F413574
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 338 | 201 | 338 | 157 |
Family's Representative Sequence
| Representative Sequence | 3300031711|Ga0265314_10130158|Ga0265314_101301582 |
| Length | 173 |
| Sequence | METEPEGRVALVLLSRASSVTKVNREGAPFDRRSFLDAVLAVGFVSTAAAIAYPVSRFLVPPASGEPITNSVVAAKVSALRPNSGLLFQFGTKPGIVVRTADGDVRAFSAVCTHLDCTVQFKSDTSQLWCACHNGTYDLAGNVVSGPPPRGLEQFSVNLRGEPGEEDIVVTRS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 2 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 4 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 7 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 22 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 31 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 33 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 34 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 36 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 37 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 38 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 39 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 40 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 41 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 42 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 46 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 47 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 48 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 49 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 50 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 51 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 53 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 111 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 115 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 116 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 117 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 118 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 119 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 120 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 121 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 122 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 123 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 124 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 125 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 126 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 127 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 128 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 129 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 130 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 131 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 132 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 133 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 134 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 135 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 136 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 137 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 138 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 139 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 140 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 141 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 142 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 143 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 144 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 145 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 146 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 147 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 148 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 178 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 179 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 180 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 181 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 182 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 183 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 184 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 185 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 186 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 187 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 188 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 189 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 190 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 191 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 192 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 193 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 194 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 195 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 196 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 197 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 198 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 201 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 4.44 |
| Rhizosphere | 95.56 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065712_10072310 | 3300005290 | Bacteria | 4802 |
| 2 | Ga0070676_10764848 | 3300005328 | Bacteria | 710 |
| 3 | Ga0070690_100327455 | 3300005330 | Bacteria | 1106 |
| 4 | Ga0070670_100071134 | 3300005331 | Bacteria | 2986 |
| 5 | Ga0070666_10038092 | 3300005335 | Bacteria | 3198 |
| 6 | Ga0068868_100108839 | 3300005338 | Bacteria | 2250 |
| 7 | Ga0068868_100169552 | 3300005338 | Bacteria | 1807 |
| 8 | Ga0070689_100026836 | 3300005340 | Bacteria | 4338 |
| 9 | Ga0070689_100120317 | 3300005340 | Bacteria | 2096 |
| 10 | Ga0070687_100167453 | 3300005343 | Bacteria | 1305 |
| 11 | Ga0070661_100849578 | 3300005344 | Unclassified | 751 |
| 12 | Ga0070669_100019422 | 3300005353 | Bacteria | 4853 |
| 13 | Ga0070671_100009153 | 3300005355 | Bacteria | 7949 |
| 14 | Ga0070674_101099591 | 3300005356 | Bacteria | 702 |
| 15 | Ga0070673_101604380 | 3300005364 | Unclassified | 615 |
| 16 | Ga0070688_100270799 | 3300005365 | Bacteria | 1216 |
| 17 | Ga0070688_100478635 | 3300005365 | Bacteria | 936 |
| 18 | Ga0070659_100403277 | 3300005366 | Bacteria | 1155 |
| 19 | Ga0070659_101072632 | 3300005366 | Unclassified | 709 |
| 20 | Ga0070667_100064930 | 3300005367 | Bacteria | 3098 |
| 21 | Ga0070694_101015407 | 3300005444 | Bacteria | 689 |
| 22 | Ga0070708_100020714 | 3300005445 | Bacteria | 5552 |
| 23 | Ga0070663_100757959 | 3300005455 | Bacteria | 829 |
| 24 | Ga0070662_100212508 | 3300005457 | Bacteria | 1540 |
| 25 | Ga0070662_100700830 | 3300005457 | Bacteria | 857 |
