F413531
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 338 | 289 | 676 | 255 |
Family's Representative Sequence
| Representative Sequence | 3300025901|Ga0207688_10055829|Ga0207688_100558292 |
| Length | 295 |
| Sequence | MPSYPGSEILEGYGGRWFMREELDGRAVVRTRALPAMGTGRKRLLSYAVFTASFLYALGFVGNYVVPKSIDKSIDVGSPTNVSEAILVNLLLMSLFAIQHSVMARPAFKRWWGKFLPVACQRSTYVLLSSLILLLLFWQWRPIPTPIWQTSGIAAWLLIVVHWLGWLIAFASTHMIDHFDLFGLRQAFVAFRGTEISGQSFRTPLLYKIVRHPLMLGFLLAFWATPAMTAGHLLFAIANTAYILLALQFEERDLIDEFGATYEDYRRRVPMLVPRLFGRRRGDDRPSPRPVGAPR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 3 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 4 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 16 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 18 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 19 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 20 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 22 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 23 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 24 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 27 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 28 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 29 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 30 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 31 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 32 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 44 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 45 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 46 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 47 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 48 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 49 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 50 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 51 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 76 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 77 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 78 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 79 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 80 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 81 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 82 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 83 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 84 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 85 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 86 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 87 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 88 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 89 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 90 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 91 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 92 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 125 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 126 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 127 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 128 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 129 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 130 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 131 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 132 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 133 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 134 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 135 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 136 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 137 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 138 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 139 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 140 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 141 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 142 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 143 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 144 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 145 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 146 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 147 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 148 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 149 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 150 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 151 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 152 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 153 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 154 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 155 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 156 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 157 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 158 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 159 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 160 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 161 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 162 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 163 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 164 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 165 