F413531

General Info

Members Datasets Scaffolds Average Seq Length
338 289 676 255

Family's Representative Sequence

Representative Sequence 3300025901|Ga0207688_10055829|Ga0207688_100558292
Length 295
Sequence MPSYPGSEILEGYGGRWFMREELDGRAVVRTRALPAMGTGRKRLLSYAVFTASFLYALGFVGNYVVPKSIDKSIDVGSPTNVSEAILVNLLLMSLFAIQHSVMARPAFKRWWGKFLPVACQRSTYVLLSSLILLLLFWQWRPIPTPIWQTSGIAAWLLIVVHWLGWLIAFASTHMIDHFDLFGLRQAFVAFRGTEISGQSFRTPLLYKIVRHPLMLGFLLAFWATPAMTAGHLLFAIANTAYILLALQFEERDLIDEFGATYEDYRRRVPMLVPRLFGRRRGDDRPSPRPVGAPR

Samples

Sample ID Description Type Environment
1 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
20 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
21 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
22 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
23 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
24 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
25 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
26 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
27 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
28 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
31 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
32 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
33 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
34 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
35 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
38 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
39 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
40 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
41 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
42 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
43 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
45 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
48 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
49 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
50 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
76 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
77 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
78 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
79 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
80 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
81 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
82 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
83 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
84 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
85 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
86 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
87 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
88 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
89 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
90 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
91 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
92 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
93 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
94 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
95 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
96 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
97 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
98 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
99 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
100 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
101 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
102 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
103 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
104 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
105 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
106 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
107 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
108 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
109 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
110 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
111 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
112 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
113 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
114 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
115 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
116 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
117 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
118 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
119 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
120 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
121 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
122 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
123 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
124 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
125 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
126 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
127 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
128 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
129 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
130 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
131 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
132 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
133 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
134 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
135 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
136 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
137 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
138 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
139 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
140 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
141 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
142 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
150 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
151 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
152 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
153 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
154 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
155 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
156 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
159 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
160 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
161 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
162 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
163 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
164 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
165 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
166 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
167 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
168 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
169 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
170 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
171 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
172 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
173 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
174 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
175 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
176 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
177 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
178 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
179 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
180 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
181 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
182 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
183 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
184 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
185 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
186 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
187 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
188 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
189 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
190 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
191 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
192 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
193 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
194 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
195 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
196 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
197 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
198 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
199 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
200 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
201 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
202 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
203 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
204 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
205 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
206 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
207 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
208 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
209 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
210 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
211 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
212 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
213 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
214 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
215 2922368715
216 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
217 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
218 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
219 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
220 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
221 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
222 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
223 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
224 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
225 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
226 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
227 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
228 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
229 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
230 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
231 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
232 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
233 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
234 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
235 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
236 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
237 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
238 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
239 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
240 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
241 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
242 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
243 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
244 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
245 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
246 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
247 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
248 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
249 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
250 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
251 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
252 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
253 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
254 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
255 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
256 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
257 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
258 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
259 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
260 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
261 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
262 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
263 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
264 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
265 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
266 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
267 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
268 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
269 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
270 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
271 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
272 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
273 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
274 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
275 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
276 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
277 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
278 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
279 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
280 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
281 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
282 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
283 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
284 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
285 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
286 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
287 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
288 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
289 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 68.84
Metatranscriptomes 0
Isolates 31.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.57
Nodule 27.51
Rhizoplane 5.33
Rhizosphere 42.6
Stem 0
Stem Tuber 0
Unclassified 0.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207688_10055829 3300025901 Bacteria 2218
2 JGI25153J46596_10002305 3300003215 Bacteria 11106
3 JGI25160J50197_1003920 3300003354 Bacteria 6511
4 JGI25160J50197_1029827 3300003354 Bacteria 1433
5 Ga0065165_1001284 3300005262 Bacteria 28344