| 26 | Ga0070662_100996461 | 3300005457 | Bacteria | 717 |
| 27 | Ga0068867_101925458 | 3300005459 | Unclassified | 558 |
| 28 | Ga0070685_11037541 | 3300005466 | Viruses | 617 |
| 29 | Ga0070706_100263348 | 3300005467 | Bacteria | 1609 |
| 30 | Ga0070698_100999184 | 3300005471 | Unclassified | 784 |
| 31 | Ga0070672_100008704 | 3300005543 | Bacteria | 6962 |
| 32 | Ga0070686_100003183 | 3300005544 | Bacteria | 8988 |
| 33 | Ga0070686_100380268 | 3300005544 | Bacteria | 1069 |
| 34 | Ga0070686_100520047 | 3300005544 | Bacteria | 926 |
| 35 | Ga0070695_101254675 | 3300005545 | Bacteria | 611 |
| 36 | Ga0070696_100268210 | 3300005546 | Bacteria | 1297 |
| 37 | Ga0070665_100103841 | 3300005548 | Bacteria | 2845 |
| 38 | Ga0070665_100114854 | 3300005548 | Unclassified | 2695 |
| 39 | Ga0068855_100431947 | 3300005563 | Bacteria | 1439 |
| 40 | Ga0070664_100272863 | 3300005564 | Unclassified | 1524 |
| 41 | Ga0068857_100299674 | 3300005577 | Bacteria | 1482 |
| 42 | Ga0068854_100014840 | 3300005578 | Bacteria | 5143 |
| 43 | Ga0070702_100282731 | 3300005615 | Unclassified | 1140 |
| 44 | Ga0068859_100008196 | 3300005617 | Bacteria | 10598 |
| 45 | Ga0068859_100057495 | 3300005617 | Bacteria | 3918 |
| 46 | Ga0068859_100777784 | 3300005617 | Bacteria | 1046 |
| 47 | Ga0068859_101147290 | 3300005617 | Viruses | 855 |
| 48 | Ga0068864_100000964 | 3300005618 | Bacteria | 24139 |
| 49 | Ga0068861_100427796 | 3300005719 | Bacteria | 1181 |
| 50 | Ga0068861_100485155 | 3300005719 | Bacteria | 1114 |
| 51 | Ga0068863_100002434 | 3300005841 | Bacteria | 18486 |
| 52 | Ga0068863_100415252 | 3300005841 | Unclassified | 1318 |
| 53 | Ga0068863_101902101 | 3300005841 | Unclassified | 605 |
| 54 | Ga0068858_100061219 | 3300005842 | Bacteria | 3480 |
| 55 | Ga0068858_100236708 | 3300005842 | Unclassified | 1731 |
| 56 | Ga0068858_100718163 | 3300005842 | Unclassified | 973 |
| 57 | Ga0068858_100827883 | 3300005842 | Bacteria | 903 |
| 58 | Ga0068860_100531066 | 3300005843 | Bacteria | 1177 |
| 59 | Ga0068862_100010886 | 3300005844 | Bacteria | 7510 |
| 60 | Ga0068862_100224185 | 3300005844 | Bacteria | 1703 |
| 61 | Ga0068862_101441836 | 3300005844 | Unclassified | 693 |
| 62 | Ga0070717_10185085 | 3300006028 | Unclassified | 1817 |
| 63 | Ga0070712_100975580 | 3300006175 | Bacteria | 733 |
| 64 | Ga0097621_100183332 | 3300006237 | Bacteria | 1810 |
| 65 | Ga0068871_100257628 | 3300006358 | Unclassified | 1521 |
| 66 | Ga0068871_100575701 | 3300006358 | Unclassified | 1022 |
| 67 | Ga0068871_100752656 | 3300006358 | Unclassified | 896 |
| 68 | Ga0075428_101081714 | 3300006844 | Bacteria | 847 |
| 69 | Ga0075434_100024241 | 3300006871 | Bacteria | 5930 |
| 70 | Ga0075434_100572401 | 3300006871 | Unclassified | 1149 |
| 71 | Ga0075429_100815940 | 3300006880 | Bacteria | 817 |
| 72 | Ga0068865_100697704 | 3300006881 | Unclassified | 867 |
| 73 | Ga0075436_100151817 | 3300006914 | Bacteria | 1630 |
| 74 | Ga0075436_100383475 | 3300006914 | Unclassified | 1016 |
| 75 | Ga0097620_100008196 | 3300006931 | Bacteria | 10598 |
| 76 | Ga0097620_100057494 | 3300006931 | Bacteria | 3918 |
| 77 | Ga0097620_100777776 | 3300006931 | Bacteria | 1046 |
| 78 | Ga0097620_101147254 | 3300006931 | Viruses | 855 |
| 79 | Ga0075435_100009598 | 3300007076 | Bacteria | 7022 |
| 80 | Ga0075435_100049977 | 3300007076 | Bacteria | 3364 |
| 81 | Ga0075435_100232478 | 3300007076 | Bacteria | 1566 |
| 82 | Ga0105240_10139109 | 3300009093 | Unclassified | 2905 |
| 83 | Ga0111539_10082636 | 3300009094 | Unclassified | 3778 |
| 84 | Ga0111539_10090253 | 3300009094 | Unclassified | 3601 |
| 85 | Ga0111539_10373234 | 3300009094 | Bacteria | 1660 |
| 86 | Ga0111539_10754934 | 3300009094 | Bacteria | 1132 |
| 87 | Ga0105245_10791901 | 3300009098 | Bacteria | 986 |
| 88 | Ga0105245_11011142 | 3300009098 | Unclassified | 876 |
| 89 | Ga0114129_10735488 | 3300009147 | Bacteria | 1264 |
| 90 | Ga0105243_10223734 | 3300009148 | Bacteria | 1665 |
| 91 | Ga0105243_10654837 | 3300009148 | Bacteria | 1018 |
| 92 | Ga0105241_10136420 | 3300009174 | Bacteria | 1993 |
| 93 | Ga0105241_11113104 | 3300009174 | Unclassified | 744 |
| 94 | Ga0105242_10124624 | 3300009176 | Unclassified | 2216 |
| 95 | Ga0105242_10634704 | 3300009176 | Unclassified | 1037 |
| 96 | Ga0105242_10670710 | 3300009176 | Unclassified | 1011 |
| 97 | Ga0105248_10001088 | 3300009177 | Bacteria | 30070 |
| 98 | Ga0105248_10046363 | 3300009177 | Bacteria | 4871 |
| 99 | Ga0105248_10193581 | 3300009177 | Bacteria | 2291 |
| 100 | Ga0105248_10227530 | 3300009177 | Bacteria | 2099 |
| 101 | Ga0105248_10246039 | 3300009177 | Bacteria | 2013 |
| 102 | Ga0105248_10340604 | 3300009177 | Unclassified | 1688 |
| 103 | Ga0105248_10760241 | 3300009177 | Bacteria | 1094 |
| 104 | Ga0105248_11112561 | 3300009177 | Unclassified | 893 |
| 105 | Ga0105248_11222921 | 3300009177 | Bacteria | 849 |
| 106 | Ga0105248_11238787 | 3300009177 | Unclassified | 844 |
| 107 | Ga0105249_11243899 | 3300009553 | Unclassified | 816 |
| 108 | Ga0105249_12283851 | 3300009553 | Unclassified | 614 |
| 109 | Ga0105246_10545002 | 3300011119 | Bacteria | 993 |
| 110 | Ga0157374_10093938 | 3300013296 | Bacteria | 2865 |
| 111 | Ga0163162_10584008 | 3300013306 | Bacteria | 1244 |
| 112 | Ga0163162_11119240 | 3300013306 | Bacteria | 892 |
| 113 | Ga0163162_12609691 | 3300013306 | Unclassified | 581 |
| 114 | Ga0157372_11265341 | 3300013307 | Bacteria | 852 |
| 115 | Ga0157375_11266554 | 3300013308 | Unclassified | 866 |
| 116 | Ga0163163_10005329 | 3300014325 | Bacteria | 11110 |
| 117 | Ga0163163_10326328 | 3300014325 | Bacteria | 1589 |
| 118 | Ga0163163_10512134 | 3300014325 | Bacteria | 1262 |
| 119 | Ga0163163_10594670 | 3300014325 | Unclassified | 1170 |
| 120 | Ga0157380_11989104 | 3300014326 | Unclassified | 643 |
| 121 | Ga0157377_10043151 | 3300014745 | Bacteria | 2509 |
| 122 | Ga0157379_10032465 | 3300014968 | Bacteria | 4655 |
| 123 | Ga0157379_10050434 | 3300014968 | Bacteria | 3715 |
| 124 | Ga0157379_10096766 | 3300014968 | Bacteria | 2649 |
| 125 | Ga0157379_10706066 | 3300014968 | Unclassified | 947 |
| 126 | Ga0157379_12115171 | 3300014968 | Bacteria | 558 |
| 127 | Ga0157376_10449621 | 3300014969 | Bacteria | 1256 |
| 128 | Ga0207710_10008884 | 3300025900 | Bacteria | 4227 |
| 129 | Ga0207680_10027287 | 3300025903 | Bacteria | 3178 |
| 130 | Ga0207699_10126541 | 3300025906 | Bacteria | 1660 |
| 131 | Ga0207699_10543772 | 3300025906 | Unclassified | 842 |