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 167 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 168 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 169 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 170 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 171 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 172 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 173 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 174 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 175 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 176 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 177 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 178 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 179 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 180 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 181 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 182 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 183 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 184 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 185 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 186 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 187 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 188 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 189 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 190 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 191 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 192 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 193 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 194 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 195 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 196 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 197 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 198 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 199 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 200 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 201 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 202 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 203 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 204 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 205 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 206 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 207 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 208 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 209 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 210 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 211 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 212 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 213 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 214 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 215 | 2922368715 | |||
| 216 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 217 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 218 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 219 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 220 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 221 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 222 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 223 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 224 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 225 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 226 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 227 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 228 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 229 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 230 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 231 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 232 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 233 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 234 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 235 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 236 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 237 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 238 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 239 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 240 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 241 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 242 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 243 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 244 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 245 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 246 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 247 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 248 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 249 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 250 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 251 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 252 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 253 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 254 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 255 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 256 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 257 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 258 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 259 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 260 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 261 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 262 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 263 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 264 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 265 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 266 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 267 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 268 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 269 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 270 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 271 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 272 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 273 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 274 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 275 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 276 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 277 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 278 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 279 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 280 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 281 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 282 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 283 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 284 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 285 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 286 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 287 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 288 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 289 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 68.84 |
| Metatranscriptomes | 0 |
| Isolates | 31.16 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 16.57 |
| Nodule | 27.51 |
| Rhizoplane | 5.33 |
| Rhizosphere | 42.6 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.3 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207688_10055829 | 3300025901 | Bacteria | 2218 |
| 2 | JGI25153J46596_10002305 | 3300003215 | Bacteria | 11106 |
| 3 | JGI25160J50197_1003920 | 3300003354 | Bacteria | 6511 |
| 4 | JGI25160J50197_1029827 | 3300003354 | Bacteria | 1433 |
| 5 | Ga0065165_1001284 | 3300005262 | Bacteria | 28344 |
| 6 | Ga0065165_1001991 | 3300005262 | Bacteria | 19209 |
| 7 | Ga0065165_1016318 | 3300005262 | Bacteria | 2787 |
| 8 | Ga0070658_10043379 | 3300005327 | Bacteria | 3633 |
| 9 | Ga0070682_100022845 | 3300005337 | Bacteria | 3710 |
| 10 | Ga0070668_100047791 | 3300005347 | Bacteria | 3290 |
| 11 | Ga0070668_100288118 | 3300005347 | Bacteria | 1373 |
| 12 | Ga0070669_100523622 | 3300005353 | Bacteria | 986 |
| 13 | Ga0070671_100031562 | 3300005355 | Bacteria | 4377 |
| 14 | Ga0070709_10000905 | 3300005434 | Bacteria | 16488 |
| 15 | Ga0070713_100286856 | 3300005436 | Bacteria | 1512 |
| 16 | Ga0070710_10035611 | 3300005437 | Bacteria | 2715 |
| 17 | Ga0070663_100018929 | 3300005455 | Bacteria | 4526 |
| 18 | Ga0070663_100256969 | 3300005455 | Bacteria | 1384 |
| 19 | Ga0070679_100036624 | 3300005530 | Bacteria | 4870 |
| 20 | Ga0068853_100293653 | 3300005539 | Bacteria | 1501 |
| 21 | Ga0070665_100014065 | 3300005548 | Bacteria | 8045 |
| 22 | Ga0068855_100314383 | 3300005563 | Bacteria | 1732 |
| 23 | Ga0068856_100265394 | 3300005614 | Bacteria | 1732 |
| 24 | Ga0068858_100164216 | 3300005842 | Bacteria | 2092 |
| 25 | Ga0070717_10026821 | 3300006028 | Unclassified | 4601 |
| 26 | Ga0070717_10444187 | 3300006028 | Bacteria | 1168 |
| 27 | Ga0075365_10072255 | 3300006038 | Bacteria | 2324 |
| 28 | Ga0075365_10331237 | 3300006038 | Bacteria | 1072 |
| 29 | Ga0075368_10027067 | 3300006042 | Bacteria | 2209 |
| 30 | Ga0075364_10064426 | 3300006051 | Bacteria | 2406 |
| 31 | Ga0070715_10022688 | 3300006163 | Bacteria | 2450 |
| 32 | Ga0070712_100155151 | 3300006175 | Bacteria | 1762 |
| 33 | Ga0075369_10167045 | 3300006186 | Bacteria | 1009 |
| 34 | Ga0075366_10241282 | 3300006195 | Bacteria | 1102 |
| 35 | Ga0075370_10040938 | 3300006353 | Bacteria | 2615 |
| 36 | Ga0075370_10090066 | 3300006353 | Bacteria | 1769 |
| 37 | Ga0105240_10010309 | 3300009093 | Bacteria | 13156 |
| 38 | Ga0105245_10313500 | 3300009098 | Bacteria | 1543 |
| 39 | Ga0105247_10288808 | 3300009101 | Bacteria | 1134 |
| 40 | Ga0105243_10108383 | 3300009148 | Bacteria | 2318 |
| 41 | Ga0105248_10131786 | 3300009177 | Bacteria | 2820 |
| 42 | Ga0105237_10008586 | 3300009545 | Bacteria | 11047 |
| 43 | Ga0105237_10492189 | 3300009545 | Bacteria | 1233 |
| 44 | Ga0105238_10127702 | 3300009551 | Bacteria | 2521 |
| 45 | Ga0105238_10469951 | 3300009551 | Bacteria | 1256 |
| 46 | Ga0105239_10002709 | 3300010375 | Bacteria | 22282 |
| 47 | Ga0105239_10026761 | 3300010375 | Bacteria | 6348 |
| 48 | Ga0105239_10116899 | 3300010375 | Bacteria | 2960 |
| 49 | Ga0105246_10202071 | 3300011119 | Bacteria | 1545 |
| 50 | Ga0157370_10194751 | 3300013104 | Bacteria | 1881 |