6 Ga0065165_1001991 3300005262 Bacteria 19209
7 Ga0065165_1016318 3300005262 Bacteria 2787
8 Ga0070658_10043379 3300005327 Bacteria 3633
9 Ga0070682_100022845 3300005337 Bacteria 3710
10 Ga0070668_100047791 3300005347 Bacteria 3290
11 Ga0070668_100288118 3300005347 Bacteria 1373
12 Ga0070669_100523622 3300005353 Bacteria 986
13 Ga0070671_100031562 3300005355 Bacteria 4377
14 Ga0070709_10000905 3300005434 Bacteria 16488
15 Ga0070713_100286856 3300005436 Bacteria 1512
16 Ga0070710_10035611 3300005437 Bacteria 2715
17 Ga0070663_100018929 3300005455 Bacteria 4526
18 Ga0070663_100256969 3300005455 Bacteria 1384
19 Ga0070679_100036624 3300005530 Bacteria 4870
20 Ga0068853_100293653 3300005539 Bacteria 1501
21 Ga0070665_100014065 3300005548 Bacteria 8045
22 Ga0068855_100314383 3300005563 Bacteria 1732
23 Ga0068856_100265394 3300005614 Bacteria 1732
24 Ga0068858_100164216 3300005842 Bacteria 2092
25 Ga0070717_10026821 3300006028 Unclassified 4601
26 Ga0070717_10444187 3300006028 Bacteria 1168
27 Ga0075365_10072255 3300006038 Bacteria 2324
28 Ga0075365_10331237 3300006038 Bacteria 1072
29 Ga0075368_10027067 3300006042 Bacteria 2209
30 Ga0075364_10064426 3300006051 Bacteria 2406
31 Ga0070715_10022688 3300006163 Bacteria 2450
32 Ga0070712_100155151 3300006175 Bacteria 1762
33 Ga0075369_10167045 3300006186 Bacteria 1009
34 Ga0075366_10241282 3300006195 Bacteria 1102
35 Ga0075370_10040938 3300006353 Bacteria 2615
36 Ga0075370_10090066 3300006353 Bacteria 1769
37 Ga0105240_10010309 3300009093 Bacteria 13156
38 Ga0105245_10313500 3300009098 Bacteria 1543
39 Ga0105247_10288808 3300009101 Bacteria 1134
40 Ga0105243_10108383 3300009148 Bacteria 2318
41 Ga0105248_10131786 3300009177 Bacteria 2820
42 Ga0105237_10008586 3300009545 Bacteria 11047
43 Ga0105237_10492189 3300009545 Bacteria 1233
44 Ga0105238_10127702 3300009551 Bacteria 2521
45 Ga0105238_10469951 3300009551 Bacteria 1256
46 Ga0105239_10002709 3300010375 Bacteria 22282
47 Ga0105239_10026761 3300010375 Bacteria 6348
48 Ga0105239_10116899 3300010375 Bacteria 2960
49 Ga0105246_10202071 3300011119 Bacteria 1545
50 Ga0157370_10194751 3300013104 Bacteria 1881
51 Ga0157370_10449387 3300013104 Bacteria 1185
52 Ga0157375_10351003 3300013308 Bacteria 1641
53 Ga0163163_10102904 3300014325 Bacteria 2880
54 Ga0163163_10264047 3300014325 Bacteria 1773
55 Ga0157376_10579850 3300014969 Bacteria 1114
56 Ga0163161_10249539 3300017792 Bacteria 1383
57 Ga0209563_104197 3300025230 Bacteria 2796
58 Ga0207425_1011992 3300025245 Bacteria 2048
59 Ga0209677_110106 3300025253 Bacteria 1608
60 Ga0209455_1017589 3300025272 Bacteria 1494
61 Ga0209758_1000407 3300025297 Bacteria 73945
62 Ga0209758_1018713 3300025297 Bacteria 3380
63 Ga0209758_1048633 3300025297 Bacteria 1505
64 Ga0209256_1003878 3300025299 Bacteria 9924
65 Ga0207426_1001843 3300025302 Bacteria 15591
66 Ga0207426_1012545 3300025302 Bacteria 3177
67 Ga0207426_1027900 3300025302 Bacteria 1876
68 Ga0207426_1056588 3300025302 Bacteria 1144
69 Ga0209257_1001136 3300025304 Bacteria 34058
70 Ga0207697_10157561 3300025315 Bacteria 989
71 Ga0207656_10155495 3300025321 Bacteria 1085
72 Ga0207647_10016650 3300025904 Bacteria 5013
73 Ga0207647_10046971 3300025904 Bacteria 2687
74 Ga0207654_10284255 3300025911 Bacteria 1120
75 Ga0207707_10143374 3300025912 Bacteria 2088
76 Ga0207695_10016767 3300025913 Bacteria 8552
77 Ga0207671_10027278 3300025914 Bacteria 4270
78 Ga0207693_10174626 3300025915 Bacteria 1691
79 Ga0207663_10050578 3300025916 Bacteria 2583
80 Ga0207660_10070309 3300025917 Bacteria 2544
81 Ga0207657_10092551 3300025919 Bacteria 2520
82 Ga0207652_10109369 3300025921 Bacteria 2450
83 Ga0207694_10010847 3300025924 Bacteria 6878
84 Ga0207700_10149562 3300025928 Bacteria 1928
85 Ga0207665_10092493 3300025939 Bacteria 2098
86 Ga0207689_10143671 3300025942 Bacteria 1966
87 Ga0207658_10345892 3300025986 Bacteria 1294
88 Ga0207703_10083453 3300026035 Bacteria 2670
89 Ga0207639_10064323 3300026041 Bacteria 2843
90 Ga0207678_10157852 3300026067 Bacteria 1937
91 Ga0207702_10003596 3300026078 Bacteria 14085
92 Ga0207702_10180217 3300026078 Bacteria 1945
93 Ga0207702_10269772 3300026078 Bacteria 1605
94 Ga0207674_10397189 3300026116 Bacteria 1333
95 Ga0268266_10522140 3300028379 Bacteria 1135
96 Ga0268264_10226442 3300028381 Bacteria 1724
97 Ga0307517_10349996 3300028786 Bacteria 803
98 Ga0307508_10003624 3300031616 Bacteria 15507
99 Ga0307516_10001159 3300031730 Bacteria 36887
100 Ga0373929_0068118 3300035085 Bacteria 846
101 Ga0373940_0012197 3300035088 Bacteria 2055
102 Ga0373949_0005871 3300035090 Bacteria 2727
103 Ga0373941_0053389 3300035115 Bacteria 1292
104 Ga0373924_0074358 3300035410 Bacteria 1437
105 Ga0373931_0014014 3300035691 Bacteria 3912
106 Ga0451839_0573886 3300041496 Bacteria 1085
107 Ga0451841_0248838 3300041498 Bacteria 917
108 Ga0466966_0001015 3300044684 Bacteria 17896
109 Ga0466961_0004635 3300044693 Bacteria 8629
110 Ga0466959_0051213 3300045049 Bacteria 3030
111 Ga0466967_0048940 3300045976 Bacteria 3694
112 Ga0495592_0042785 3300046454 Bacteria 3391
113 Ga0495592_0143040 3300046454 Bacteria 1661
114 Ga0495590_0067766 3300046457 Bacteria 1251
115 Ga0495638_0004908 3300046460 Bacteria 10052
116 Ga0495651_0002101 3300046462 Bacteria 15375
117 Ga0495580_0004600 3300046472 Bacteria 11577
118 Ga0495664_0017489 3300046477 Bacteria 4100
119 Ga0495596_0076526 3300046500 Bacteria 1300
120 Ga0495606_0153212 3300046507 Bacteria 1351
121 Ga0495606_0238146 3300046507 Bacteria 1016
122 Ga0495632_0121803 3300046519 Bacteria 1219
123 Ga0495643_0038478 3300046522 Bacteria 2619
124 Ga0495652_0015538 3300046529 Bacteria 6814
125 Ga0495586_0177173 3300046535 Bacteria 1206
126 Ga0495587_0005502 3300046536 Bacteria 8264
127 Ga0495645_0002752 3300046543 Bacteria 11949
128 Ga0495667_0021116 3300046559 Bacteria 4392
129 Ga0495668_0036802 3300046616 Bacteria 2741
130 Ga0495634_0039020 3300046642 Bacteria 3236
131 Ga0495611_0147310 3300046648 Bacteria 1099
132 Ga0495625_0105919 3300046660 Bacteria 1926
133 Ga0495635_0025208 3300046663 Bacteria 4142
134 Ga0495657_0002643 3300046675 Bacteria 14975
135 Ga0495599_0015152 3300046678 Bacteria 4781
136 Ga0495623_0030903 3300046679 Bacteria 3445
137 Ga0495646_0014214 3300046680 Bacteria 5062
138 Ga0495624_0039317 3300046690 Bacteria 3033
139 Ga0495604_0004468 3300047317 Bacteria 11080
140 Ga0495674_0011854 3300047319 Bacteria 8218
141 Ga0495680_0016739 3300047322 Bacteria 6287
142 Ga0495680_0082049 3300047322 Bacteria 2433
143 Ga0495687_012698 3300047443 Bacteria 4441
144 Ga0495675_0007079 3300047444 Bacteria 6902
145 Ga0495684_0156271 3300047471 Bacteria 1703
146 Ga0495686_0156400 3300047472 Bacteria 1335
147 Ga0495686_0162949 3300047472 Bacteria 1302
148 Ga0495593_0172601 3300047673 Bacteria 1090
149 Ga0495602_0002010 3300048088 Bacteria 20455
150 Ga0496100_0037745 3300048903 Bacteria 3057
151 Ga0496101_0052666 3300048904 Bacteria 2935
152 Ga0496102_0084276 3300048905 Bacteria 2933
153 Ga0496103_0015869 3300048906 Bacteria 4491
154 Ga0496104_0032734 3300048907 Bacteria 4839
155 Ga0496104_0066205 3300048907 Bacteria 3430
156 Ga0496105_0091450 3300048908 Bacteria 2512
157 Ga0496105_0105334 3300048908 Bacteria 2328
158 Ga0496107_0130999 3300048910 Bacteria 1851
159 Ga0496107_0144113 3300048910 Bacteria 1761
160 Ga0496108_0004743 3300048911 Bacteria 10963
161 Ga0496109_0092534 3300048912 Bacteria 2797
162 Ga0496110_0308123 3300048913 Bacteria 1442
163 Ga0496110_0741997 3300048913 Bacteria 885
164 Ga0496112_0083283 3300048915 Bacteria 3163
165 Ga0496112_0792961 3300048915 Bacteria 872
166 Ga0496113_0216513 3300048916 Bacteria 1526
167 Ga0496115_0109878 3300048918 Bacteria 2264
168 Ga0496118_0088765 3300048921 Bacteria 2137
169 Ga0496118_0145056 3300048921 Bacteria 1496
170 Ga0496120_0018985 3300048923 Bacteria 4415
171 Ga0496121_0044438 3300048924 Bacteria 3831
172 Ga0496121_0092559 3300048924 Bacteria 2356
173 Ga0496121_0184708 3300048924 Bacteria 1501
174 Ga0496124_0230028 3300048927 Bacteria 1387
175 Ga0496126_0046385 3300048929 Bacteria 3986
176 Ga0496126_0327130 3300048929 Bacteria 1259
177 Ga0501034_0198480 3300049571 Bacteria 1965
178 Ga0501039_0185399 3300049575 Bacteria 1636
179 Ga0501040_0006333 3300049576 Bacteria 7685
180 Ga0501041_0028180 3300049577 Bacteria 3387
181 Ga0501046_0148967 3300049580 Bacteria 1766
182 Ga0501047_0107929 3300049581 Bacteria 2665
183 Ga0501048_0072239 3300049582 Bacteria 2436
184 Ga0501067_0042735 3300049583 Bacteria 2516
185 Ga0501069_0033680 3300049585 Bacteria 2822
186 Ga0501070_0080112 3300049586 Bacteria 2702
187 Ga0501070_0096737 3300049586 Bacteria 2442
188 Ga0501072_0001413 3300049588 Bacteria 18042
189 Ga0501072_0027162 3300049588 Bacteria 4466
190 Ga0501074_0104432 3300049590 Bacteria 2028
191 Ga0501074_0234043 3300049590 Bacteria 1307
192 Ga0501079_0045522 3300049741 Bacteria 3386
193 Ga0501079_0093828 3300049741 Bacteria 2325
194 Ga0501080_0021859 3300049742 Bacteria 5925
195 Ga0501035_0069165 3300049822 Bacteria 3130
196 Ga0501035_0132830 3300049822 Bacteria 2169
197 Ga0501044_0061300 3300049823 Bacteria 3848
198 Ga0501045_0075406 3300049824 Bacteria 2484
199 nmdc:mga00v17_18144_c1 3300050491 Bacteria 3992
200 nmdc:mga0yw44_32546_c1 3300050492 Bacteria 3039
201 nmdc:mga0yw44_4139_c1 3300050492 Bacteria 2459
202 nmdc:mga0k408_79893_c1 3300050493 Bacteria 1914
203 nmdc:mga06z11_82458_c1 3300050494 Bacteria 1729
204 nmdc:mga0rr50_183963_c1 3300050513 Bacteria 1709
205 nmdc:mga0sz30_113562_c1 3300050516 Bacteria 1188
206 Ga0495619_0304870 3300053085 Bacteria 1103
207 Ga0500578_0194790 3300053086 Bacteria 1243