| 132 | Ga0207654_10093241 | 3300025911 | Bacteria | 1841 |
| 133 | Ga0207654_10310552 | 3300025911 | Unclassified | 1075 |
| 134 | Ga0207695_11422531 | 3300025913 | Unclassified | 574 |
| 135 | Ga0207662_10455368 | 3300025918 | Bacteria | 875 |
| 136 | Ga0207652_11285491 | 3300025921 | Bacteria | 634 |
| 137 | Ga0207646_10650457 | 3300025922 | Unclassified | 944 |
| 138 | Ga0207646_10788605 | 3300025922 | Unclassified | 847 |
| 139 | Ga0207681_10004734 | 3300025923 | Bacteria | 8372 |
| 140 | Ga0207650_10214707 | 3300025925 | Bacteria | 1546 |
| 141 | Ga0207659_10000763 | 3300025926 | Bacteria | 19113 |
| 142 | Ga0207659_11269017 | 3300025926 | Bacteria | 633 |
| 143 | Ga0207687_11136805 | 3300025927 | Unclassified | 671 |
| 144 | Ga0207644_10028545 | 3300025931 | Bacteria | 3864 |
| 145 | Ga0207690_10258987 | 3300025932 | Bacteria | 1347 |
| 146 | Ga0207706_10390938 | 3300025933 | Unclassified | 1206 |
| 147 | Ga0207706_10451741 | 3300025933 | Bacteria | 1111 |
| 148 | Ga0207706_10483032 | 3300025933 | Bacteria | 1070 |
| 149 | Ga0207686_10598363 | 3300025934 | Unclassified | 867 |
| 150 | Ga0207709_10236476 | 3300025935 | Bacteria | 1326 |
| 151 | Ga0207709_10434310 | 3300025935 | Bacteria | 1011 |
| 152 | Ga0207709_10455729 | 3300025935 | Unclassified | 989 |
| 153 | Ga0207670_10042556 | 3300025936 | Bacteria | 2994 |
| 154 | Ga0207670_10181022 | 3300025936 | Bacteria | 1588 |
| 155 | Ga0207669_10208712 | 3300025937 | Bacteria | 1424 |
| 156 | Ga0207704_10211520 | 3300025938 | Bacteria | 1428 |
| 157 | Ga0207704_10311802 | 3300025938 | Bacteria | 1210 |
| 158 | Ga0207691_10012289 | 3300025940 | Bacteria | 8208 |
| 159 | Ga0207711_10022795 | 3300025941 | Bacteria | 5239 |
| 160 | Ga0207711_10089321 | 3300025941 | Bacteria | 2707 |
| 161 | Ga0207711_10354546 | 3300025941 | Unclassified | 1359 |
| 162 | Ga0207711_10861498 | 3300025941 | Bacteria | 843 |
| 163 | Ga0207711_10868799 | 3300025941 | Bacteria | 839 |
| 164 | Ga0207711_11104423 | 3300025941 | Unclassified | 734 |
| 165 | Ga0207689_10217752 | 3300025942 | Bacteria | 1577 |
| 166 | Ga0207689_11551201 | 3300025942 | Unclassified | 552 |
| 167 | Ga0207661_11206049 | 3300025944 | Unclassified | 696 |
| 168 | Ga0207679_11283077 | 3300025945 | Unclassified | 672 |
| 169 | Ga0207651_10097702 | 3300025960 | Unclassified | 2169 |
| 170 | Ga0207668_10040292 | 3300025972 | Bacteria | 3151 |
| 171 | Ga0207640_10271275 | 3300025981 | Bacteria | 1327 |
| 172 | Ga0207658_10084682 | 3300025986 | Bacteria | 2440 |
| 173 | Ga0207658_10591902 | 3300025986 | Bacteria | 996 |
| 174 | Ga0207677_10158459 | 3300026023 | Bacteria | 1755 |
| 175 | Ga0207677_10428609 | 3300026023 | Bacteria | 1128 |
| 176 | Ga0207677_11754955 | 3300026023 | Unclassified | 576 |
| 177 | Ga0207703_10009474 | 3300026035 | Bacteria | 7646 |
| 178 | Ga0207703_10163807 | 3300026035 | Bacteria | 1949 |
| 179 | Ga0207703_10316148 | 3300026035 | Bacteria | 1429 |
| 180 | Ga0207703_10716431 | 3300026035 | Unclassified | 952 |
| 181 | Ga0207639_10975566 | 3300026041 | Unclassified | 793 |
| 182 | Ga0207708_10209550 | 3300026075 | Bacteria | 1557 |
| 183 | Ga0207641_10003379 | 3300026088 | Bacteria | 14167 |
| 184 | Ga0207641_12038402 | 3300026088 | Unclassified | 575 |
| 185 | Ga0207676_10004488 | 3300026095 | Bacteria | 9865 |
| 186 | Ga0207676_10516926 | 3300026095 | Unclassified | 1136 |
| 187 | Ga0207674_10067684 | 3300026116 | Bacteria | 3595 |
| 188 | Ga0207674_10723809 | 3300026116 | Bacteria | 960 |
| 189 | Ga0207675_100042528 | 3300026118 | Bacteria | 4243 |
| 190 | Ga0207683_11603091 | 3300026121 | Unclassified | 600 |
| 191 | Ga0207428_10712900 | 3300027907 | Bacteria | 717 |
| 192 | Ga0268266_10061758 | 3300028379 | Bacteria | 3232 |
| 193 | Ga0268266_10080103 | 3300028379 | Bacteria | 2845 |
| 194 | Ga0268265_10005771 | 3300028380 | Bacteria | 8451 |
| 195 | Ga0268265_10209555 | 3300028380 | Bacteria | 1697 |
| 196 | Ga0268264_10358866 | 3300028381 | Bacteria | 1389 |
| 197 | Ga0268264_10816454 | 3300028381 | Bacteria | 932 |
| 198 | Ga0268264_11240188 | 3300028381 | Bacteria | 755 |
| 199 | Ga0265328_10296008 | 3300031239 | Bacteria | 624 |
| 200 | Ga0265316_10009045 | 3300031344 | Bacteria | 9180 |
| 201 | Ga0265316_10681302 | 3300031344 | Unclassified | 725 |
| 202 | Ga0265314_10130158 | 3300031711 | Bacteria | 1571 |
| 203 | Ga0373930_0000449 | 3300034816 | Bacteria | 5514 |
| 204 | Ga0373948_0073392 | 3300034817 | Bacteria | 770 |
| 205 | Ga0373958_0005195 | 3300034819 | Bacteria | 1965 |
| 206 | Ga0373959_0011204 | 3300034820 | Bacteria | 1579 |
| 207 | Ga0373938_0003511 | 3300034957 | Bacteria | 2574 |
| 208 | Ga0373926_0069518 | 3300035083 | Bacteria | 1292 |
| 209 | Ga0373928_0021552 | 3300035084 | Bacteria | 1360 |
| 210 | Ga0373929_0001196 | 3300035085 | Bacteria | 5023 |
| 211 | Ga0373940_0001329 | 3300035088 | Bacteria | 4408 |
| 212 | Ga0373944_0337166 | 3300035089 | Bacteria | 572 |
| 213 | Ga0373949_0000694 | 3300035090 | Bacteria | 10940 |
| 214 | Ga0373951_0000448 | 3300035091 | Bacteria | 11950 |
| 215 | Ga0373932_0000543 | 3300035112 | Bacteria | 11551 |
| 216 | Ga0373932_0140477 | 3300035112 | Unclassified | 821 |
| 217 | Ga0373939_0001831 | 3300035114 | Bacteria | 5113 |
| 218 | Ga0373939_0028167 | 3300035114 | Bacteria | 1597 |
| 219 | Ga0373941_0000759 | 3300035115 | Bacteria | 6603 |
| 220 | Ga0373941_0071274 | 3300035115 | Bacteria | 1154 |
| 221 | Ga0373954_0014825 | 3300035118 | Bacteria | 3478 |
| 222 | Ga0373956_0035897 | 3300035119 | Bacteria | 2187 |
| 223 | Ga0373960_0000139 | 3300035121 | Bacteria | 12064 |
| 224 | Ga0373946_0236633 | 3300035171 | Bacteria | 887 |
| 225 | Ga0373946_0488786 | 3300035171 | Unclassified | 630 |
| 226 | Ga0373955_0044565 | 3300035172 | Bacteria | 2390 |
| 227 | Ga0373955_0269048 | 3300035172 | Bacteria | 1024 |
| 228 | Ga0373942_0003783 | 3300035207 | Bacteria | 3540 |
| 229 | Ga0373942_0256569 | 3300035207 | Unclassified | 596 |
| 230 | Ga0373962_0005280 | 3300035242 | Bacteria | 3126 |
| 231 | Ga0373924_0137019 | 3300035410 | Unclassified | 1067 |
| 232 | Ga0373931_0002779 | 3300035691 | Bacteria | 7791 |
| 233 | Ga0373927_0002589 | 3300035695 | Bacteria | 13188 |
| 234 | Ga0373933_0099338 | 3300035724 | Bacteria | 1804 |
| 235 | Ga0373947_0061068 | 3300035725 | Bacteria | 2290 |
| 236 | Ga0373947_0184095 | 3300035725 | Unclassified | 1361 |
| 237 | Ga0373947_0508545 | 3300035725 | Viruses | 819 |
| 238 | Ga0373937_0074214 | 3300036401 | Bacteria | 3138 |
| 239 | Ga0373937_0081591 | 3300036401 | Bacteria | 2992 |