| 51 | Ga0157370_10449387 | 3300013104 | Bacteria | 1185 |
| 52 | Ga0157375_10351003 | 3300013308 | Bacteria | 1641 |
| 53 | Ga0163163_10102904 | 3300014325 | Bacteria | 2880 |
| 54 | Ga0163163_10264047 | 3300014325 | Bacteria | 1773 |
| 55 | Ga0157376_10579850 | 3300014969 | Bacteria | 1114 |
| 56 | Ga0163161_10249539 | 3300017792 | Bacteria | 1383 |
| 57 | Ga0209563_104197 | 3300025230 | Bacteria | 2796 |
| 58 | Ga0207425_1011992 | 3300025245 | Bacteria | 2048 |
| 59 | Ga0209677_110106 | 3300025253 | Bacteria | 1608 |
| 60 | Ga0209455_1017589 | 3300025272 | Bacteria | 1494 |
| 61 | Ga0209758_1000407 | 3300025297 | Bacteria | 73945 |
| 62 | Ga0209758_1018713 | 3300025297 | Bacteria | 3380 |
| 63 | Ga0209758_1048633 | 3300025297 | Bacteria | 1505 |
| 64 | Ga0209256_1003878 | 3300025299 | Bacteria | 9924 |
| 65 | Ga0207426_1001843 | 3300025302 | Bacteria | 15591 |
| 66 | Ga0207426_1012545 | 3300025302 | Bacteria | 3177 |
| 67 | Ga0207426_1027900 | 3300025302 | Bacteria | 1876 |
| 68 | Ga0207426_1056588 | 3300025302 | Bacteria | 1144 |
| 69 | Ga0209257_1001136 | 3300025304 | Bacteria | 34058 |
| 70 | Ga0207697_10157561 | 3300025315 | Bacteria | 989 |
| 71 | Ga0207656_10155495 | 3300025321 | Bacteria | 1085 |
| 72 | Ga0207647_10016650 | 3300025904 | Bacteria | 5013 |
| 73 | Ga0207647_10046971 | 3300025904 | Bacteria | 2687 |
| 74 | Ga0207654_10284255 | 3300025911 | Bacteria | 1120 |
| 75 | Ga0207707_10143374 | 3300025912 | Bacteria | 2088 |
| 76 | Ga0207695_10016767 | 3300025913 | Bacteria | 8552 |
| 77 | Ga0207671_10027278 | 3300025914 | Bacteria | 4270 |
| 78 | Ga0207693_10174626 | 3300025915 | Bacteria | 1691 |
| 79 | Ga0207663_10050578 | 3300025916 | Bacteria | 2583 |
| 80 | Ga0207660_10070309 | 3300025917 | Bacteria | 2544 |
| 81 | Ga0207657_10092551 | 3300025919 | Bacteria | 2520 |
| 82 | Ga0207652_10109369 | 3300025921 | Bacteria | 2450 |
| 83 | Ga0207694_10010847 | 3300025924 | Bacteria | 6878 |
| 84 | Ga0207700_10149562 | 3300025928 | Bacteria | 1928 |
| 85 | Ga0207665_10092493 | 3300025939 | Bacteria | 2098 |
| 86 | Ga0207689_10143671 | 3300025942 | Bacteria | 1966 |
| 87 | Ga0207658_10345892 | 3300025986 | Bacteria | 1294 |
| 88 | Ga0207703_10083453 | 3300026035 | Bacteria | 2670 |
| 89 | Ga0207639_10064323 | 3300026041 | Bacteria | 2843 |
| 90 | Ga0207678_10157852 | 3300026067 | Bacteria | 1937 |
| 91 | Ga0207702_10003596 | 3300026078 | Bacteria | 14085 |
| 92 | Ga0207702_10180217 | 3300026078 | Bacteria | 1945 |
| 93 | Ga0207702_10269772 | 3300026078 | Bacteria | 1605 |
| 94 | Ga0207674_10397189 | 3300026116 | Bacteria | 1333 |
| 95 | Ga0268266_10522140 | 3300028379 | Bacteria | 1135 |
| 96 | Ga0268264_10226442 | 3300028381 | Bacteria | 1724 |
| 97 | Ga0307517_10349996 | 3300028786 | Bacteria | 803 |
| 98 | Ga0307508_10003624 | 3300031616 | Bacteria | 15507 |
| 99 | Ga0307516_10001159 | 3300031730 | Bacteria | 36887 |
| 100 | Ga0373929_0068118 | 3300035085 | Bacteria | 846 |
| 101 | Ga0373940_0012197 | 3300035088 | Bacteria | 2055 |
| 102 | Ga0373949_0005871 | 3300035090 | Bacteria | 2727 |
| 103 | Ga0373941_0053389 | 3300035115 | Bacteria | 1292 |
| 104 | Ga0373924_0074358 | 3300035410 | Bacteria | 1437 |
| 105 | Ga0373931_0014014 | 3300035691 | Bacteria | 3912 |
| 106 | Ga0451839_0573886 | 3300041496 | Bacteria | 1085 |
| 107 | Ga0451841_0248838 | 3300041498 | Bacteria | 917 |
| 108 | Ga0466966_0001015 | 3300044684 | Bacteria | 17896 |
| 109 | Ga0466961_0004635 | 3300044693 | Bacteria | 8629 |
| 110 | Ga0466959_0051213 | 3300045049 | Bacteria | 3030 |
| 111 | Ga0466967_0048940 | 3300045976 | Bacteria | 3694 |
| 112 | Ga0495592_0042785 | 3300046454 | Bacteria | 3391 |
| 113 | Ga0495592_0143040 | 3300046454 | Bacteria | 1661 |
| 114 | Ga0495590_0067766 | 3300046457 | Bacteria | 1251 |
| 115 | Ga0495638_0004908 | 3300046460 | Bacteria | 10052 |
| 116 | Ga0495651_0002101 | 3300046462 | Bacteria | 15375 |
| 117 | Ga0495580_0004600 | 3300046472 | Bacteria | 11577 |
| 118 | Ga0495664_0017489 | 3300046477 | Bacteria | 4100 |
| 119 | Ga0495596_0076526 | 3300046500 | Bacteria | 1300 |
| 120 | Ga0495606_0153212 | 3300046507 | Bacteria | 1351 |
| 121 | Ga0495606_0238146 | 3300046507 | Bacteria | 1016 |
| 122 | Ga0495632_0121803 | 3300046519 | Bacteria | 1219 |
| 123 | Ga0495643_0038478 | 3300046522 | Bacteria | 2619 |
| 124 | Ga0495652_0015538 | 3300046529 | Bacteria | 6814 |
| 125 | Ga0495586_0177173 | 3300046535 | Bacteria | 1206 |
| 126 | Ga0495587_0005502 | 3300046536 | Bacteria | 8264 |
| 127 | Ga0495645_0002752 | 3300046543 | Bacteria | 11949 |
| 128 | Ga0495667_0021116 | 3300046559 | Bacteria | 4392 |
| 129 | Ga0495668_0036802 | 3300046616 | Bacteria | 2741 |
| 130 | Ga0495634_0039020 | 3300046642 | Bacteria | 3236 |
| 131 | Ga0495611_0147310 | 3300046648 | Bacteria | 1099 |
| 132 | Ga0495625_0105919 | 3300046660 | Bacteria | 1926 |
| 133 | Ga0495635_0025208 | 3300046663 | Bacteria | 4142 |
| 134 | Ga0495657_0002643 | 3300046675 | Bacteria | 14975 |
| 135 | Ga0495599_0015152 | 3300046678 | Bacteria | 4781 |
| 136 | Ga0495623_0030903 | 3300046679 | Bacteria | 3445 |
| 137 | Ga0495646_0014214 | 3300046680 | Bacteria | 5062 |
| 138 | Ga0495624_0039317 | 3300046690 | Bacteria | 3033 |
| 139 | