495616_0000150 Ga0495616_0000150_10743_11429 228
258 3300046513 Ga0495616_0207120 Ga0495616_0207120_154_840 228
259 3300046518 Ga0495631_0000337 Ga0495631_0000337_14865_15551 228
260 3300046519 Ga0495632_0005519 Ga0495632_0005519_5256_5957 228
261 3300046522 Ga0495643_0000134 Ga0495643_0000134_100849_101535 228
262 3300046523 Ga0495644_0011918 Ga0495644_0011918_2454_3140 228
263 3300046616 Ga0495668_0096415 Ga0495668_0096415_747_1433 228
264 3300046616 Ga0495668_0290331 Ga0495668_0290331_169_855 228
265 3300046648 Ga0495611_0002187 Ga0495611_0002187_1766_2452 228
266 3300046660 Ga0495625_0008678 Ga0495625_0008678_5829_6515 228
267 3300046660 Ga0495625_0181743 Ga0495625_0181743_337_1023 228
268 3300046660 Ga0495625_0298642 Ga0495625_0298642_281_967 228
269 3300046665 Ga0495661_0001046 Ga0495661_0001046_6237_6923 228
270 3300046665 Ga0495661_0135001 Ga0495661_0135001_339_1025 228
271 3300046690 Ga0495624_0117803 Ga0495624_0117803_873_1559 228
272 3300046694 Ga0495649_0121150 Ga0495649_0121150_25_711 228
273 3300046794 Ga0495589_0000046 Ga0495589_0000046_34371_35057 228
274 3300046810 Ga0495660_0000040 Ga0495660_0000040_34850_35536 228
275 3300047320 Ga0495672_0003962 Ga0495672_0003962_6664_7350 228
276 3300047323 Ga0495683_0007540 Ga0495683_0007540_3380_4066 228
277 3300047323 Ga0495683_0010325 Ga0495683_0010325_3343_4029 228
278 3300047443 Ga0495687_000100 Ga0495687_000100_102727_103413 228
279 3300047445 Ga0495677_0000371 Ga0495677_0000371_8990_9676 228
280 3300047469 Ga0495673_0012864 Ga0495673_0012864_2945_3631 228
281 3300047469 Ga0495673_0082410 Ga0495673_0082410_43_729 228
282 3300047472 Ga0495686_0002474 Ga0495686_0002474_4448_5134 228
283 3300048091 Ga0495626_0000328 Ga0495626_0000328_48639_49325 228
284 3300048091 Ga0495626_0023261 Ga0495626_0023261_1512_2198 228
285 3300048091 Ga0495626_0033078 Ga0495626_0033078_59_745 228
286 3300048920 Ga0496117_0125211 Ga0496117_0125211_232_918 228
287 3300048921 Ga0496118_0001619 Ga0496118_0001619_11025_11711 228
288 3300048924 Ga0496121_0085346 Ga0496121_0085346_1712_2398 228
289 3300048925 Ga0496122_0001360 Ga0496122_0001360_38909_39595 228
290 3300048926 Ga0496123_0000262 Ga0496123_0000262_8797_9483 228
291 3300048926 Ga0496123_0050585 Ga0496123_0050585_1284_1970 228
292 3300049459 Ga0495678_000060 Ga0495678_000060_101867_102553 228
293 3300049460 Ga0495682_0000035 Ga0495682_0000035_75236_75922 228
294 3300050493 nmdc:mga0k408_25746_c1 nmdc:mga0k408_25746_c1_965_1651 228
295 3300050493 nmdc:mga0k408_413832_c1 nmdc:mga0k408_413832_c1_102_788 228
296 3300050493 nmdc:mga0k408_5843_c1 nmdc:mga0k408_5843_c1_1401_2087 228
297 3300050493 nmdc:mga0k408_79922_c1 nmdc:mga0k408_79922_c1_406_1092 228
298 3300050496 nmdc:mga07m45_10302_c1 nmdc:mga07m45_10302_c1_4081_4836 228
299 3300050516 nmdc:mga0sz30_13469_c2 nmdc:mga0sz30_13469_c2_711_1397 228
300 3300050516 nmdc:mga0sz30_55483_c1 nmdc:mga0sz30_55483_c1_448_1134 228
301 3300053079 Ga0500610_0212487 Ga0500610_0212487_227_913 228
302 3300053086 Ga0500578_0078290 Ga0500578_0078290_323_1009 228
303 3300053087 Ga0500643_000042 Ga0500643_000042_123983_124669 228
304 3300053088 Ga0500644_0001702 Ga0500644_0001702_4346_5032 228
305 3300053092 Ga0500583_0018820 Ga0500583_0018820_56_742 228
306 3300053092 Ga0500583_0238014 Ga0500583_0238014_24_713 228
307 3300053093 Ga0500651_0012504 Ga0500651_0012504_1319_2005 228
308 3300053093 Ga0500651_0036165 Ga0500651_0036165_2017_2703 228
309 3300053093 Ga0500651_0073966 Ga0500651_0073966_435_1136 228
310 3300053094 Ga0500566_0109159 Ga0500566_0109159_40_726 228
311 3300053098 Ga0500650_0171711 Ga0500650_0171711_200_901 228
312 3300053103 Ga0500555_002881 Ga0500555_002881_499_1185 228
313 3300053109 Ga0500569_003912 Ga0500569_003912_1883_2584 228
314 3300053109 Ga0500569_006588 Ga0500569_006588_1724_2410 228
315 3300053116 Ga0500592_003805 Ga0500592_003805_912_1598 228
316 3300053117 Ga0500593_000704 Ga0500593_000704_7782_8468 228
317 3300053121 Ga0500607_033969 Ga0500607_033969_1554_2240 228
318 3300053123 Ga0500614_006547 Ga0500614_006547_399_1085 228
319 3300053125 Ga0500618_000087 Ga0500618_000087_53367_54053 228
320 3300053125 Ga0500618_001006 Ga0500618_001006_12500_13186 228
321 3300053131 Ga0500652_000076 Ga0500652_000076_29503_30204 228
322 3300053133 Ga0500655_048755 Ga0500655_048755_20_706 228
323 3300053134 Ga0500658_0129383 Ga0500658_0129383_312_1013 228
324 3300053136 Ga0500559_0053457 Ga0500559_0053457_51_737 228
325 3300053136 Ga0500559_0147933 Ga0500559_0147933_104_790 228
326 3300053139 Ga0500568_0009262 Ga0500568_0009262_3317_4018 228
327 3300053139 Ga0500568_0048748 Ga0500568_0048748_80_766 228
328 3300053146 Ga0500588_0036517 Ga0500588_0036517_416_1102 228
329 3300053151 Ga0500604_0004357 Ga0500604_0004357_2171_2878 228
330 3300053151 Ga0500604_0020265 Ga0500604_0020265_467_1153 228
331 3300053151 Ga0500604_0032683 Ga0500604_0032683_347_1048 228
332 3300053154 Ga0500619_032605 Ga0500619_032605_209_895 228
333 3300053156 Ga0500622_0000236 Ga0500622_0000236_42620_43321 228
334 3300053156 Ga0500622_0039202 Ga0500622_0039202_44_730 228
335 3300053158 Ga0500627_0015672 Ga0500627_0015672_1151_1837 228
336 3300053177 Ga0500636_0007385 Ga0500636_0007385_181_867 228
337 3300053737 Ga0500601_000355 Ga0500601_000355_2375_3061 228
338 iso_pu_bacteria 2588253510 2588291310 228