| 240 | Ga0373937_0210641 | 3300036401 | Bacteria | 1829 |
| 241 | Ga0373937_0293440 | 3300036401 | Unclassified | 1536 |
| 242 | Ga0373937_0332283 | 3300036401 | Bacteria | 1439 |
| 243 | Ga0373925_0031228 | 3300037068 | Bacteria | 3914 |
| 244 | Ga0373925_0452274 | 3300037068 | Unclassified | 1052 |
| 245 | Ga0373925_0723791 | 3300037068 | Viruses | 820 |
| 246 | Ga0439450_032847 | 3300042008 | Unclassified | 1174 |
| 247 | Ga0451576_0055497 | 3300045051 | Bacteria | 4144 |
| 248 | Ga0451576_0195265 | 3300045051 | Bacteria | 2114 |
| 249 | Ga0451576_1028292 | 3300045051 | Unclassified | 863 |
| 250 | Ga0451576_1330221 | 3300045051 | Unclassified | 749 |
| 251 | Ga0495603_0294774 | 3300046455 | Bacteria | 932 |
| 252 | Ga0495651_0054157 | 3300046462 | Bacteria | 3087 |
| 253 | Ga0495651_0477878 | 3300046462 | Bacteria | 801 |
| 254 | Ga0495580_0010238 | 3300046472 | Bacteria | 7313 |
| 255 | Ga0495580_0184301 | 3300046472 | Unclassified | 1441 |
| 256 | Ga0495580_0259226 | 3300046472 | Unclassified | 1189 |
| 257 | Ga0495580_0798102 | 3300046472 | Unclassified | 612 |
| 258 | Ga0495662_0134244 | 3300046476 | Unclassified | 1217 |
| 259 | Ga0495608_0212083 | 3300046511 | Bacteria | 1217 |
| 260 | Ga0495608_0403268 | 3300046511 | Bacteria | 836 |
| 261 | Ga0495628_0303940 | 3300046516 | Viruses | 1180 |
| 262 | Ga0495628_0405236 | 3300046516 | Bacteria | 996 |
| 263 | Ga0495630_0636161 | 3300046517 | Viruses | 817 |
| 264 | Ga0495666_0100753 | 3300046526 | Unclassified | 1361 |
| 265 | Ga0495665_0087342 | 3300046531 | Bacteria | 1639 |
| 266 | Ga0495640_0047532 | 3300046533 | Viruses | 2969 |
| 267 | Ga0495586_0296676 | 3300046535 | Viruses | 926 |
| 268 | Ga0495621_0161376 | 3300046539 | Bacteria | 887 |
| 269 | Ga0495645_0003437 | 3300046543 | Bacteria | 10737 |
| 270 | Ga0495645_0259438 | 3300046543 | Viruses | 1152 |
| 271 | Ga0495633_0112235 | 3300046558 | Bacteria | 1264 |
| 272 | Ga0495667_0050370 | 3300046559 | Bacteria | 2750 |
| 273 | Ga0495667_0232287 | 3300046559 | Unclassified | 1176 |
| 274 | Ga0495667_0489580 | 3300046559 | Unclassified | 771 |
| 275 | Ga0495656_0064392 | 3300046615 | Bacteria | 1610 |
| 276 | Ga0495635_0196247 | 3300046663 | Bacteria | 1370 |
| 277 | Ga0495635_0265106 | 3300046663 | Unclassified | 1156 |
| 278 | Ga0495646_0196041 | 3300046680 | Viruses | 1102 |
| 279 | Ga0495647_0203578 | 3300046681 | Bacteria | 869 |
| 280 | Ga0495658_0254854 | 3300046683 | Bacteria | 1104 |
| 281 | Ga0495613_0099411 | 3300046689 | Bacteria | 2102 |
| 282 | Ga0495613_0556453 | 3300046689 | Unclassified | 767 |
| 283 | Ga0495613_0583375 | 3300046689 | Unclassified | 745 |
| 284 | Ga0495581_0279724 | 3300047315 | Bacteria | 976 |
| 285 | Ga0495674_0014655 | 3300047319 | Bacteria | 7334 |
| 286 | Ga0495674_0085943 | 3300047319 | Bacteria | 2694 |
| 287 | Ga0495674_0222234 | 3300047319 | Unclassified | 1561 |
| 288 | Ga0495676_0527050 | 3300047321 | Viruses | 774 |
| 289 | Ga0495680_0252487 | 3300047322 | Bacteria | 1250 |
| 290 | Ga0495675_0383699 | 3300047444 | Unclassified | 821 |
| 291 | Ga0495675_0476387 | 3300047444 | Bacteria | 719 |
| 292 | Ga0495684_0042573 | 3300047471 | Bacteria | 3478 |
| 293 | Ga0495684_0073980 | 3300047471 | Bacteria | 2588 |
| 294 | Ga0495684_0323492 | 3300047471 | Bacteria | 1102 |
| 295 | Ga0495602_0419010 | 3300048088 | Bacteria | 951 |
| 296 | Ga0495602_0432255 | 3300048088 | Bacteria | 933 |
| 297 | Ga0495614_0052719 | 3300048089 | Bacteria | 1744 |
| 298 | Ga0496101_0954424 | 3300048904 | Bacteria | 675 |
| 299 | Ga0496104_0328934 | 3300048907 | Bacteria | 1441 |
| 300 | Ga0496104_0372410 | 3300048907 | Bacteria | 1341 |
| 301 | Ga0496106_0028646 | 3300048909 | Bacteria | 4149 |
| 302 | Ga0496106_0224070 | 3300048909 | Bacteria | 1500 |
| 303 | Ga0496107_0362376 | 3300048910 | Bacteria | 1079 |
| 304 | Ga0496108_0085822 | 3300048911 | Bacteria | 2672 |
| 305 | Ga0496109_0259387 | 3300048912 | Bacteria | 1637 |
| 306 | Ga0496111_0168576 | 3300048914 | Bacteria | 1627 |
| 307 | Ga0496112_0004416 | 3300048915 | Bacteria | 11907 |
| 308 | Ga0496113_0009434 | 3300048916 | Bacteria | 6402 |
| 309 | Ga0496113_0421499 | 3300048916 | Bacteria | 1072 |
| 310 | Ga0496114_0623057 | 3300048917 | Bacteria | 950 |
| 311 | Ga0496114_0642940 | 3300048917 | Unclassified | 933 |
| 312 | Ga0496114_0958084 | 3300048917 | Unclassified | 738 |
| 313 | Ga0501039_1124738 | 3300049575 | Unclassified | 608 |
| 314 | Ga0501076_0130057 | 3300049592 | Bacteria | 2042 |
| 315 | Ga0501079_0097528 | 3300049741 | Bacteria | 2279 |
| 316 | Ga0501081_0575750 | 3300049743 | Bacteria | 842 |
| 317 | nmdc:mga05p37_823623_c1 | 3300050507 | Bacteria | 1012 |
| 318 | nmdc:mga09592_423472_c1 | 3300050508 | Bacteria | 1150 |
| 319 | nmdc:mga09592_518523_c1 | 3300050508 | Bacteria | 1025 |
| 320 | nmdc:mga0qj67_619979_c1 | 3300050509 | Unclassified | 864 |
| 321 | nmdc:mga08y16_320319_c1 | 3300050511 | Bacteria | 1596 |
| 322 | nmdc:mga0n895_761_c1 | 3300050512 | Bacteria | 22851 |
| 323 | nmdc:mga0rr50_244596_c1 | 3300050513 | Bacteria | 1488 |
| 324 | nmdc:mga0rr50_261_c1 | 3300050513 | Bacteria | 28462 |
| 325 | nmdc:mga0rr50_4604_c1 | 3300050513 | Bacteria | 8122 |
| 326 | nmdc:mga0rr50_54483_c1 | 3300050513 | Bacteria | 2980 |
| 327 | nmdc:mga0rr50_7495_c1 | 3300050513 | Bacteria | 6736 |
| 328 | nmdc:mga08x19_1054517_c1 | 3300050514 | Unclassified | 577 |
| 329 | nmdc:mga08x19_1320_c1 | 3300050514 | Bacteria | 15374 |
| 330 | nmdc:mga08x19_145982_c1 | 3300050514 | Unclassified | 1600 |
| 331 | nmdc:mga08x19_203805_c1 | 3300050514 | Unclassified | 1357 |
| 332 | nmdc:mga08x19_56092_c1 | 3300050514 | Bacteria | 2542 |
| 333 | nmdc:mga08x19_76990_c1 | 3300050514 | Bacteria | 2184 |
| 334 | nmdc:mga08x19_92450_c1 | 3300050514 | Bacteria | 1998 |
| 335 | Ga0495601_0035263 | 3300053077 | Unclassified | 3122 |
| 336 | Ga0495595_0363218 | 3300053084 | Bacteria | 732 |
| 337 | Ga0501082_0725483 | 3300060353 | Bacteria | 870 |
| 338 | Ga0530510_1376397 | 3300061734 | Bacteria | 541 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025922 | Ga0207646_10650457 | Ga0207646_106504572 | 141 |
| 2 | 3300046472 | Ga0495580_0184301 | Ga0495580_0184301_154_585 | 141 |
| 3 | 3300031344 | Ga0265316_10009045 | Ga0265316_100090458 | 145 |
| 4 | 3300031344 | Ga0265316_10681302 | Ga0265316_106813021 | 145 |
| 5 | 3300005457 | Ga0070662_100996461 | Ga0070662_1009964611 | 146 |
| 6 | 3300014325 | Ga0163163_10594670 | Ga0163163_105946701 | 146 |
| 7 | 3300049575 | Ga0501039_1124738 | Ga0501039_1124738_151_591 | 146 |