208 Ga0500643_000019 3300053087 Bacteria 294301
209 Ga0500643_046835 3300053087 Bacteria 1248
210 Ga0500651_0321801 3300053093 Bacteria 883
211 Ga0500566_0002434 3300053094 Bacteria 11036
212 Ga0500555_007767 3300053103 Bacteria 3051
213 Ga0500556_0011511 3300053104 Bacteria 2621
214 Ga0500557_000039 3300053105 Bacteria 66862
215 Ga0500642_0000285 3300053130 Bacteria 18457
216 Ga0500568_0028521 3300053139 Bacteria 2326
217 Ga0500568_0043169 3300053139 Bacteria 1803
218 Ga0500568_0054666 3300053139 Bacteria 1560
219 Ga0500577_0056665 3300053142 Bacteria 1493
220 Ga0500622_0004934 3300053156 Bacteria 8134
221 Ga0500622_0004962 3300053156 Bacteria 8109
222 Ga0500638_036514 3300053162 Bacteria 2383
223 Ga0500636_0000313 3300053177 Bacteria 26675
224 Ga0500636_0122410 3300053177 Bacteria 1458
225 Ga0500636_0154568 3300053177 Bacteria 1257
226 Ga0500625_020232 3300053729 Bacteria 3131
227 Ga0500599_004216 3300053736 Bacteria 1776
228 Ga0500601_000294 3300053737 Bacteria 9383
229 Ga0500601_005660 3300053737 Bacteria 1371
230 Ga0501084_0018723 3300054114 Bacteria 5765
231 Ga0501084_0176504 3300054114 Bacteria 1803
232 Ga0501082_0036961 3300060353 Bacteria 4207
233 2507510110 2507262055 Bacteria 8048963
234 2508544112 2508501009 Bacteria 7784016
235 2508697948 2508501042 Bacteria 8719808
236 2513643828 2513237094 Bacteria 8789602
237 2513648922 2513237095 Bacteria 8976980
238 2515629390 2515154112 Bacteria 8294334
239 2528849684 2528768022 Bacteria 10457665
240 2805919992 2802429603 Bacteria 8777136
241 2818241674 2816332527 Bacteria 8933356
242 2824668710 2824661429 Bacteria 9877870
243 2824698549 2824696289 Bacteria 8335049
244 2824713366 2824704595 Bacteria 9667483
245 2824758906 2824753945 Bacteria 9787441
246 2824766082 2824763712 Bacteria 9792355
247 2842038172 2842038055 Bacteria 8002051
248 2842048882 2842045827 Bacteria 8006841
249 2847945037 2847939898 Bacteria 8606328
250 2874593306 2874590934 Bacteria 8299676
251 2874623133 2874620515 Bacteria 8290088
252 2874636127 2874628541 Bacteria 8630250
253 2874652919 2874645413 Bacteria 8214782
254 2876773346 2876771140 Bacteria 8287509
255 2876821299 2876818435 Bacteria 8274608
256 2879077262 2879074833 Bacteria 8279565
257 2879107652 2879099564 Bacteria 10442239
258 2879130181 2879127579 Bacteria 8294491
259 2879146696 2879142872 Bacteria 8267021
260 2888382375 2888378607 Bacteria 9652610
261 2888388317 2888388044 Bacteria 7304136
262 2904669953 2904666416 Bacteria 8226587
263 2904718566 2904711408 Bacteria 9771557
264 2922375582
265 2929616320 2929615660 Bacteria 9193770
266 2929625064 2929624759 Bacteria 9339455
267 2932787011 2932784394 Bacteria 9704911
268 2932811213 2932809354 Bacteria 9135765
269 2932819914 2932818245 Bacteria 9955613
270 2932832399 2932828146 Bacteria 9745859
271 2933578396 2933577622 Bacteria 9116884
272 2935610984 2935608549 Bacteria 8203142
273 2935619103 2935616580 Bacteria 9032984
274 2935643077 2935638405 Bacteria 10015038
275 2935648416 2935648319 Bacteria 8801166
276 2935657596 2935656913 Bacteria 8965014
277 2935669704 2935665750 Bacteria 9571747
278 2935677155 2935675223 Bacteria 9928132
279 2935693190 2935684952 Bacteria 9590419
280 2935695315 2935694250 Bacteria 9291695
281 2935709577 2935703347 Bacteria 10242284
282 2935719798 2935713505 Bacteria 9608509
283 2935729435 2935722832 Bacteria 9608746
284 2935739681 2935732158 Bacteria 9706831
285 2935748719 2935741537 Bacteria 9707219
286 2935756694 2935750917 Bacteria 9590372
287 2935761322 2935760218 Bacteria 9817913
288 2935779094 2935777560 Bacteria 8077691
289 2935788298 2935785616 Bacteria 7962367
290 2935796937 2935793552 Bacteria 8012592
291 2935807227 2935801545 Bacteria 9301974
292 2935812359 2935810662 Bacteria 9401221
293 2935820469 2935819856 Bacteria 8261050
294 2935832778 2935827899 Bacteria 10038562
295 2935839141 2935837841 Bacteria 9454360
296 2935849522 2935847175 Bacteria 8228321
297 2935857468 2935855204 Bacteria 9035059
298 2935865000 2935864058 Bacteria 9784707
299 2935876778 2935873716 Bacteria 9632195
300 2935911705 2935908558 Bacteria 8568796
301 2935919360 2935916978 Bacteria 9113783
302 2935928734 2935926038 Bacteria 8601059
303 2935938379 2935934488 Bacteria 8602579
304 2935945729 2935942939 Bacteria 8599779
305 2935954664 2935951376 Bacteria 8602333
306 2935970551 2935967501 Bacteria 8603075
307 2935979207 2935975950 Bacteria 8347125
308 2935987775 2935984226 Bacteria 8302647
309 2935999610 2935992306 Bacteria 9802711
310 2936008368 2936002035 Bacteria 9362176
311 2936011326 2936011229 Bacteria 8801034
312 2936019921 2936019824 Bacteria 8804134
313 2936028517 2936028420 Bacteria 8965941
314 2936038952 2936037263 Bacteria 9446081
315 2936046644 2936046547 Bacteria 8903709
316 2936062337 2936055302 Bacteria 8785755
317 2940562608 2940556831 Bacteria 9590747
318 2941536301 2941531003 Bacteria 7653939
319 2941539831 2941538514 Bacteria 9402094
320 3005597388 3005594810 Bacteria 8716512
321 8016515201 8016511872 Bacteria 9921665
322 8016590749 8016583857 Bacteria 10421953
323 8016612312 8016603502 Bacteria 8731218
324 8016621494 8016613128 Bacteria 8794220
325 8016632669 8016630954 Bacteria 9217207
326 8017061257 8017057580 Bacteria 10023680
327 8019588462 8019586578 Bacteria 10212056
328 8019602875 8019597564 Bacteria 10041141
329 8019615680 8019608314 Bacteria 10042931
330 8019626432 8019619141 Bacteria 9218857
331 8019636062 8019629233 Bacteria 8687553
332 8019643604 8019638758 Bacteria 9062356
333 8019656393 8019648815 Bacteria 10014479
334 8019663829 8019659431 Bacteria 8577854
335 8019673458 8019668869 Bacteria 8791617
336 8019682673 8019678201 Bacteria 8863603
337 8019688351 8019687851 Bacteria 8712826
338 8055747966 8055742211 Bacteria 9226248
339 Ga0207688_10055829
340 JGI25153J46596_10002305
341 JGI25160J50197_1003920
342 JGI25160J50197_1029827
343 Ga0065165_1001284
344 Ga0065165_1001991
345 Ga0065165_1016318
346 Ga0070658_10043379
347 Ga0070682_100022845
348 Ga0070668_100047791
349 Ga0070668_100288118
350 Ga0070669_100523622
351 Ga0070671_100031562
352 Ga0070709_10000905
353 Ga0070713_100286856
354 Ga0070710_10035611
355 Ga0070663_100018929
356 Ga0070663_100256969
357 Ga0070679_100036624
358 Ga0068853_100293653
359 Ga0070665_100014065
360 Ga0068855_100314383
361 Ga0068856_100265394
362 Ga0068858_100164216
363 Ga0070717_10026821
364 Ga0070717_10444187
365 Ga0075365_10072255
366 Ga0075365_10331237
367 Ga0075368_10027067
368 Ga0075364_10064426
369 Ga0070715_10022688
370 Ga0070712_100155151
371 Ga0075369_10167045
372 Ga0075366_10241282
373 Ga0075370_10040938
374 Ga0075370_10090066
375 Ga0105240_10010309
376 Ga0105245_10313500
377 Ga0105247_10288808
378 Ga0105243_10108383
379 Ga0105248_10131786
380 Ga0105237_10008586
381 Ga0105237_10492189
382 Ga0105238_10127702
383 Ga0105238_10469951
384 Ga0105239_10002709
385 Ga0105239_10026761
386 Ga0105239_10116899
387 Ga0105246_10202071
388 Ga0157370_10194751
389 Ga0157370_10449387
390 Ga0157375_10351003
391 Ga0163163_10102904
392 Ga0163163_10264047
393 Ga0157376_10579850
394 Ga0163161_10249539
395 Ga0209563_104197
396 Ga0207425_1011992
397 Ga0209677_110106
398 Ga0209455_1017589
399 Ga0209758_1000407
400 Ga0209758_1018713
401 Ga0209758_1048633
402 Ga0209256_1003878
403 Ga0207426_1001843
404 Ga0207426_1012545
405 Ga0207426_1027900
406 Ga0207426_1056588
407 Ga0209257_1001136
408 Ga0207697_10157561
409 Ga0207656_10155495
410 Ga0207647_10016650
411 Ga0207647_10046971
412 Ga0207654_10284255
413 Ga0207707_10143374
414 Ga0207695_10016767
415 Ga0207671_10027278
416 Ga0207693_10174626
417 Ga0207663_10050578
418 Ga0207660_10070309
419 Ga0207657_10092551
420 Ga0207652_10109369
421 Ga0207694_10010847
422 Ga0207700_10149562
423 Ga0207665_10092493
424 Ga0207689_10143671
425 Ga0207658_10345892
426 Ga0207703_10083453
427 Ga0207639_10064323
428 Ga0207678_10157852
429 Ga0207702_10003596
430 Ga0207702_10180217
431 Ga0207702_10269772
432 Ga0207674_10397189
433 Ga0268266_10522140
434 Ga0268264_10226442
435 Ga0307517_10349996
436 Ga0307508_10003624
437 Ga0307516_10001159
438 Ga0373929_0068118
439 Ga0373940_0012197
440 Ga0373949_0005871
441 Ga0373941_0053389
442 Ga0373924_0074358
443 Ga0373931_0014014
444 Ga0451839_0573886
445 Ga0451841_0248838
446 Ga0466966_0001015
447 Ga0466961_0004635
448 Ga0466959_0051213
449 Ga0466967_0048940
450 Ga0495592_0042785
451 Ga0495592_0143040
452 Ga0495590_0067766
453 Ga0495638_0004908
454 Ga0495651_0002101
455 Ga0495580_0004600
456 Ga0495664_0017489
457 Ga0495596_0076526
458 Ga0495606_0153212
459 Ga0495606_0238146
460 Ga0495632_0121803
461 Ga0495643_0038478
462 Ga0495652_0015538
463 Ga0495586_0177173
464 Ga0495587_0005502
465 Ga0495645_0002752
466 Ga0495667_0021116
467 Ga0495668_0036802
468 Ga0495634_0039020
469 Ga0495611_0147310
470 Ga0495625_0105919
471 Ga0495635_0025208
472 Ga0495657_0002643
473 Ga0495599_0015152
474 Ga0495623_0030903
475 Ga0495646_0014214
476 Ga0495624_0039317
477 Ga0495604_0004468
478 Ga0495674_0011854
479 Ga0495680_0016739
480 Ga0495680_0082049
481 Ga0495687_012698
482 Ga0495675_0007079
483 Ga0495684_0156271
484 Ga0495686_0156400
485 Ga0495686_0162949
486 Ga0495593_0172601
487 Ga0495602_0002010
488 Ga0496100_0037745
489 Ga0496101_0052666
490 Ga0496102_0084276
491 Ga0496103_0015869
492 Ga0496104_0032734
493 Ga0496104_0066205
494 Ga0496105_0091450
495 Ga0496105_0105334
496 Ga0496107_0130999
497 Ga0496107_0144113
498 Ga0496108_0004743
499 Ga0496109_0092534
500 Ga0496110_0308123
501 Ga0496110_0741997
502 Ga0496112_0083283
503 Ga0496112_0792961
504 Ga0496113_0216513
505 Ga0496115_0109878