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13410

GST_C_2

Glutathione S-transferase, C-terminal domain

131

203

0.93

PF14497

GST_C_3

Glutathione S-transferase, C-terminal domain

134

212

0.93

PF00043

GST_C

Glutathione S-transferase, C-terminal domain

123

208

0.91

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

1

77

0.91

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

10

78

0.91

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

4

83

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3erf-assembly1.cif.gz_A crystal structure of gtt2 from saccharomyces cerevisiae 0.9857 1 212
3erf-assembly1.cif.gz_A crystal structure of gtt2 from saccharomyces cerevisiae 0.9717 1 212
4n0v-assembly1.cif.gz_B crystal structure of a glutathione s-transferase domain-containing protein (marinobacter aquaeolei vt8), target efi-507332 0.9678 1 210
4n0v-assembly1.cif.gz_B crystal structure of a glutathione s-transferase domain-containing protein (marinobacter aquaeolei vt8), target efi-507332 0.9586 1 210
7miq-assembly1.cif.gz_B crystal structure of a glutathione s-transferase class gtt2 of vibrio parahaemolyticus (vpgstt2) 0.8887 1 217
ID Description Score Start End Superfamily
3erfA02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9759 84 207 1.20.1050.10
4n0vB02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9746 84 207 1.20.1050.10
3erfA02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9678 84 207 1.20.1050.10
4n0vB02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9665 84 207 1.20.1050.10
af_Q9SRY6_37_122_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9433 2 78 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A353R401-F1-model_v4 Glutathione S-transferase 0.9935 1 106 GO:0004364
GO:0006559
GO:0006749
GO:0016034
AF-A0A353PCR2-F1-model_v4 Glutathione S-transferase 0.9926 1 97 GO:0004364
GO:0006559
GO:0006749
GO:0016034
AF-A0A7X2MU45-F1-model_v4 Glutathione S-transferase 0.9903 2 83 GO:0004364
GO:0006559
GO:0006749
GO:0016034
AF-A0A849E844-F1-model_v4 Glutathione S-transferase 0.9898 1 125 GO:0005737
GO:0016740
AF-A0A7Z0I9C3-F1-model_v4 deleted 0.987 1 212

Feature Viewer

pLDDT pTM Quality
97.24 0.94 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map