| 8 | 3300049592 | Ga0501076_0130057 | Ga0501076_0130057_879_1319 | 146 |
| 9 | 3300049741 | Ga0501079_0097528 | Ga0501079_0097528_1107_1547 | 146 |
| 10 | 3300049743 | Ga0501081_0575750 | Ga0501081_0575750_164_604 | 146 |
| 11 | 3300060353 | Ga0501082_0725483 | Ga0501082_0725483_223_663 | 146 |
| 12 | 3300061734 | Ga0530510_1376397 | Ga0530510_1376397_55_495 | 146 |
| 13 | 3300005340 | Ga0070689_100120317 | Ga0070689_1001203172 | 147 |
| 14 | 3300005365 | Ga0070688_100270799 | Ga0070688_1002707992 | 147 |
| 15 | 3300005617 | Ga0068859_100057495 | Ga0068859_1000574952 | 147 |
| 16 | 3300006880 | Ga0075429_100815940 | Ga0075429_1008159402 | 147 |
| 17 | 3300006931 | Ga0097620_100057494 | Ga0097620_1000574946 | 147 |
| 18 | 3300009094 | Ga0111539_10082636 | Ga0111539_100826363 | 147 |
| 19 | 3300009094 | Ga0111539_10090253 | Ga0111539_100902535 | 147 |
| 20 | 3300009094 | Ga0111539_10373234 | Ga0111539_103732344 | 147 |
| 21 | 3300009553 | Ga0105249_11243899 | Ga0105249_112438991 | 147 |
| 22 | 3300025936 | Ga0207670_10042556 | Ga0207670_100425564 | 147 |
| 23 | 3300027907 | Ga0207428_10712900 | Ga0207428_107129002 | 147 |
| 24 | 3300035112 | Ga0373932_0140477 | Ga0373932_0140477_292_738 | 147 |
| 25 | 3300050508 | nmdc:mga09592_423472_c1 | nmdc:mga09592_423472_c1_490_933 | 147 |
| 26 | 3300050508 | nmdc:mga09592_518523_c1 | nmdc:mga09592_518523_c1_62_508 | 147 |
| 27 | 3300050509 | nmdc:mga0qj67_619979_c1 | nmdc:mga0qj67_619979_c1_390_836 | 147 |
| 28 | 3300050511 | nmdc:mga08y16_320319_c1 | nmdc:mga08y16_320319_c1_21_467 | 147 |
| 29 | 3300005457 | Ga0070662_100212508 | Ga0070662_1002125082 | 148 |
| 30 | 3300005546 | Ga0070696_100268210 | Ga0070696_1002682102 | 148 |
| 31 | 3300025933 | Ga0207706_10390938 | Ga0207706_103909382 | 148 |
| 32 | 3300035083 | Ga0373926_0069518 | Ga0373926_0069518_799_1251 | 148 |
| 33 | 3300035118 | Ga0373954_0014825 | Ga0373954_0014825_1329_1781 | 148 |
| 34 | 3300035119 | Ga0373956_0035897 | Ga0373956_0035897_893_1345 | 148 |
| 35 | 3300035172 | Ga0373955_0044565 | Ga0373955_0044565_222_674 | 148 |
| 36 | 3300035695 | Ga0373927_0002589 | Ga0373927_0002589_9629_10081 | 148 |
| 37 | 3300035724 | Ga0373933_0099338 | Ga0373933_0099338_296_748 | 148 |
| 38 | 3300035725 | Ga0373947_0061068 | Ga0373947_0061068_1240_1692 | 148 |
| 39 | 3300036401 | Ga0373937_0074214 | Ga0373937_0074214_1914_2366 | 148 |
| 40 | 3300037068 | Ga0373925_0031228 | Ga0373925_0031228_1906_2358 | 148 |
| 41 | 3300046462 | Ga0495651_0054157 | Ga0495651_0054157_1085_1537 | 148 |
| 42 | 3300046472 | Ga0495580_0010238 | Ga0495580_0010238_3497_3949 | 148 |
| 43 | 3300046511 | Ga0495608_0212083 | Ga0495608_0212083_100_552 | 148 |
| 44 | 3300046663 | Ga0495635_0196247 | Ga0495635_0196247_811_1263 | 148 |
| 45 | 3300046689 | Ga0495613_0099411 | Ga0495613_0099411_1532_1984 | 148 |
| 46 | 3300047319 | Ga0495674_0085943 | Ga0495674_0085943_2155_2607 | 148 |
| 47 | 3300047471 | Ga0495684_0073980 | Ga0495684_0073980_622_1074 | 148 |
| 48 | 3300048088 | Ga0495602_0432255 | Ga0495602_0432255_156_608 | 148 |
| 49 | 3300005330 | Ga0070690_100327455 | Ga0070690_1003274551 | 149 |
| 50 | 3300005459 | Ga0068867_101925458 | Ga0068867_1019254581 | 149 |
| 51 | 3300005466 | Ga0070685_11037541 | Ga0070685_110375411 | 149 |
| 52 | 3300005545 | Ga0070695_101254675 | Ga0070695_1012546751 | 149 |
| 53 | 3300005615 | Ga0070702_100282731 | Ga0070702_1002827312 | 149 |
| 54 | 3300005617 | Ga0068859_101147290 | Ga0068859_1011472902 | 149 |
| 55 | 3300005842 | Ga0068858_100718163 | Ga0068858_1007181631 | 149 |
| 56 | 3300006931 | Ga0097620_101147254 | Ga0097620_1011472541 | 149 |
| 57 | 3300009093 | Ga0105240_10139109 | Ga0105240_101391091 | 149 |
| 58 | 3300009098 | Ga0105245_10791901 | Ga0105245_107919012 | 149 |
| 59 | 3300009174 | Ga0105241_11113104 | Ga0105241_111131042 | 149 |
| 60 | 3300009177 | Ga0105248_10340604 | Ga0105248_103406042 | 149 |
| 61 | 3300009177 | Ga0105248_10760241 | Ga0105248_107602412 | 149 |
| 62 | 3300011119 | Ga0105246_10545002 | Ga0105246_105450022 | 149 |
| 63 | 3300013306 | Ga0163162_12609691 | Ga0163162_126096911 | 149 |
| 64 | 3300013307 | Ga0157372_11265341 | Ga0157372_112653412 | 149 |
| 65 | 3300014325 | Ga0163163_10326328 | Ga0163163_103263281 | 149 |
| 66 | 3300014968 | Ga0157379_10706066 | Ga0157379_107060661 | 149 |
| 67 | 3300014969 | Ga0157376_10449621 | Ga0157376_104496212 | 149 |
| 68 | 3300025911 | Ga0207654_10310552 | Ga0207654_103105521 | 149 |
| 69 | 3300025913 | Ga0207695_11422531 | Ga0207695_114225311 | 149 |
| 70 | 3300025941 | Ga0207711_10354546 | Ga0207711_103545462 | 149 |
| 71 | 3300025944 | Ga0207661_11206049 | Ga0207661_112060491 | 149 |
| 72 | 3300025960 | Ga0207651_10097702 | Ga0207651_100977022 | 149 |
| 73 | 3300026023 | Ga0207677_10158459 | Ga0207677_101584593 | 149 |
| 74 | 3300026035 | Ga0207703_10316148 | Ga0207703_103161482 | 149 |
| 75 | 3300026095 | Ga0207676_10516926 | Ga0207676_105169262 | 149 |
| 76 | 3300031239 | Ga0265328_10296008 | Ga0265328_102960081 | 149 |
| 77 | 3300035089 | Ga0373944_0337166 | Ga0373944_0337166_25_486 | 149 |
| 78 | 3300035171 | Ga0373946_0236633 | Ga0373946_0236633_106_567 | 149 |
| 79 | 3300035725 | Ga0373947_0508545 | Ga0373947_0508545_303_764 | 149 |
| 80 | 3300036401 | Ga0373937_0210641 | Ga0373937_0210641_886_1347 | 149 |
| 81 | 3300037068 | Ga0373925_0723791 | Ga0373925_0723791_165_626 | 149 |
| 82 | 3300045051 | Ga0451576_0195265 | Ga0451576_0195265_487_963 | 149 |
| 83 | 3300046462 | Ga0495651_0477878 | Ga0495651_0477878_294_755 | 149 |
| 84 | 3300046476 | Ga0495662_0134244 | Ga0495662_0134244_412_873 | 149 |
| 85 | 3300046511 | Ga0495608_0403268 | Ga0495608_0403268_237_698 | 149 |
| 86 | 3300046516 | Ga0495628_0303940 | Ga0495628_0303940_155_616 | 149 |
| 87 | 3300046517 | Ga0495630_0636161 | Ga0495630_0636161_77_538 | 149 |
| 88 | 3300046526 | Ga0495666_0100753 | Ga0495666_0100753_75_695 | 149 |
| 89 | 3300046531 | Ga0495665_0087342 | Ga0495665_0087342_977_1438 | 149 |
| 90 | 3300046533 | Ga0495640_0047532 | Ga0495640_0047532_2121_2582 | 149 |
| 91 | 3300046535 | Ga0495586_0296676 | Ga0495586_0296676_332_793 | 149 |
| 92 | 3300046543 | Ga0495645_0259438 | Ga0495645_0259438_204_665 | 149 |
| 93 | 3300046559 | Ga0495667_0050370 | Ga0495667_0050370_607_1068 | 149 |
| 94 | 3300046680 | Ga0495646_0196041 | Ga0495646_0196041_454_915 | 149 |
| 95 | 3300047319 | Ga0495674_0014655 | Ga0495674_0014655_5628_6089 | 149 |
| 96 | 3300047321 | Ga0495676_0527050 | Ga0495676_0527050_165_626 | 149 |
