F413574

General Info

Members Datasets Scaffolds Average Seq Length
338 201 338 157

Family's Representative Sequence

Representative Sequence 3300031711|Ga0265314_10130158|Ga0265314_101301582
Length 173
Sequence METEPEGRVALVLLSRASSVTKVNREGAPFDRRSFLDAVLAVGFVSTAAAIAYPVSRFLVPPASGEPITNSVVAAKVSALRPNSGLLFQFGTKPGIVVRTADGDVRAFSAVCTHLDCTVQFKSDTSQLWCACHNGTYDLAGNVVSGPPPRGLEQFSVNLRGEPGEEDIVVTRS

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
111 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
115 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
116 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
117 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
118 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
119 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
120 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
121 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
122 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
123 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
124 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
125 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
126 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
127 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
128 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
129 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
130 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
131 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
132 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
133 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
134 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
135 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
136 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
137 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
138 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
139 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
140 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
141 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
142 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
143 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
144 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
146 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
147 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
148 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
149 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
150 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
151 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
152 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
153 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
154 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
155 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
156 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
157 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
158 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
159 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
160 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
161 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
162 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
163 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
164 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
165 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
166 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
167 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
168 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
169 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
170 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
171 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
172 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
173 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
174 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
175 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
176 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
177 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
178 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
179 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
180 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
181 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
182 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
183 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
184 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
185 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
186 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
187 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
189 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
190 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
191 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
192 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
193 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
194 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
195 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
196 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
197 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
198 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
199 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
200 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
201 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.44
Rhizosphere 95.56
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10072310 3300005290 Bacteria 4802
2 Ga0070676_10764848 3300005328 Bacteria 710
3 Ga0070690_100327455 3300005330 Bacteria 1106
4 Ga0070670_100071134 3300005331 Bacteria 2986
5 Ga0070666_10038092 3300005335 Bacteria 3198
6 Ga0068868_100108839 3300005338 Bacteria 2250
7 Ga0068868_100169552 3300005338 Bacteria 1807
8 Ga0070689_100026836 3300005340 Bacteria 4338
9 Ga0070689_100120317 3300005340 Bacteria 2096
10 Ga0070687_100167453 3300005343 Bacteria 1305
11 Ga0070661_100849578 3300005344 Unclassified 751
12 Ga0070669_100019422 3300005353 Bacteria 4853
13 Ga0070671_100009153 3300005355 Bacteria 7949
14 Ga0070674_101099591 3300005356 Bacteria 702
15 Ga0070673_101604380 3300005364 Unclassified 615
16 Ga0070688_100270799 3300005365 Bacteria 1216
17 Ga0070688_100478635 3300005365 Bacteria 936
18 Ga0070659_100403277 3300005366 Bacteria 1155
19 Ga0070659_101072632 3300005366 Unclassified 709
20 Ga0070667_100064930 3300005367 Bacteria 3098
21 Ga0070694_101015407 3300005444 Bacteria 689
22 Ga0070708_100020714 3300005445 Bacteria 5552
23 Ga0070663_100757959 3300005455 Bacteria 829
24 Ga0070662_100212508 3300005457 Bacteria 1540
25 Ga0070662_100700830 3300005457 Bacteria 857
26 Ga0070662_100996461 3300005457 Bacteria 717
27 Ga0068867_101925458 3300005459 Unclassified 558
28 Ga0070685_11037541 3300005466 Viruses 617
29 Ga0070706_100263348 3300005467 Bacteria 1609
30 Ga0070698_100999184 3300005471 Unclassified 784
31 Ga0070672_100008704 3300005543 Bacteria 6962
32 Ga0070686_100003183 3300005544 Bacteria 8988
33 Ga0070686_100380268 3300005544 Bacteria 1069
34 Ga0070686_100520047 3300005544 Bacteria 926
35 Ga0070695_101254675 3300005545 Bacteria 611
36 Ga0070696_100268210 3300005546 Bacteria 1297
37 Ga0070665_100103841 3300005548 Bacteria 2845
38 Ga0070665_100114854 3300005548 Unclassified 2695
39 Ga0068855_100431947 3300005563 Bacteria 1439
40 Ga0070664_100272863 3300005564 Unclassified 1524
41 Ga0068857_100299674 3300005577 Bacteria 1482
42 Ga0068854_100014840 3300005578 Bacteria 5143
43 Ga0070702_100282731 3300005615 Unclassified 1140
44 Ga0068859_100008196 3300005617 Bacteria 10598
45 Ga0068859_100057495 3300005617 Bacteria 3918
46 Ga0068859_100777784 3300005617 Bacteria 1046
47 Ga0068859_101147290 3300005617 Viruses 855
48 Ga0068864_100000964 3300005618 Bacteria 24139
49 Ga0068861_100427796 3300005719 Bacteria 1181
50 Ga0068861_100485155 3300005719 Bacteria 1114
51 Ga0068863_100002434 3300005841 Bacteria 18486
52 Ga0068863_100415252 3300005841 Unclassified 1318
53 Ga0068863_101902101 3300005841 Unclassified 605
54 Ga0068858_100061219 3300005842 Bacteria 3480
55 Ga0068858_100236708 3300005842 Unclassified 1731
56 Ga0068858_100718163 3300005842 Unclassified 973
57 Ga0068858_100827883 3300005842 Bacteria 903
58 Ga0068860_100531066 3300005843 Bacteria 1177
59 Ga0068862_100010886 3300005844 Bacteria 7510
60 Ga0068862_100224185 3300005844 Bacteria 1703
61 Ga0068862_101441836 3300005844 Unclassified 693
62 Ga0070717_10185085 3300006028 Unclassified 1817
63 Ga0070712_100975580 3300006175 Bacteria 733
64 Ga0097621_100183332 3300006237 Bacteria 1810
65 Ga0068871_100257628 3300006358 Unclassified 1521
66 Ga0068871_100575701 3300006358 Unclassified 1022
67 Ga0068871_100752656 3300006358 Unclassified 896
68 Ga0075428_101081714 3300006844 Bacteria 847
69 Ga0075434_100024241 3300006871 Bacteria 5930
70 Ga0075434_100572401 3300006871 Unclassified 1149
71 Ga0075429_100815940 3300006880 Bacteria 817
72 Ga0068865_100697704 3300006881 Unclassified 867
73 Ga0075436_100151817 3300006914 Bacteria 1630
74 Ga0075436_100383475 3300006914 Unclassified 1016
75 Ga0097620_100008196 3300006931 Bacteria 10598
76 Ga0097620_100057494 3300006931 Bacteria 3918
77 Ga0097620_100777776 3300006931 Bacteria 1046
78 Ga0097620_101147254 3300006931 Viruses 855
79 Ga0075435_100009598 3300007076 Bacteria 7022
80 Ga0075435_100049977 3300007076 Bacteria 3364
81 Ga0075435_100232478 3300007076 Bacteria 1566
82 Ga0105240_10139109 3300009093 Unclassified 2905
83 Ga0111539_10082636 3300009094 Unclassified 3778
84 Ga0111539_10090253 3300009094 Unclassified 3601
85 Ga0111539_10373234 3300009094 Bacteria 1660
86 Ga0111539_10754934 3300009094 Bacteria 1132
87 Ga0105245_10791901 3300009098 Bacteria 986
88 Ga0105245_11011142 3300009098 Unclassified 876
89 Ga0114129_10735488 3300009147 Bacteria 1264
90 Ga0105243_10223734 3300009148 Bacteria 1665
91 Ga0105243_10654837 3300009148 Bacteria 1018
92 Ga0105241_10136420 3300009174 Bacteria 1993
93 Ga0105241_11113104 3300009174 Unclassified 744
94 Ga0105242_10124624 3300009176 Unclassified 2216
95 Ga0105242_10634704 3300009176 Unclassified 1037
96 Ga0105242_10670710 3300009176 Unclassified 1011
97 Ga0105248_10001088 3300009177 Bacteria 30070
98 Ga0105248_10046363 3300009177 Bacteria 4871
99 Ga0105248_10193581 3300009177 Bacteria 2291
100 Ga0105248_10227530 3300009177 Bacteria 2099
101 Ga0105248_10246039 3300009177 Bacteria 2013
102 Ga0105248_10340604 3300009177 Unclassified 1688
103 Ga0105248_10760241 3300009177 Bacteria 1094
104 Ga0105248_11112561 3300009177 Unclassified 893
105 Ga0105248_11222921 3300009177 Bacteria 849
106 Ga0105248_11238787 3300009177 Unclassified 844
107 Ga0105249_11243899 3300009553 Unclassified 816
108 Ga0105249_12283851 3300009553 Unclassified 614
109 Ga0105246_10545002 3300011119 Bacteria 993
110 Ga0157374_10093938 3300013296 Bacteria 2865
111 Ga0163162_10584008 3300013306 Bacteria 1244
112 Ga0163162_11119240 3300013306 Bacteria 892
113 Ga0163162_12609691 3300013306 Unclassified 581
114 Ga0157372_11265341 3300013307 Bacteria 852
115 Ga0157375_11266554 3300013308 Unclassified 866