506 Ga0496118_0088765
507 Ga0496118_0145056
508 Ga0496120_0018985
509 Ga0496121_0044438
510 Ga0496121_0092559
511 Ga0496121_0184708
512 Ga0496124_0230028
513 Ga0496126_0046385
514 Ga0496126_0327130
515 Ga0501034_0198480
516 Ga0501039_0185399
517 Ga0501040_0006333
518 Ga0501041_0028180
519 Ga0501046_0148967
520 Ga0501047_0107929
521 Ga0501048_0072239
522 Ga0501067_0042735
523 Ga0501069_0033680
524 Ga0501070_0080112
525 Ga0501070_0096737
526 Ga0501072_0001413
527 Ga0501072_0027162
528 Ga0501074_0104432
529 Ga0501074_0234043
530 Ga0501079_0045522
531 Ga0501079_0093828
532 Ga0501080_0021859
533 Ga0501035_0069165
534 Ga0501035_0132830
535 Ga0501044_0061300
536 Ga0501045_0075406
537 nmdc:mga00v17_18144_c1
538 nmdc:mga0yw44_32546_c1
539 nmdc:mga0yw44_4139_c1
540 nmdc:mga0k408_79893_c1
541 nmdc:mga06z11_82458_c1
542 nmdc:mga0rr50_183963_c1
543 nmdc:mga0sz30_113562_c1
544 Ga0495619_0304870
545 Ga0500578_0194790
546 Ga0500643_000019
547 Ga0500643_046835
548 Ga0500651_0321801
549 Ga0500566_0002434
550 Ga0500555_007767
551 Ga0500556_0011511
552 Ga0500557_000039
553 Ga0500642_0000285
554 Ga0500568_0028521
555 Ga0500568_0043169
556 Ga0500568_0054666
557 Ga0500577_0056665
558 Ga0500622_0004934
559 Ga0500622_0004962
560 Ga0500638_036514
561 Ga0500636_0000313
562 Ga0500636_0122410
563 Ga0500636_0154568
564 Ga0500625_020232
565 Ga0500599_004216
566 Ga0500601_000294
567 Ga0500601_005660
568 Ga0501084_0018723
569 Ga0501084_0176504
570 Ga0501082_0036961
571 2507510110
572 2508544112
573 2508697948
574 2513643828
575 2513648922
576 2515629390
577 2528849684
578 2805919992
579 2818241674
580 2824668710
581 2824698549
582 2824713366
583 2824758906
584 2824766082
585 2842038172
586 2842048882
587 2847945037
588 2874593306
589 2874623133
590 2874636127
591 2874652919
592 2876773346
593 2876821299
594 2879077262
595 2879107652
596 2879130181
597 2879146696
598 2888382375
599 2888388317
600 2904669953
601 2904718566
602 2922375582
603 2929616320
604 2929625064
605 2932787011
606 2932811213
607 2932819914
608 2932832399
609 2933578396
610 2935610984
611 2935619103
612 2935643077
613 2935648416
614 2935657596
615 2935669704
616 2935677155
617 2935693190
618 2935695315
619 2935709577
620 2935719798
621 2935729435
622 2935739681
623 2935748719
624 2935756694
625 2935761322
626 2935779094
627 2935788298
628 2935796937
629 2935807227
630 2935812359
631 2935820469
632 2935832778
633 2935839141
634 2935849522
635 2935857468
636 2935865000
637 2935876778
638 2935911705
639 2935919360
640 2935928734
641 2935938379
642 2935945729
643 2935954664
644 2935970551
645 2935979207
646 2935987775
647 2935999610
648 2936008368
649 2936011326
650 2936019921
651 2936028517
652 2936038952
653 2936046644
654 2936062337
655 2940562608
656 2941536301
657 2941539831
658 3005597388
659 8016515201
660 8016590749
661 8016612312
662 8016621494
663 8016632669
664 8017061257
665 8019588462
666 8019602875
667 8019615680
668 8019626432
669 8019636062
670 8019643604
671 8019656393
672 8019663829
673 8019673458
674 8019682673
675 8019688351
676 8055747966

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07298

NnrU

NnrU protein

88

256

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bw1-assembly1.cif.gz_A crystal structure of steroid 5-alpha-reductase 2 in complex with finasteride 0.4058 7 241
4a2n-assembly1.cif.gz_B crystal structure of ma-icmt 0.3997 53 238
7bw1-assembly1.cif.gz_A crystal structure of steroid 5-alpha-reductase 2 in complex with finasteride 0.3902 7 241
4a2n-assembly1.cif.gz_B crystal structure of ma-icmt 0.3862 53 238
7c83-assembly1.cif.gz_A crystal structure of an integral membrane steroid 5-alpha-reductase pbsrd5a 0.3442 7 240
ID Description Score Start End Superfamily
af_O05883_47_239_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.9606 49 238 1.20.120.1630
af_O05883_47_239_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.9413 49 238 1.20.120.1630
af_Q9VEG9_60_228_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.8217 50 209 1.20.120.1630
af_Q54JG5_70_234_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.8159 50 208 1.20.120.1630
af_Q6MG14_62_250_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.8003 50 218 1.20.120.1630
ID Description Score Start End GO Terms
AF-A0A6I6SQV3-F1-model_v4 methanethiol S-methyltransferase (EC 2.1.1.334) 0.9774 4 238 GO:0008168
GO:0016020
GO:0032259
AF-A0A836U4A6-F1-model_v4 methanethiol S-methyltransferase (EC 2.1.1.334) 0.9746 3 238 GO:0008168
GO:0016020
GO:0032259
AF-A0A0M9TZ98-F1-model_v4 deleted 0.9723 3 240
AF-A0A0Q2U2U2-F1-model_v4 methanethiol S-methyltransferase (EC 2.1.1.334) 0.9718 2 238 GO:0008168
GO:0016020
GO:0032259
AF-K8P644-F1-model_v4 methanethiol S-methyltransferase (EC 2.1.1.334) 0.9716 3 238 GO:0008168
GO:0016020
GO:0032259

Map