| 97 | 3300047444 | Ga0495675_0383699 | Ga0495675_0383699_227_688 | 149 |
| 98 | 3300047471 | Ga0495684_0042573 | Ga0495684_0042573_1387_1848 | 149 |
| 99 | 3300048089 | Ga0495614_0052719 | Ga0495614_0052719_50_511 | 149 |
| 100 | 3300053084 | Ga0495595_0363218 | Ga0495595_0363218_187_648 | 149 |
| 101 | 3300005844 | Ga0068862_100224185 | Ga0068862_1002241852 | 150 |
| 102 | 3300025938 | Ga0207704_10211520 | Ga0207704_102115202 | 150 |
| 103 | 3300025972 | Ga0207668_10040292 | Ga0207668_100402922 | 150 |
| 104 | 3300026075 | Ga0207708_10209550 | Ga0207708_102095503 | 150 |
| 105 | 3300028380 | Ga0268265_10209555 | Ga0268265_102095552 | 150 |
| 106 | 3300005328 | Ga0070676_10764848 | Ga0070676_107648482 | 151 |
| 107 | 3300005356 | Ga0070674_101099591 | Ga0070674_1010995912 | 151 |
| 108 | 3300006175 | Ga0070712_100975580 | Ga0070712_1009755802 | 151 |
| 109 | 3300025906 | Ga0207699_10126541 | Ga0207699_101265412 | 151 |
| 110 | 3300050514 | nmdc:mga08x19_1054517_c1 | nmdc:mga08x19_1054517_c1_40_504 | 151 |
| 111 | 3300050514 | nmdc:mga08x19_92450_c1 | nmdc:mga08x19_92450_c1_362_850 | 151 |
| 112 | 3300006871 | Ga0075434_100024241 | Ga0075434_1000242415 | 152 |
| 113 | 3300007076 | Ga0075435_100049977 | Ga0075435_1000499773 | 152 |
| 114 | 3300009176 | Ga0105242_10670710 | Ga0105242_106707102 | 152 |
| 115 | 3300048917 | Ga0496114_0642940 | Ga0496114_0642940_34_510 | 152 |
| 116 | 3300006028 | Ga0070717_10185085 | Ga0070717_101850852 | 153 |
| 117 | 3300006844 | Ga0075428_101081714 | Ga0075428_1010817141 | 153 |
| 118 | 3300025922 | Ga0207646_10788605 | Ga0207646_107886052 | 153 |
| 119 | 3300035725 | Ga0373947_0184095 | Ga0373947_0184095_94_594 | 153 |
| 120 | 3300036401 | Ga0373937_0332283 | Ga0373937_0332283_320_823 | 153 |
| 121 | 3300037068 | Ga0373925_0452274 | Ga0373925_0452274_528_1028 | 153 |
| 122 | 3300046472 | Ga0495580_0259226 | Ga0495580_0259226_113_613 | 153 |
| 123 | 3300046559 | Ga0495667_0232287 | Ga0495667_0232287_629_1132 | 153 |
| 124 | 3300047444 | Ga0495675_0476387 | Ga0495675_0476387_91_594 | 153 |
| 125 | 3300005445 | Ga0070708_100020714 | Ga0070708_1000207142 | 154 |
| 126 | 3300009177 | Ga0105248_10046363 | Ga0105248_100463634 | 154 |
| 127 | 3300046455 | Ga0495603_0294774 | Ga0495603_0294774_283_765 | 154 |
| 128 | 3300005455 | Ga0070663_100757959 | Ga0070663_1007579591 | 155 |
| 129 | 3300005842 | Ga0068858_100827883 | Ga0068858_1008278831 | 155 |
| 130 | 3300005844 | Ga0068862_101441836 | Ga0068862_1014418361 | 155 |
| 131 | 3300009553 | Ga0105249_12283851 | Ga0105249_122838511 | 155 |
| 132 | 3300014968 | Ga0157379_10032465 | Ga0157379_100324652 | 155 |
| 133 | 3300014968 | Ga0157379_12115171 | Ga0157379_121151711 | 155 |
| 134 | 3300026035 | Ga0207703_10163807 | Ga0207703_101638071 | 155 |
| 135 | 3300028381 | Ga0268264_10816454 | Ga0268264_108164541 | 155 |
| 136 | 3300042008 | Ga0439450_032847 | Ga0439450_032847_469_954 | 155 |
| 137 | 3300005335 | Ga0070666_10038092 | Ga0070666_100380922 | 156 |
| 138 | 3300005338 | Ga0068868_100108839 | Ga0068868_1001088393 | 156 |
| 139 | 3300005338 | Ga0068868_100169552 | Ga0068868_1001695522 | 156 |
| 140 | 3300005340 | Ga0070689_100026836 | Ga0070689_1000268363 | 156 |
| 141 | 3300005343 | Ga0070687_100167453 | Ga0070687_1001674532 | 156 |
| 142 | 3300005353 | Ga0070669_100019422 | Ga0070669_1000194222 | 156 |
| 143 | 3300005355 | Ga0070671_100009153 | Ga0070671_1000091536 | 156 |
| 144 | 3300005364 | Ga0070673_101604380 | Ga0070673_1016043801 | 156 |
| 145 | 3300005365 | Ga0070688_100478635 | Ga0070688_1004786352 | 156 |
| 146 | 3300005367 | Ga0070667_100064930 | Ga0070667_1000649302 | 156 |
| 147 | 3300005444 | Ga0070694_101015407 | Ga0070694_1010154071 | 156 |
| 148 | 3300005457 | Ga0070662_100700830 | Ga0070662_1007008302 | 156 |
| 149 | 3300005543 | Ga0070672_100008704 | Ga0070672_1000087046 | 156 |
| 150 | 3300005544 | Ga0070686_100380268 | Ga0070686_1003802682 | 156 |
| 151 | 3300005563 | Ga0068855_100431947 | Ga0068855_1004319472 | 156 |
| 152 | 3300005617 | Ga0068859_100777784 | Ga0068859_1007777842 | 156 |
| 153 | 3300005841 | Ga0068863_100002434 | Ga0068863_10000243418 | 156 |
| 154 | 3300005841 | Ga0068863_100415252 | Ga0068863_1004152521 | 156 |
| 155 | 3300005844 | Ga0068862_100010886 | Ga0068862_1000108866 | 156 |
| 156 | 3300006358 | Ga0068871_100752656 | Ga0068871_1007526562 | 156 |
| 157 | 3300006881 | Ga0068865_100697704 | Ga0068865_1006977041 | 156 |
| 158 | 3300006914 | Ga0075436_100151817 | Ga0075436_1001518173 | 156 |
| 159 | 3300006914 | Ga0075436_100383475 | Ga0075436_1003834751 | 156 |
| 160 | 3300006931 | Ga0097620_100777776 | Ga0097620_1007777762 | 156 |
| 161 | 3300007076 | Ga0075435_100232478 | Ga0075435_1002324782 | 156 |
| 162 | 3300009094 | Ga0111539_10754934 | Ga0111539_107549342 | 156 |
| 163 | 3300009148 | Ga0105243_10223734 | Ga0105243_102237342 | 156 |
| 164 | 3300009176 | Ga0105242_10634704 | Ga0105242_106347042 | 156 |
| 165 | 3300009177 | Ga0105248_10193581 | Ga0105248_101935812 | 156 |
| 166 | 3300013306 | Ga0163162_10584008 | Ga0163162_105840082 | 156 |
| 167 | 3300014326 | Ga0157380_11989104 | Ga0157380_119891042 | 156 |
| 168 | 3300014968 | Ga0157379_10096766 | Ga0157379_100967662 | 156 |
| 169 | 3300025906 | Ga0207699_10543772 | Ga0207699_105437722 | 156 |
| 170 | 3300025921 | Ga0207652_11285491 | Ga0207652_112854912 | 156 |
| 171 | 3300025923 | Ga0207681_10004734 | Ga0207681_100047346 | 156 |
| 172 | 3300025931 | Ga0207644_10028545 | Ga0207644_100285452 | 156 |
| 173 | 3300025933 | Ga0207706_10451741 | Ga0207706_104517412 | 156 |
| 174 | 3300025935 | Ga0207709_10236476 | Ga0207709_102364762 | 156 |
| 175 | 3300025935 | Ga0207709_10455729 | Ga0207709_104557291 | 156 |
| 176 | 3300025936 | Ga0207670_10181022 | Ga0207670_101810222 | 156 |
| 177 | 3300025937 | Ga0207669_10208712 | Ga0207669_102087122 | 156 |
| 178 | 3300025938 | Ga0207704_10311802 | Ga0207704_103118022 | 156 |
| 179 | 3300025940 | Ga0207691_10012289 | Ga0207691_100122896 | 156 |
| 180 | 3300025986 | Ga0207658_10084682 | Ga0207658_100846822 | 156 |
| 181 | 3300026023 | Ga0207677_10428609 | Ga0207677_104286092 | 156 |
| 182 | 3300026023 | Ga0207677_11754955 | Ga0207677_117549551 | 156 |
| 183 | 3300026035 | Ga0207703_10716431 | Ga0207703_107164311 | 156 |
| 184 | 3300026041 | Ga0207639_10975566 | Ga0207639_109755662 | 156 |
| 185 | 3300026088 | Ga0207641_10003379 | Ga0207641_100033796 | 156 |
| 186 | 3300026121 | Ga0207683_11603091 | Ga0207683_116030911 | 156 |
| 187 | 3300028380 | Ga0268265_10005771 | Ga0268265_100057712 | 156 |