116 Ga0163163_10005329 3300014325 Bacteria 11110
117 Ga0163163_10326328 3300014325 Bacteria 1589
118 Ga0163163_10512134 3300014325 Bacteria 1262
119 Ga0163163_10594670 3300014325 Unclassified 1170
120 Ga0157380_11989104 3300014326 Unclassified 643
121 Ga0157377_10043151 3300014745 Bacteria 2509
122 Ga0157379_10032465 3300014968 Bacteria 4655
123 Ga0157379_10050434 3300014968 Bacteria 3715
124 Ga0157379_10096766 3300014968 Bacteria 2649
125 Ga0157379_10706066 3300014968 Unclassified 947
126 Ga0157379_12115171 3300014968 Bacteria 558
127 Ga0157376_10449621 3300014969 Bacteria 1256
128 Ga0207710_10008884 3300025900 Bacteria 4227
129 Ga0207680_10027287 3300025903 Bacteria 3178
130 Ga0207699_10126541 3300025906 Bacteria 1660
131 Ga0207699_10543772 3300025906 Unclassified 842
132 Ga0207654_10093241 3300025911 Bacteria 1841
133 Ga0207654_10310552 3300025911 Unclassified 1075
134 Ga0207695_11422531 3300025913 Unclassified 574
135 Ga0207662_10455368 3300025918 Bacteria 875
136 Ga0207652_11285491 3300025921 Bacteria 634
137 Ga0207646_10650457 3300025922 Unclassified 944
138 Ga0207646_10788605 3300025922 Unclassified 847
139 Ga0207681_10004734 3300025923 Bacteria 8372
140 Ga0207650_10214707 3300025925 Bacteria 1546
141 Ga0207659_10000763 3300025926 Bacteria 19113
142 Ga0207659_11269017 3300025926 Bacteria 633
143 Ga0207687_11136805 3300025927 Unclassified 671
144 Ga0207644_10028545 3300025931 Bacteria 3864
145 Ga0207690_10258987 3300025932 Bacteria 1347
146 Ga0207706_10390938 3300025933 Unclassified 1206
147 Ga0207706_10451741 3300025933 Bacteria 1111
148 Ga0207706_10483032 3300025933 Bacteria 1070
149 Ga0207686_10598363 3300025934 Unclassified 867
150 Ga0207709_10236476 3300025935 Bacteria 1326
151 Ga0207709_10434310 3300025935 Bacteria 1011
152 Ga0207709_10455729 3300025935 Unclassified 989
153 Ga0207670_10042556 3300025936 Bacteria 2994
154 Ga0207670_10181022 3300025936 Bacteria 1588
155 Ga0207669_10208712 3300025937 Bacteria 1424
156 Ga0207704_10211520 3300025938 Bacteria 1428
157 Ga0207704_10311802 3300025938 Bacteria 1210
158 Ga0207691_10012289 3300025940 Bacteria 8208
159 Ga0207711_10022795 3300025941 Bacteria 5239
160 Ga0207711_10089321 3300025941 Bacteria 2707
161 Ga0207711_10354546 3300025941 Unclassified 1359
162 Ga0207711_10861498 3300025941 Bacteria 843
163 Ga0207711_10868799 3300025941 Bacteria 839
164 Ga0207711_11104423 3300025941 Unclassified 734
165 Ga0207689_10217752 3300025942 Bacteria 1577
166 Ga0207689_11551201 3300025942 Unclassified 552
167 Ga0207661_11206049 3300025944 Unclassified 696
168 Ga0207679_11283077 3300025945 Unclassified 672
169 Ga0207651_10097702 3300025960 Unclassified 2169
170 Ga0207668_10040292 3300025972 Bacteria 3151
171 Ga0207640_10271275 3300025981 Bacteria 1327
172 Ga0207658_10084682 3300025986 Bacteria 2440
173 Ga0207658_10591902 3300025986 Bacteria 996
174 Ga0207677_10158459 3300026023 Bacteria 1755
175 Ga0207677_10428609 3300026023 Bacteria 1128
176 Ga0207677_11754955 3300026023 Unclassified 576
177 Ga0207703_10009474 3300026035 Bacteria 7646
178 Ga0207703_10163807 3300026035 Bacteria 1949
179 Ga0207703_10316148 3300026035 Bacteria 1429
180 Ga0207703_10716431 3300026035 Unclassified 952
181 Ga0207639_10975566 3300026041 Unclassified 793
182 Ga0207708_10209550 3300026075 Bacteria 1557
183 Ga0207641_10003379 3300026088 Bacteria 14167
184 Ga0207641_12038402 3300026088 Unclassified 575
185 Ga0207676_10004488 3300026095 Bacteria 9865
186 Ga0207676_10516926 3300026095 Unclassified 1136
187 Ga0207674_10067684 3300026116 Bacteria 3595
188 Ga0207674_10723809 3300026116 Bacteria 960
189 Ga0207675_100042528 3300026118 Bacteria 4243
190 Ga0207683_11603091 3300026121 Unclassified 600
191 Ga0207428_10712900 3300027907 Bacteria 717
192 Ga0268266_10061758 3300028379 Bacteria 3232
193 Ga0268266_10080103 3300028379 Bacteria 2845
194 Ga0268265_10005771 3300028380 Bacteria 8451
195 Ga0268265_10209555 3300028380 Bacteria 1697
196 Ga0268264_10358866 3300028381 Bacteria 1389
197 Ga0268264_10816454 3300028381 Bacteria 932
198 Ga0268264_11240188 3300028381 Bacteria 755
199 Ga0265328_10296008 3300031239 Bacteria 624
200 Ga0265316_10009045 3300031344 Bacteria 9180
201 Ga0265316_10681302 3300031344 Unclassified 725
202 Ga0265314_10130158 3300031711 Bacteria 1571
203 Ga0373930_0000449 3300034816 Bacteria 5514
204 Ga0373948_0073392 3300034817 Bacteria 770
205 Ga0373958_0005195 3300034819 Bacteria 1965
206 Ga0373959_0011204 3300034820 Bacteria 1579
207 Ga0373938_0003511 3300034957 Bacteria 2574
208 Ga0373926_0069518 3300035083 Bacteria 1292
209 Ga0373928_0021552 3300035084 Bacteria 1360
210 Ga0373929_0001196 3300035085 Bacteria 5023
211 Ga0373940_0001329 3300035088 Bacteria 4408
212 Ga0373944_0337166 3300035089 Bacteria 572
213 Ga0373949_0000694 3300035090 Bacteria 10940
214 Ga0373951_0000448 3300035091 Bacteria 11950
215 Ga0373932_0000543 3300035112 Bacteria 11551
216 Ga0373932_0140477 3300035112 Unclassified 821
217 Ga0373939_0001831 3300035114 Bacteria 5113
218 Ga0373939_0028167 3300035114 Bacteria 1597
219 Ga0373941_0000759 3300035115 Bacteria 6603
220 Ga0373941_0071274 3300035115 Bacteria 1154
221 Ga0373954_0014825 3300035118 Bacteria 3478
222 Ga0373956_0035897 3300035119 Bacteria 2187
223 Ga0373960_0000139 3300035121 Bacteria 12064
224 Ga0373946_0236633 3300035171 Bacteria 887
225 Ga0373946_0488786 3300035171 Unclassified 630
226 Ga0373955_0044565 3300035172 Bacteria 2390
227 Ga0373955_0269048 3300035172 Bacteria 1024
228 Ga0373942_0003783 3300035207 Bacteria 3540
229 Ga0373942_0256569 3300035207 Unclassified 596
230 Ga0373962_0005280 3300035242 Bacteria 3126
231 Ga0373924_0137019 3300035410 Unclassified 1067
232 Ga0373931_0002779 3300035691 Bacteria 7791
233 Ga0373927_0002589 3300035695 Bacteria 13188
234 Ga0373933_0099338 3300035724 Bacteria 1804
235 Ga0373947_0061068 3300035725 Bacteria 2290
236 Ga0373947_0184095 3300035725 Unclassified 1361
237 Ga0373947_0508545 3300035725 Viruses 819
238 Ga0373937_0074214 3300036401 Bacteria 3138
239 Ga0373937_0081591 3300036401 Bacteria 2992
240 Ga0373937_0210641 3300036401 Bacteria 1829
241 Ga0373937_0293440 3300036401 Unclassified 1536
242 Ga0373937_0332283 3300036401 Bacteria 1439
243 Ga0373925_0031228 3300037068 Bacteria 3914
244 Ga0373925_0452274 3300037068 Unclassified 1052
245 Ga0373925_0723791 3300037068 Viruses 820
246 Ga0439450_032847 3300042008 Unclassified 1174
247 Ga0451576_0055497 3300045051 Bacteria 4144
248 Ga0451576_0195265 3300045051 Bacteria 2114
249 Ga0451576_1028292 3300045051 Unclassified 863
250 Ga0451576_1330221 3300045051 Unclassified 749
251 Ga0495603_0294774 3300046455 Bacteria 932
252 Ga0495651_0054157 3300046462 Bacteria 3087
253 Ga0495651_0477878 3300046462 Bacteria 801
254 Ga0495580_0010238 3300046472 Bacteria 7313
255 Ga0495580_0184301 3300046472 Unclassified 1441
256 Ga0495580_0259226 3300046472 Unclassified 1189
257 Ga0495580_0798102 3300046472 Unclassified 612
258 Ga0495662_0134244 3300046476 Unclassified 1217
259 Ga0495608_0212083 3300046511 Bacteria 1217
260 Ga0495608_0403268 3300046511 Bacteria 836
261 Ga0495628_0303940 3300046516 Viruses 1180
262 Ga0495628_0405236 3300046516 Bacteria 996
263 Ga0495630_0636161 3300046517 Viruses 817
264 Ga0495666_0100753 3300046526 Unclassified 1361
265 Ga0495665_0087342 3300046531 Bacteria 1639
266 Ga0495640_0047532 3300046533 Viruses 2969
267 Ga0495586_0296676 3300046535 Viruses 926
268 Ga0495621_0161376 3300046539 Bacteria 887
269 Ga0495645_0003437 3300046543 Bacteria 10737
270 Ga0495645_0259438 3300046543 Viruses 1152
271 Ga0495633_0112235 3300046558 Bacteria 1264
272 Ga0495667_0050370 3300046559 Bacteria 2750
273 Ga0495667_0232287 3300046559 Unclassified 1176
274 Ga0495667_0489580 3300046559 Unclassified 771
275 Ga0495656_0064392 3300046615 Bacteria 1610
276 Ga0495635_0196247 3300046663 Bacteria 1370
277 Ga0495635_0265106 3300046663 Unclassified 1156
278 Ga0495646_0196041 3300046680 Viruses 1102
279 Ga0495647_0203578 3300046681 Bacteria 869
280 Ga0495658_0254854 3300046683 Bacteria 1104
281 Ga0495613_0099411 3300046689 Bacteria 2102
282 Ga0495613_0556453 3300046689 Unclassified 767
283 Ga0495613_0583375 3300046689 Unclassified 745
284 Ga0495581_0279724 3300047315 Bacteria 976
285 Ga0495674_0014655 3300047319 Bacteria 7334
286 Ga0495674_0085943 3300047319 Bacteria 2694
287 Ga0495674_0222234 3300047319 Unclassified 1561
288 Ga0495676_0527050 3300047321 Viruses 774
289 Ga0495680_0252487 3300047322 Bacteria 1250
290 Ga0495675_0383699 3300047444 Unclassified 821
291 Ga0495675_0476387 3300047444 Bacteria 719
292 Ga0495684_0042573 3300047471 Bacteria 3478
293 Ga0495684_0073980 3300047471 Bacteria 2588
294 Ga0495684_0323492 3300047471 Bacteria 1102
295 Ga0495602_0419010 3300048088 Bacteria 951
296 Ga0495602_0432255 3300048088 Bacteria 933
297 Ga0495614_0052719 3300048089 Bacteria 1744
298 Ga0496101_0954424 3300048904 Bacteria 675
299 Ga0496104_0328934 3300048907 Bacteria 1441
300 Ga0496104_0372410 3300048907 Bacteria 1341
301 Ga0496106_0028646 3300048909 Bacteria 4149
302 Ga0496106_0224070 3300048909 Bacteria 1500
303 Ga0496107_0362376 3300048910 Bacteria 1079
304 Ga0496108_0085822 3300048911 Bacteria 2672
305 Ga0496109_0259387 3300048912 Bacteria 1637
306 Ga0496111_0168576 3300048914 Bacteria 1627
307 Ga0496112_0004416 3300048915 Bacteria 11907
308 Ga0496113_0009434 3300048916 Bacteria 6402
309 Ga0496113_0421499 3300048916 Bacteria 1072
310 Ga0496114_0623057 3300048917 Bacteria 950
311 Ga0496114_0642940 3300048917 Unclassified 933
312 Ga0496114_0958084 3300048917 Unclassified 738
313 Ga0501039_1124738 3300049575 Unclassified 608
314 Ga0501076_0130057 3300049592 Bacteria 2042
315 Ga0501079_0097528 3300049741 Bacteria 2279
316 Ga0501081_0575750 3300049743 Bacteria 842
317 nmdc:mga05p37_823623_c1 3300050507 Bacteria 1012
318 nmdc:mga09592_423472_c1 3300050508 Bacteria 1150
319 nmdc:mga09592_518523_c1 3300050508 Bacteria 1025
320 nmdc:mga0qj67_619979_c1 3300050509 Unclassified 864
321 nmdc:mga08y16_320319_c1 3300050511 Bacteria 1596
322 nmdc:mga0n895_761_c1 3300050512 Bacteria 22851
323 nmdc:mga0rr50_244596_c1 3300050513 Bacteria 1488
324 nmdc:mga0rr50_261_c1 3300050513 Bacteria 28462
325 nmdc:mga0rr50_4604_c1 3300050513 Bacteria 8122
326 nmdc:mga0rr50_54483_c1 3300050513 Bacteria 2980
327 nmdc:mga0rr50_7495_c1 3300050513 Bacteria 6736
328 nmdc:mga08x19_1054517_c1 3300050514 Unclassified 577
329 nmdc:mga08x19_1320_c1 3300050514 Bacteria 15374
330 nmdc:mga08x19_145982_c1 3300050514 Unclassified 1600
331 nmdc:mga08x19_203805_c1 3300050514 Unclassified 1357
332 nmdc:mga08x19_56092_c1 3300050514 Bacteria 2542
333 nmdc:mga08x19_76990_c1 3300050514 Bacteria 2184
334 nmdc:mga08x19_92450_c1 3300050514 Bacteria 1998
335 Ga0495601_0035263 3300053077 Unclassified 3122
336 Ga0495595_0363218 3300053084 Bacteria 732
337 Ga0501082_0725483 3300060353 Bacteria 870
338 Ga0530510_1376397 3300061734 Bacteria 541

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025922 Ga0207646_10650457 Ga0207646_106504572 141
2 3300046472 Ga0495580_0184301 Ga0495580_0184301_154_585 141
3 3300031344 Ga0265316_10009045 Ga0265316_100090458 145
4 3300031344 Ga0265316_10681302 Ga0265316_106813021 145