| 188 | 3300028381 | Ga0268264_10358866 | Ga0268264_103588662 | 156 |
| 189 | 3300035114 | Ga0373939_0028167 | Ga0373939_0028167_31_507 | 156 |
| 190 | 3300035115 | Ga0373941_0071274 | Ga0373941_0071274_242_718 | 156 |
| 191 | 3300035207 | Ga0373942_0256569 | Ga0373942_0256569_32_508 | 156 |
| 192 | 3300046539 | Ga0495621_0161376 | Ga0495621_0161376_345_821 | 156 |
| 193 | 3300046615 | Ga0495656_0064392 | Ga0495656_0064392_543_1019 | 156 |
| 194 | 3300048907 | Ga0496104_0372410 | Ga0496104_0372410_465_941 | 156 |
| 195 | 3300048910 | Ga0496107_0362376 | Ga0496107_0362376_519_1001 | 156 |
| 196 | 3300050513 | nmdc:mga0rr50_244596_c1 | nmdc:mga0rr50_244596_c1_349_831 | 156 |
| 197 | 3300050514 | nmdc:mga08x19_145982_c1 | nmdc:mga08x19_145982_c1_1045_1533 | 156 |
| 198 | 3300050514 | nmdc:mga08x19_203805_c1 | nmdc:mga08x19_203805_c1_119_601 | 156 |
| 199 | 3300050514 | nmdc:mga08x19_76990_c1 | nmdc:mga08x19_76990_c1_1173_1661 | 156 |
| 200 | 3300005290 | Ga0065712_10072310 | Ga0065712_100723102 | 157 |
| 201 | 3300005331 | Ga0070670_100071134 | Ga0070670_1000711342 | 157 |
| 202 | 3300005344 | Ga0070661_100849578 | Ga0070661_1008495782 | 157 |
| 203 | 3300005366 | Ga0070659_100403277 | Ga0070659_1004032772 | 157 |
| 204 | 3300005366 | Ga0070659_101072632 | Ga0070659_1010726321 | 157 |
| 205 | 3300005467 | Ga0070706_100263348 | Ga0070706_1002633482 | 157 |
| 206 | 3300005471 | Ga0070698_100999184 | Ga0070698_1009991842 | 157 |
| 207 | 3300005544 | Ga0070686_100003183 | Ga0070686_1000031838 | 157 |
| 208 | 3300005544 | Ga0070686_100520047 | Ga0070686_1005200471 | 157 |
| 209 | 3300005548 | Ga0070665_100103841 | Ga0070665_1001038412 | 157 |
| 210 | 3300005548 | Ga0070665_100114854 | Ga0070665_1001148542 | 157 |
| 211 | 3300005564 | Ga0070664_100272863 | Ga0070664_1002728632 | 157 |
| 212 | 3300005577 | Ga0068857_100299674 | Ga0068857_1002996742 | 157 |
| 213 | 3300005578 | Ga0068854_100014840 | Ga0068854_1000148402 | 157 |
| 214 | 3300005617 | Ga0068859_100008196 | Ga0068859_1000081963 | 157 |
| 215 | 3300005618 | Ga0068864_100000964 | Ga0068864_10000096422 | 157 |
| 216 | 3300005719 | Ga0068861_100427796 | Ga0068861_1004277962 | 157 |
| 217 | 3300005719 | Ga0068861_100485155 | Ga0068861_1004851552 | 157 |
| 218 | 3300005841 | Ga0068863_101902101 | Ga0068863_1019021011 | 157 |
| 219 | 3300005842 | Ga0068858_100061219 | Ga0068858_1000612192 | 157 |
| 220 | 3300005842 | Ga0068858_100236708 | Ga0068858_1002367082 | 157 |
| 221 | 3300005843 | Ga0068860_100531066 | Ga0068860_1005310662 | 157 |
| 222 | 3300006237 | Ga0097621_100183332 | Ga0097621_1001833322 | 157 |
| 223 | 3300006358 | Ga0068871_100257628 | Ga0068871_1002576282 | 157 |
| 224 | 3300006358 | Ga0068871_100575701 | Ga0068871_1005757012 | 157 |
| 225 | 3300006871 | Ga0075434_100572401 | Ga0075434_1005724012 | 157 |
| 226 | 3300006931 | Ga0097620_100008196 | Ga0097620_1000081967 | 157 |
| 227 | 3300007076 | Ga0075435_100009598 | Ga0075435_1000095982 | 157 |
| 228 | 3300009098 | Ga0105245_11011142 | Ga0105245_110111422 | 157 |
| 229 | 3300009147 | Ga0114129_10735488 | Ga0114129_107354882 | 157 |
| 230 | 3300009148 | Ga0105243_10654837 | Ga0105243_106548371 | 157 |
| 231 | 3300009174 | Ga0105241_10136420 | Ga0105241_101364202 | 157 |
| 232 | 3300009176 | Ga0105242_10124624 | Ga0105242_101246242 | 157 |
| 233 | 3300009177 | Ga0105248_10001088 | Ga0105248_1000108822 | 157 |
| 234 | 3300009177 | Ga0105248_10227530 | Ga0105248_102275302 | 157 |
| 235 | 3300009177 | Ga0105248_10246039 | Ga0105248_102460393 | 157 |
| 236 | 3300009177 | Ga0105248_11112561 | Ga0105248_111125612 | 157 |
| 237 | 3300009177 | Ga0105248_11222921 | Ga0105248_112229212 | 157 |
| 238 | 3300009177 | Ga0105248_11238787 | Ga0105248_112387871 | 157 |
| 239 | 3300013296 | Ga0157374_10093938 | Ga0157374_100939382 | 157 |
| 240 | 3300013306 | Ga0163162_11119240 | Ga0163162_111192402 | 157 |
| 241 | 3300013308 | Ga0157375_11266554 | Ga0157375_112665541 | 157 |
| 242 | 3300014325 | Ga0163163_10005329 | Ga0163163_100053294 | 157 |
| 243 | 3300014325 | Ga0163163_10512134 | Ga0163163_105121342 | 157 |
| 244 | 3300014745 | Ga0157377_10043151 | Ga0157377_100431512 | 157 |
| 245 | 3300014968 | Ga0157379_10050434 | Ga0157379_100504343 | 157 |
| 246 | 3300025900 | Ga0207710_10008884 | Ga0207710_100088844 | 157 |
| 247 | 3300025903 | Ga0207680_10027287 | Ga0207680_100272873 | 157 |
| 248 | 3300025911 | Ga0207654_10093241 | Ga0207654_100932413 | 157 |
| 249 | 3300025918 | Ga0207662_10455368 | Ga0207662_104553681 | 157 |
| 250 | 3300025925 | Ga0207650_10214707 | Ga0207650_102147072 | 157 |
| 251 | 3300025926 | Ga0207659_10000763 | Ga0207659_100007633 | 157 |
| 252 | 3300025926 | Ga0207659_11269017 | Ga0207659_112690172 | 157 |
| 253 | 3300025927 | Ga0207687_11136805 | Ga0207687_111368052 | 157 |
| 254 | 3300025932 | Ga0207690_10258987 | Ga0207690_102589872 | 157 |
| 255 | 3300025933 | Ga0207706_10483032 | Ga0207706_104830322 | 157 |
| 256 | 3300025934 | Ga0207686_10598363 | Ga0207686_105983632 | 157 |
| 257 | 3300025935 | Ga0207709_10434310 | Ga0207709_104343101 | 157 |
| 258 | 3300025941 | Ga0207711_10022795 | Ga0207711_100227952 | 157 |
| 259 | 3300025941 | Ga0207711_10089321 | Ga0207711_100893213 | 157 |
| 260 | 3300025941 | Ga0207711_10861498 | Ga0207711_108614981 | 157 |
| 261 | 3300025941 | Ga0207711_10868799 | Ga0207711_108687992 | 157 |
| 262 | 3300025941 | Ga0207711_11104423 | Ga0207711_111044231 | 157 |
| 263 | 3300025942 | Ga0207689_10217752 | Ga0207689_102177521 | 157 |
| 264 | 3300025942 | Ga0207689_11551201 | Ga0207689_115512011 | 157 |
| 265 | 3300025945 | Ga0207679_11283077 | Ga0207679_112830772 | 157 |
| 266 | 3300025981 | Ga0207640_10271275 | Ga0207640_102712752 | 157 |
| 267 | 3300025986 | Ga0207658_10591902 | Ga0207658_105919022 | 157 |
| 268 | 3300026035 | Ga0207703_10009474 | Ga0207703_100094744 | 157 |
| 269 | 3300026088 | Ga0207641_12038402 | Ga0207641_120384021 | 157 |
| 270 | 3300026095 | Ga0207676_10004488 | Ga0207676_100044887 | 157 |
| 271 | 3300026116 | Ga0207674_10067684 | Ga0207674_100676842 | 157 |
| 272 | 3300026116 | Ga0207674_10723809 | Ga0207674_107238092 | 157 |
| 273 | 3300026118 | Ga0207675_100042528 | Ga0207675_1000425282 | 157 |
| 274 | 3300028379 | Ga0268266_10061758 | Ga0268266_100617584 | 157 |
| 275 | 3300028379 | Ga0268266_10080103 | Ga0268266_100801033 | 157 |
| 276 | 3300028381 | Ga0268264_11240188 | Ga0268264_112401881 | 157 |
| 277 | 3300031711 | Ga0265314_10130158 | Ga0265314_101301582 | 157 |