5 3300005457 Ga0070662_100996461 Ga0070662_1009964611 146
6 3300014325 Ga0163163_10594670 Ga0163163_105946701 146
7 3300049575 Ga0501039_1124738 Ga0501039_1124738_151_591 146
8 3300049592 Ga0501076_0130057 Ga0501076_0130057_879_1319 146
9 3300049741 Ga0501079_0097528 Ga0501079_0097528_1107_1547 146
10 3300049743 Ga0501081_0575750 Ga0501081_0575750_164_604 146
11 3300060353 Ga0501082_0725483 Ga0501082_0725483_223_663 146
12 3300061734 Ga0530510_1376397 Ga0530510_1376397_55_495 146
13 3300005340 Ga0070689_100120317 Ga0070689_1001203172 147
14 3300005365 Ga0070688_100270799 Ga0070688_1002707992 147
15 3300005617 Ga0068859_100057495 Ga0068859_1000574952 147
16 3300006880 Ga0075429_100815940 Ga0075429_1008159402 147
17 3300006931 Ga0097620_100057494 Ga0097620_1000574946 147
18 3300009094 Ga0111539_10082636 Ga0111539_100826363 147
19 3300009094 Ga0111539_10090253 Ga0111539_100902535 147
20 3300009094 Ga0111539_10373234 Ga0111539_103732344 147
21 3300009553 Ga0105249_11243899 Ga0105249_112438991 147
22 3300025936 Ga0207670_10042556 Ga0207670_100425564 147
23 3300027907 Ga0207428_10712900 Ga0207428_107129002 147
24 3300035112 Ga0373932_0140477 Ga0373932_0140477_292_738 147
25 3300050508 nmdc:mga09592_423472_c1 nmdc:mga09592_423472_c1_490_933 147
26 3300050508 nmdc:mga09592_518523_c1 nmdc:mga09592_518523_c1_62_508 147
27 3300050509 nmdc:mga0qj67_619979_c1 nmdc:mga0qj67_619979_c1_390_836 147
28 3300050511 nmdc:mga08y16_320319_c1 nmdc:mga08y16_320319_c1_21_467 147
29 3300005457 Ga0070662_100212508 Ga0070662_1002125082 148
30 3300005546 Ga0070696_100268210 Ga0070696_1002682102 148
31 3300025933 Ga0207706_10390938 Ga0207706_103909382 148
32 3300035083 Ga0373926_0069518 Ga0373926_0069518_799_1251 148
33 3300035118 Ga0373954_0014825 Ga0373954_0014825_1329_1781 148
34 3300035119 Ga0373956_0035897 Ga0373956_0035897_893_1345 148
35 3300035172 Ga0373955_0044565 Ga0373955_0044565_222_674 148
36 3300035695 Ga0373927_0002589 Ga0373927_0002589_9629_10081 148
37 3300035724 Ga0373933_0099338 Ga0373933_0099338_296_748 148
38 3300035725 Ga0373947_0061068 Ga0373947_0061068_1240_1692 148
39 3300036401 Ga0373937_0074214 Ga0373937_0074214_1914_2366 148
40 3300037068 Ga0373925_0031228 Ga0373925_0031228_1906_2358 148
41 3300046462 Ga0495651_0054157 Ga0495651_0054157_1085_1537 148
42 3300046472 Ga0495580_0010238 Ga0495580_0010238_3497_3949 148
43 3300046511 Ga0495608_0212083 Ga0495608_0212083_100_552 148
44 3300046663 Ga0495635_0196247 Ga0495635_0196247_811_1263 148
45 3300046689 Ga0495613_0099411 Ga0495613_0099411_1532_1984 148
46 3300047319 Ga0495674_0085943 Ga0495674_0085943_2155_2607 148
47 3300047471 Ga0495684_0073980 Ga0495684_0073980_622_1074 148
48 3300048088 Ga0495602_0432255 Ga0495602_0432255_156_608 148
49 3300005330 Ga0070690_100327455 Ga0070690_1003274551 149
50 3300005459 Ga0068867_101925458 Ga0068867_1019254581 149
51 3300005466 Ga0070685_11037541 Ga0070685_110375411 149
52 3300005545 Ga0070695_101254675 Ga0070695_1012546751 149
53 3300005615 Ga0070702_100282731 Ga0070702_1002827312 149
54 3300005617 Ga0068859_101147290 Ga0068859_1011472902 149
55 3300005842 Ga0068858_100718163 Ga0068858_1007181631 149
56 3300006931 Ga0097620_101147254 Ga0097620_1011472541 149
57 3300009093 Ga0105240_10139109 Ga0105240_101391091 149
58 3300009098 Ga0105245_10791901 Ga0105245_107919012 149
59 3300009174 Ga0105241_11113104 Ga0105241_111131042 149
60 3300009177 Ga0105248_10340604 Ga0105248_103406042 149
61 3300009177 Ga0105248_10760241 Ga0105248_107602412 149
62 3300011119 Ga0105246_10545002 Ga0105246_105450022 149
63 3300013306 Ga0163162_12609691 Ga0163162_126096911 149
64 3300013307 Ga0157372_11265341 Ga0157372_112653412 149
65 3300014325 Ga0163163_10326328 Ga0163163_103263281 149
66 3300014968 Ga0157379_10706066 Ga0157379_107060661 149
67 3300014969 Ga0157376_10449621 Ga0157376_104496212 149
68 3300025911 Ga0207654_10310552 Ga0207654_103105521 149
69 3300025913 Ga0207695_11422531 Ga0207695_114225311 149
70 3300025941 Ga0207711_10354546 Ga0207711_103545462 149
71 3300025944 Ga0207661_11206049 Ga0207661_112060491 149
72 3300025960 Ga0207651_10097702 Ga0207651_100977022 149
73 3300026023 Ga0207677_10158459 Ga0207677_101584593 149
74 3300026035 Ga0207703_10316148 Ga0207703_103161482 149
75 3300026095 Ga0207676_10516926 Ga0207676_105169262 149
76 3300031239 Ga0265328_10296008 Ga0265328_102960081 149
77 3300035089 Ga0373944_0337166 Ga0373944_0337166_25_486 149
78 3300035171 Ga0373946_0236633 Ga0373946_0236633_106_567 149
79 3300035725 Ga0373947_0508545 Ga0373947_0508545_303_764 149
80 3300036401 Ga0373937_0210641 Ga0373937_0210641_886_1347 149
81 3300037068 Ga0373925_0723791 Ga0373925_0723791_165_626 149
82 3300045051 Ga0451576_0195265 Ga0451576_0195265_487_963 149
83 3300046462 Ga0495651_0477878 Ga0495651_0477878_294_755 149
84 3300046476 Ga0495662_0134244 Ga0495662_0134244_412_873 149
85 3300046511 Ga0495608_0403268 Ga0495608_0403268_237_698 149
86 3300046516 Ga0495628_0303940 Ga0495628_0303940_155_616 149
87 3300046517 Ga0495630_0636161 Ga0495630_0636161_77_538 149
88 3300046526 Ga0495666_0100753 Ga0495666_0100753_75_695 149
89 3300046531 Ga0495665_0087342 Ga0495665_0087342_977_1438 149
90 3300046533 Ga0495640_0047532 Ga0495640_0047532_2121_2582 149
91 3300046535 Ga0495586_0296676 Ga0495586_0296676_332_793 149
92 3300046543 Ga0495645_0259438 Ga0495645_0259438_204_665 149
93 3300046559 Ga0495667_0050370 Ga0495667_0050370_607_1068 149
94 3300046680 Ga0495646_0196041 Ga0495646_0196041_454_915 149
95 3300047319 Ga0495674_0014655 Ga0495674_0014655_5628_6089 149
96 3300047321 Ga0495676_0527050 Ga0495676_0527050_165_626 149
97 3300047444 Ga0495675_0383699 Ga0495675_0383699_227_688 149
98 3300047471 Ga0495684_0042573 Ga0495684_0042573_1387_1848 149
99 3300048089 Ga0495614_0052719 Ga0495614_0052719_50_511 149
100 3300053084 Ga0495595_0363218 Ga0495595_0363218_187_648 149
101 3300005844 Ga0068862_100224185 Ga0068862_1002241852 150
102 3300025938 Ga0207704_10211520 Ga0207704_102115202 150
103 3300025972 Ga0207668_10040292 Ga0207668_100402922 150
104 3300026075 Ga0207708_10209550 Ga0207708_102095503 150
105 3300028380 Ga0268265_10209555 Ga0268265_102095552 150
106 3300005328 Ga0070676_10764848 Ga0070676_107648482 151
107 3300005356 Ga0070674_101099591 Ga0070674_1010995912 151
108 3300006175 Ga0070712_100975580 Ga0070712_1009755802 151
109 3300025906 Ga0207699_10126541 Ga0207699_101265412 151
110 3300050514 nmdc:mga08x19_1054517_c1 nmdc:mga08x19_1054517_c1_40_504 151
111 3300050514 nmdc:mga08x19_92450_c1 nmdc:mga08x19_92450_c1_362_850 151
112 3300006871 Ga0075434_100024241 Ga0075434_1000242415 152
113 3300007076 Ga0075435_100049977 Ga0075435_1000499773 152
114 3300009176 Ga0105242_10670710 Ga0105242_106707102 152
115 3300048917 Ga0496114_0642940 Ga0496114_0642940_34_510 152
116 3300006028 Ga0070717_10185085 Ga0070717_101850852 153
117 3300006844 Ga0075428_101081714 Ga0075428_1010817141 153
118 3300025922 Ga0207646_10788605 Ga0207646_107886052 153
119 3300035725 Ga0373947_0184095 Ga0373947_0184095_94_594 153
120 3300036401 Ga0373937_0332283 Ga0373937_0332283_320_823 153
121 3300037068 Ga0373925_0452274 Ga0373925_0452274_528_1028 153
122 3300046472 Ga0495580_0259226 Ga0495580_0259226_113_613 153
123 3300046559 Ga0495667_0232287 Ga0495667_0232287_629_1132 153
124 3300047444 Ga0495675_0476387 Ga0495675_0476387_91_594 153
125 3300005445 Ga0070708_100020714 Ga0070708_1000207142 154
126 3300009177 Ga0105248_10046363 Ga0105248_100463634 154
127 3300046455 Ga0495603_0294774 Ga0495603_0294774_283_765 154
128 3300005455 Ga0070663_100757959 Ga0070663_1007579591 155
129 3300005842 Ga0068858_100827883 Ga0068858_1008278831 155
130 3300005844 Ga0068862_101441836 Ga0068862_1014418361 155
131 3300009553 Ga0105249_12283851 Ga0105249_122838511 155
132 3300014968 Ga0157379_10032465 Ga0157379_100324652 155
133 3300014968 Ga0157379_12115171 Ga0157379_121151711 155
134 3300026035 Ga0207703_10163807 Ga0207703_101638071 155
135 3300028381 Ga0268264_10816454 Ga0268264_108164541 155
136 3300042008 Ga0439450_032847 Ga0439450_032847_469_954 155
137 3300005335 Ga0070666_10038092 Ga0070666_100380922 156
138 3300005338 Ga0068868_100108839 Ga0068868_1001088393 156
139 3300005338 Ga0068868_100169552 Ga0068868_1001695522 156
140 3300005340 Ga0070689_100026836 Ga0070689_1000268363 156
141 3300005343 Ga0070687_100167453 Ga0070687_1001674532 156
142 3300005353 Ga0070669_100019422 Ga0070669_1000194222 156
143 3300005355 Ga0070671_100009153 Ga0070671_1000091536 156
144 3300005364 Ga0070673_101604380 Ga0070673_1016043801 156
145 3300005365 Ga0070688_100478635 Ga0070688_1004786352 156
146 3300005367 Ga0070667_100064930 Ga0070667_1000649302 156
147 3300005444 Ga0070694_101015407 Ga0070694_1010154071 156
148 3300005457 Ga0070662_100700830 Ga0070662_1007008302 156
149 3300005543 Ga0070672_100008704 Ga0070672_1000087046 156
150 3300005544 Ga0070686_100380268 Ga0070686_1003802682 156
151 3300005563 Ga0068855_100431947 Ga0068855_1004319472 156
152 3300005617 Ga0068859_100777784 Ga0068859_1007777842 156
153 3300005841 Ga0068863_100002434 Ga0068863_10000243418 156
154 3300005841 Ga0068863_100415252 Ga0068863_1004152521 156
155 3300005844 Ga0068862_100010886 Ga0068862_1000108866 156
156 3300006358 Ga0068871_100752656 Ga0068871_1007526562 156
157 3300006881 Ga0068865_100697704 Ga0068865_1006977041 156
158 3300006914 Ga0075436_100151817 Ga0075436_1001518173 156
159 3300006914 Ga0075436_100383475 Ga0075436_1003834751 156
160 3300006931 Ga0097620_100777776 Ga0097620_1007777762 156
161 3300007076 Ga0075435_100232478 Ga0075435_1002324782 156
162 3300009094 Ga0111539_10754934 Ga0111539_107549342 156
163 3300009148 Ga0105243_10223734 Ga0105243_102237342 156
164 3300009176 Ga0105242_10634704 Ga0105242_106347042 156
165 3300009177 Ga0105248_10193581 Ga0105248_101935812 156
166 3300013306 Ga0163162_10584008 Ga0163162_105840082 156
167 3300014326 Ga0157380_11989104 Ga0157380_119891042 156
168 3300014968 Ga0157379_10096766 Ga0157379_100967662 156
169 3300025906 Ga0207699_10543772 Ga0207699_105437722 156
170 3300025921 Ga0207652_11285491 Ga0207652_112854912 156
171 3300025923 Ga0207681_10004734 Ga0207681_100047346 156
172 3300025931 Ga0207644_10028545 Ga0207644_100285452 156
173 3300025933 Ga0207706_10451741 Ga0207706_104517412 156
174 3300025935 Ga0207709_10236476 Ga0207709_102364762 156
175 3300025935 Ga0207709_10455729 Ga0207709_104557291 156
176 3300025936 Ga0207670_10181022 Ga0207670_101810222 156
177 3300025937 Ga0207669_10208712 Ga0207669_102087122 156
178 3300025938 Ga0207704_10311802 Ga0207704_103118022 156
179 3300025940 Ga0207691_10012289 Ga0207691_100122896 156
180 3300025986 Ga0207658_10084682 Ga0207658_100846822 156
181 3300026023 Ga0207677_10428609 Ga0207677_104286092 156
182 3300026023 Ga0207677_11754955 Ga0207677_117549551 156
183 3300026035 Ga0207703_10716431 Ga0207703_107164311 156
184 3300026041 Ga0207639_10975566 Ga0207639_109755662 156
185 3300026088 Ga0207641_10003379 Ga0207641_100033796 156
186 3300026121 Ga0207683_11603091 Ga0207683_116030911 156
187 3300028380 Ga0268265_10005771 Ga0268265_100057712 156
188 3300028381 Ga0268264_10358866 Ga0268264_103588662 156
189 3300035114 Ga0373939_0028167 Ga0373939_0028167_31_507 156
190 3300035115 Ga0373941_0071274 Ga0373941_0071274_242_718 156
191 3300035207 Ga0373942_0256569 Ga0373942_0256569_32_508 156
192 3300046539 Ga0495621_0161376 Ga0495621_0161376_345_821 156
193 3300046615 Ga0495656_0064392 Ga0495656_0064392_543_1019 156
194 3300048907 Ga0496104_0372410 Ga0496104_0372410_465_941 156
195 3300048910 Ga0496107_0362376 Ga0496107_0362376_519_1001 156
196 3300050513 nmdc:mga0rr50_244596_c1 nmdc:mga0rr50_244596_c1_349_831 156
197 3300050514 nmdc:mga08x19_145982_c1 nmdc:mga08x19_145982_c1_1045_1533 156
198 3300050514 nmdc:mga08x19_203805_c1 nmdc:mga08x19_203805_c1_119_601 156
199 3300050514 nmdc:mga08x19_76990_c1 nmdc:mga08x19_76990_c1_1173_1661 156
200 3300005290 Ga0065712_10072310 Ga0065712_100723102 157
201 3300005331 Ga0070670_100071134 Ga0070670_1000711342 157
202 3300005344 Ga0070661_100849578 Ga0070661_1008495782 157
203 3300005366 Ga0070659_100403277 Ga0070659_1004032772 157
204 3300005366 Ga0070659_101072632 Ga0070659_1010726321 157
205 3300005467 Ga0070706_100263348 Ga0070706_1002633482 157
206 3300005471 Ga0070698_100999184 Ga0070698_1009991842 157
207 3300005544 Ga0070686_100003183 Ga0070686_1000031838 157
208 3300005544 Ga0070686_100520047 Ga0070686_1005200471 157
209 3300005548 Ga0070665_100103841 Ga0070665_1001038412 157
210 3300005548 Ga0070665_100114854 Ga0070665_1001148542 157
211 3300005564 Ga0070664_100272863 Ga0070664_1002728632 157
212 3300005577 Ga0068857_100299674 Ga0068857_1002996742 157
213 3300005578 Ga0068854_100014840 Ga0068854_1000148402 157
214 3300005617 Ga0068859_100008196 Ga0068859_1000081963 157
215 3300005618 Ga0068864_100000964 Ga0068864_10000096422 157
216 3300005719 Ga0068861_100427796 Ga0068861_1004277962 157
217 3300005719 Ga0068861_100485155 Ga0068861_1004851552 157
218 3300005841 Ga0068863_101902101 Ga0068863_1019021011 157
219 3300005842 Ga0068858_100061219 Ga0068858_1000612192 157
220 3300005842 Ga0068858_100236708 Ga0068858_1002367082 157
221 3300005843 Ga0068860_100531066 Ga0068860_1005310662 157
222 3300006237 Ga0097621_100183332 Ga0097621_1001833322 157
223 3300006358 Ga0068871_100257628 Ga0068871_1002576282 157
224 3300006358 Ga0068871_100575701 Ga0068871_1005757012 157
225 3300006871 Ga0075434_100572401 Ga0075434_1005724012 157
226 3300006931 Ga0097620_100008196 Ga0097620_1000081967 157
227 3300007076 Ga0075435_100009598 Ga0075435_1000095982 157
228 3300009098 Ga0105245_11011142 Ga0105245_110111422 157
229 3300009147 Ga0114129_10735488 Ga0114129_107354882 157
230 3300009148 Ga0105243_10654837 Ga0105243_106548371 157
231 3300009174 Ga0105241_10136420 Ga0105241_101364202 157
232 3300009176 Ga0105242_10124624 Ga0105242_101246242 157
233 3300009177 Ga0105248_10001088 Ga0105248_1000108822 157
234 3300009177 Ga0105248_10227530 Ga0105248_102275302 157
235 3300009177 Ga0105248_10246039 Ga0105248_102460393 157
236 3300009177 Ga0105248_11112561 Ga0105248_111125612 157
237 3300009177 Ga0105248_11222921 Ga0105248_112229212 157
238 3300009177 Ga0105248_11238787 Ga0105248_112387871 157
239 3300013296 Ga0157374_10093938 Ga0157374_100939382 157
240 3300013306 Ga0163162_11119240 Ga0163162_111192402 157
241 3300013308 Ga0157375_11266554 Ga0157375_112665541 157
242 3300014325 Ga0163163_10005329 Ga0163163_100053294 157
243 3300014325 Ga0163163_10512134 Ga0163163_105121342 157
244 3300014745 Ga0157377_10043151 Ga0157377_100431512 157
245 3300014968 Ga0157379_10050434 Ga0157379_100504343 157
246 3300025900 Ga0207710_10008884 Ga0207710_100088844 157
247 3300025903 Ga0207680_10027287 Ga0207680_100272873 157
248 3300025911 Ga0207654_10093241 Ga0207654_100932413 157
249 3300025918 Ga0207662_10455368 Ga0207662_104553681 157
250 3300025925 Ga0207650_10214707 Ga0207650_102147072 157
251 3300025926 Ga0207659_10000763 Ga0207659_100007633 157
252 3300025926 Ga0207659_11269017 Ga0207659_112690172 157
253 3300025927 Ga0207687_11136805 Ga0207687_111368052 157
254 3300025932 Ga0207690_10258987 Ga0207690_102589872 157
255 3300025933 Ga0207706_10483032 Ga0207706_104830322 157
256 3300025934 Ga0207686_10598363 Ga0207686_105983632 157
257 3300025935 Ga0207709_10434310 Ga0207709_104343101 157
258 3300025941 Ga0207711_10022795 Ga0207711_100227952 157
259 3300025941 Ga0207711_10089321 Ga0207711_100893213 157
260 3300025941 Ga0207711_10861498 Ga0207711_108614981 157
261 3300025941 Ga0207711_10868799 Ga0207711_108687992 157
262 3300025941 Ga0207711_11104423 Ga0207711_111044231 157
263 3300025942 Ga0207689_10217752 Ga0207689_102177521 157
264 3300025942 Ga0207689_11551201 Ga0207689_115512011 157
265 3300025945 Ga0207679_11283077 Ga0207679_112830772 157
266 3300025981 Ga0207640_10271275 Ga0207640_102712752 157
267 3300025986 Ga0207658_10591902 Ga0207658_105919022 157
268 3300026035 Ga0207703_10009474 Ga0207703_100094744 157
269 3300026088 Ga0207641_12038402 Ga0207641_120384021 157
270 3300026095 Ga0207676_10004488 Ga0207676_100044887 157
271 3300026116 Ga0207674_10067684 Ga0207674_100676842 157
272 3300026116 Ga0207674_10723809 Ga0207674_107238092 157
273 3300026118 Ga0207675_100042528 Ga0207675_1000425282 157
274 3300028379 Ga0268266_10061758 Ga0268266_100617584 157
275 3300028379 Ga0268266_10080103 Ga0268266_100801033 157
276 3300028381 Ga0268264_11240188 Ga0268264_112401881 157
277 3300031711 Ga0265314_10130158 Ga0265314_101301582 157
278 3300034816 Ga0373930_0000449 Ga0373930_0000449_859_1344 157
279 3300034817 Ga0373948_0073392 Ga0373948_0073392_103_579 157
280 3300034819 Ga0373958_0005195 Ga0373958_0005195_63_548 157
281 3300034820 Ga0373959_0011204 Ga0373959_0011204_197_682 157
282 3300034957 Ga0373938_0003511 Ga0373938_0003511_392_877 157
283 3300035084 Ga0373928_0021552 Ga0373928_0021552_592_1077 157
284 3300035085 Ga0373929_0001196 Ga0373929_0001196_2447_2932 157
285 3300035088 Ga0373940_0001329 Ga0373940_0001329_1355_1840 157
286 3300035090 Ga0373949_0000694 Ga0373949_0000694_4213_4698 157
287 3300035091 Ga0373951_0000448 Ga0373951_0000448_6325_6810 157
288 3300035112 Ga0373932_0000543 Ga0373932_0000543_6807_7292 157
289 3300035114 Ga0373939_0001831 Ga0373939_0001831_4235_4720 157
290 3300035115 Ga0373941_0000759 Ga0373941_0000759_2620_3105 157
291 3300035121 Ga0373960_0000139 Ga0373960_0000139_5381_5866 157
292 3300035171 Ga0373946_0488786 Ga0373946_0488786_109_597 157
293 3300035172 Ga0373955_0269048 Ga0373955_0269048_330_818 157
294 3300035207 Ga0373942_0003783 Ga0373942_0003783_2012_2497 157
295 3300035242 Ga0373962_0005280 Ga0373962_0005280_2561_3046 157
296 3300035410 Ga0373924_0137019 Ga0373924_0137019_552_1028 157
297 3300035691 Ga0373931_0002779 Ga0373931_0002779_6706_7191 157
298 3300036401 Ga0373937_0081591 Ga0373937_0081591_501_989 157
299 3300036401 Ga0373937_0293440 Ga0373937_0293440_102_599 157
300 3300045051 Ga0451576_0055497 Ga0451576_0055497_1870_2355 157
301 3300045051 Ga0451576_1028292 Ga0451576_1028292_129_605 157
302 3300045051 Ga0451576_1330221 Ga0451576_1330221_212_718 157
303 3300046472 Ga0495580_0798102 Ga0495580_0798102_86_571 157
304 3300046516 Ga0495628_0405236 Ga0495628_0405236_455_943 157
305 3300046543 Ga0495645_0003437 Ga0495645_0003437_5963_6451 157
306 3300046558 Ga0495633_0112235 Ga0495633_0112235_510_998 157
307 3300046559 Ga0495667_0489580 Ga0495667_0489580_242_730 157
308 3300046663 Ga0495635_0265106 Ga0495635_0265106_548_1036 157
309 3300046681 Ga0495647_0203578 Ga0495647_0203578_58_546 157
310 3300046683 Ga0495658_0254854 Ga0495658_0254854_25_513 157
311 3300046689 Ga0495613_0556453 Ga0495613_0556453_31_519 157
312 3300046689 Ga0495613_0583375 Ga0495613_0583375_103_579 157
313 3300047315 Ga0495581_0279724 Ga0495581_0279724_22_510 157
314 3300047319 Ga0495674_0222234 Ga0495674_0222234_401_889 157
315 3300047322 Ga0495680_0252487 Ga0495680_0252487_115_603 157
316 3300047471 Ga0495684_0323492 Ga0495684_0323492_166_654 157
317 3300048088 Ga0495602_0419010 Ga0495602_0419010_429_917 157
318 3300048904 Ga0496101_0954424 Ga0496101_0954424_131_616 157
319 3300048907 Ga0496104_0328934 Ga0496104_0328934_902_1378 157
320 3300048909 Ga0496106_0028646 Ga0496106_0028646_699_1184 157
321 3300048909 Ga0496106_0224070 Ga0496106_0224070_751_1236 157
322 3300048911 Ga0496108_0085822 Ga0496108_0085822_114_590 157
323 3300048912 Ga0496109_0259387 Ga0496109_0259387_1094_1570 157
324 3300048914 Ga0496111_0168576 Ga0496111_0168576_508_984 157
325 3300048915 Ga0496112_0004416 Ga0496112_0004416_2135_2611 157
326 3300048916 Ga0496113_0009434 Ga0496113_0009434_2716_3192 157
327 3300048916 Ga0496113_0421499 Ga0496113_0421499_243_719 157
328 3300048917 Ga0496114_0623057 Ga0496114_0623057_257_745 157
329 3300048917 Ga0496114_0958084 Ga0496114_0958084_227_703 157
330 3300050507 nmdc:mga05p37_823623_c1 nmdc:mga05p37_823623_c1_94_585 157
331 3300050512 nmdc:mga0n895_761_c1 nmdc:mga0n895_761_c1_6883_7368 157
332 3300050513 nmdc:mga0rr50_261_c1 nmdc:mga0rr50_261_c1_1109_1594 157
333 3300050513 nmdc:mga0rr50_4604_c1 nmdc:mga0rr50_4604_c1_7186_7668 157
334 3300050513 nmdc:mga0rr50_54483_c1 nmdc:mga0rr50_54483_c1_2092_2583 157
335 3300050513 nmdc:mga0rr50_7495_c1 nmdc:mga0rr50_7495_c1_318_803 157
336 3300050514 nmdc:mga08x19_1320_c1 nmdc:mga08x19_1320_c1_13838_14323 157
337 3300050514 nmdc:mga08x19_56092_c1 nmdc:mga08x19_56092_c1_553_1038 157
338 3300053077 Ga0495601_0035263 Ga0495601_0035263_2048_2536 157

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00355

Rieske

Rieske [2Fe-2S] domain

70

156

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5cxm-assembly2.cif.gz_D crystal structure of the cyanobacterial plasma membrane rieske protein petc3 from synechocystis pcc 6803 0.8636 56 153
2v5i-assembly1.cif.gz_A structure of the receptor-binding protein of bacteriophage det7: a podoviral tailspike in a myovirus 0.8611 64 93
2qpz-assembly1.cif.gz_A naphthalene 1,2-dioxygenase rieske ferredoxin 0.8534 55 157
5z1v-assembly4.cif.gz_D crystal structure of avrpib 0.8388 64 91
4emj-assembly1.cif.gz_B complex between the reductase and ferredoxin components of toluene dioxygenase 0.8345 55 156
ID Description Score Start End Superfamily
af_E7F3F1_17_122_2.102.10.10 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.888 54 155 2.102.10.10
5cxmD00 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.8636 56 153 2.102.10.10
1z01A02 Mainly Beta;Single Sheet;N-terminal domain of TfIIb; 0.862 54 155 2.20.25.680
af_Q9URZ1_2_228_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8486 64 93 3.40.50.150
af_Q4E113_2_239_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8456 63 93 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A357Z6T0-F1-model_v4 (2Fe-2S)-binding protein 0.961 79 155 GO:0046872
GO:0051537
AF-A0A3N5KAZ6-F1-model_v4 Rieske (2Fe-2S) protein 0.9496 79 155 GO:0016020
GO:0046872
GO:0051537
AF-A0A7X6AIZ7-F1-model_v4 deleted 0.9495 55 157
AF-A0A2Z3GJM8-F1-model_v4 (2Fe-2S)-binding protein 0.9458 79 155 GO:0016020
GO:0046872
GO:0051537
AF-A0A4P5T2I9-F1-model_v4 Rieske domain-containing protein 0.9377 79 155 GO:0046872
GO:0051537

Feature Viewer

pLDDT pTM Quality
86.96 0.64 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map