| 278 | 3300034816 | Ga0373930_0000449 | Ga0373930_0000449_859_1344 | 157 |
| 279 | 3300034817 | Ga0373948_0073392 | Ga0373948_0073392_103_579 | 157 |
| 280 | 3300034819 | Ga0373958_0005195 | Ga0373958_0005195_63_548 | 157 |
| 281 | 3300034820 | Ga0373959_0011204 | Ga0373959_0011204_197_682 | 157 |
| 282 | 3300034957 | Ga0373938_0003511 | Ga0373938_0003511_392_877 | 157 |
| 283 | 3300035084 | Ga0373928_0021552 | Ga0373928_0021552_592_1077 | 157 |
| 284 | 3300035085 | Ga0373929_0001196 | Ga0373929_0001196_2447_2932 | 157 |
| 285 | 3300035088 | Ga0373940_0001329 | Ga0373940_0001329_1355_1840 | 157 |
| 286 | 3300035090 | Ga0373949_0000694 | Ga0373949_0000694_4213_4698 | 157 |
| 287 | 3300035091 | Ga0373951_0000448 | Ga0373951_0000448_6325_6810 | 157 |
| 288 | 3300035112 | Ga0373932_0000543 | Ga0373932_0000543_6807_7292 | 157 |
| 289 | 3300035114 | Ga0373939_0001831 | Ga0373939_0001831_4235_4720 | 157 |
| 290 | 3300035115 | Ga0373941_0000759 | Ga0373941_0000759_2620_3105 | 157 |
| 291 | 3300035121 | Ga0373960_0000139 | Ga0373960_0000139_5381_5866 | 157 |
| 292 | 3300035171 | Ga0373946_0488786 | Ga0373946_0488786_109_597 | 157 |
| 293 | 3300035172 | Ga0373955_0269048 | Ga0373955_0269048_330_818 | 157 |
| 294 | 3300035207 | Ga0373942_0003783 | Ga0373942_0003783_2012_2497 | 157 |
| 295 | 3300035242 | Ga0373962_0005280 | Ga0373962_0005280_2561_3046 | 157 |
| 296 | 3300035410 | Ga0373924_0137019 | Ga0373924_0137019_552_1028 | 157 |
| 297 | 3300035691 | Ga0373931_0002779 | Ga0373931_0002779_6706_7191 | 157 |
| 298 | 3300036401 | Ga0373937_0081591 | Ga0373937_0081591_501_989 | 157 |
| 299 | 3300036401 | Ga0373937_0293440 | Ga0373937_0293440_102_599 | 157 |
| 300 | 3300045051 | Ga0451576_0055497 | Ga0451576_0055497_1870_2355 | 157 |
| 301 | 3300045051 | Ga0451576_1028292 | Ga0451576_1028292_129_605 | 157 |
| 302 | 3300045051 | Ga0451576_1330221 | Ga0451576_1330221_212_718 | 157 |
| 303 | 3300046472 | Ga0495580_0798102 | Ga0495580_0798102_86_571 | 157 |
| 304 | 3300046516 | Ga0495628_0405236 | Ga0495628_0405236_455_943 | 157 |
| 305 | 3300046543 | Ga0495645_0003437 | Ga0495645_0003437_5963_6451 | 157 |
| 306 | 3300046558 | Ga0495633_0112235 | Ga0495633_0112235_510_998 | 157 |
| 307 | 3300046559 | Ga0495667_0489580 | Ga0495667_0489580_242_730 | 157 |
| 308 | 3300046663 | Ga0495635_0265106 | Ga0495635_0265106_548_1036 | 157 |
| 309 | 3300046681 | Ga0495647_0203578 | Ga0495647_0203578_58_546 | 157 |
| 310 | 3300046683 | Ga0495658_0254854 | Ga0495658_0254854_25_513 | 157 |
| 311 | 3300046689 | Ga0495613_0556453 | Ga0495613_0556453_31_519 | 157 |
| 312 | 3300046689 | Ga0495613_0583375 | Ga0495613_0583375_103_579 | 157 |
| 313 | 3300047315 | Ga0495581_0279724 | Ga0495581_0279724_22_510 | 157 |
| 314 | 3300047319 | Ga0495674_0222234 | Ga0495674_0222234_401_889 | 157 |
| 315 | 3300047322 | Ga0495680_0252487 | Ga0495680_0252487_115_603 | 157 |
| 316 | 3300047471 | Ga0495684_0323492 | Ga0495684_0323492_166_654 | 157 |
| 317 | 3300048088 | Ga0495602_0419010 | Ga0495602_0419010_429_917 | 157 |
| 318 | 3300048904 | Ga0496101_0954424 | Ga0496101_0954424_131_616 | 157 |
| 319 | 3300048907 | Ga0496104_0328934 | Ga0496104_0328934_902_1378 | 157 |
| 320 | 3300048909 | Ga0496106_0028646 | Ga0496106_0028646_699_1184 | 157 |
| 321 | 3300048909 | Ga0496106_0224070 | Ga0496106_0224070_751_1236 | 157 |
| 322 | 3300048911 | Ga0496108_0085822 | Ga0496108_0085822_114_590 | 157 |
| 323 | 3300048912 | Ga0496109_0259387 | Ga0496109_0259387_1094_1570 | 157 |
| 324 | 3300048914 | Ga0496111_0168576 | Ga0496111_0168576_508_984 | 157 |
| 325 | 3300048915 | Ga0496112_0004416 | Ga0496112_0004416_2135_2611 | 157 |
| 326 | 3300048916 | Ga0496113_0009434 | Ga0496113_0009434_2716_3192 | 157 |
| 327 | 3300048916 | Ga0496113_0421499 | Ga0496113_0421499_243_719 | 157 |
| 328 | 3300048917 | Ga0496114_0623057 | Ga0496114_0623057_257_745 | 157 |
| 329 | 3300048917 | Ga0496114_0958084 | Ga0496114_0958084_227_703 | 157 |
| 330 | 3300050507 | nmdc:mga05p37_823623_c1 | nmdc:mga05p37_823623_c1_94_585 | 157 |
| 331 | 3300050512 | nmdc:mga0n895_761_c1 | nmdc:mga0n895_761_c1_6883_7368 | 157 |
| 332 | 3300050513 | nmdc:mga0rr50_261_c1 | nmdc:mga0rr50_261_c1_1109_1594 | 157 |
| 333 | 3300050513 | nmdc:mga0rr50_4604_c1 | nmdc:mga0rr50_4604_c1_7186_7668 | 157 |
| 334 | 3300050513 | nmdc:mga0rr50_54483_c1 | nmdc:mga0rr50_54483_c1_2092_2583 | 157 |
| 335 | 3300050513 | nmdc:mga0rr50_7495_c1 | nmdc:mga0rr50_7495_c1_318_803 | 157 |
| 336 | 3300050514 | nmdc:mga08x19_1320_c1 | nmdc:mga08x19_1320_c1_13838_14323 | 157 |
| 337 | 3300050514 | nmdc:mga08x19_56092_c1 | nmdc:mga08x19_56092_c1_553_1038 | 157 |
| 338 | 3300053077 | Ga0495601_0035263 | Ga0495601_0035263_2048_2536 | 157 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5cxm-assembly2.cif.gz_D | crystal structure of the cyanobacterial plasma membrane rieske protein petc3 from synechocystis pcc 6803 | 0.8636 | 56 | 153 |
| 2v5i-assembly1.cif.gz_A | structure of the receptor-binding protein of bacteriophage det7: a podoviral tailspike in a myovirus | 0.8611 | 64 | 93 |
| 2qpz-assembly1.cif.gz_A | naphthalene 1,2-dioxygenase rieske ferredoxin | 0.8534 | 55 | 157 |
| 5z1v-assembly4.cif.gz_D | crystal structure of avrpib | 0.8388 | 64 | 91 |
| 4emj-assembly1.cif.gz_B | complex between the reductase and ferredoxin components of toluene dioxygenase | 0.8345 | 55 | 156 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_E7F3F1_17_122_2.102.10.10 | Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain | 0.888 | 54 | 155 | 2.102.10.10 |
| 5cxmD00 | Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain | 0.8636 | 56 | 153 | 2.102.10.10 |
| 1z01A02 | Mainly Beta;Single Sheet;N-terminal domain of TfIIb; | 0.862 | 54 | 155 | 2.20.25.680 |
| af_Q9URZ1_2_228_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8486 | 64 | 93 | 3.40.50.150 |
| af_Q4E113_2_239_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8456 | 63 | 93 | 3.40.50.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A357Z6T0-F1-model_v4 | (2Fe-2S)-binding protein | 0.961 | 79 | 155 |
GO:0046872
GO:0051537 |
| AF-A0A3N5KAZ6-F1-model_v4 | Rieske (2Fe-2S) protein | 0.9496 | 79 | 155 |
GO:0016020
GO:0046872 GO:0051537 |
| AF-A0A7X6AIZ7-F1-model_v4 | deleted | 0.9495 | 55 | 157 |
|
| AF-A0A2Z3GJM8-F1-model_v4 | (2Fe-2S)-binding protein | 0.9458 | 79 | 155 |
GO:0016020
GO:0046872 GO:0051537 |
| AF-A0A4P5T2I9-F1-model_v4 | Rieske domain-containing protein | 0.9377 | 79 | 155 |
GO:0046872
GO:0051537 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar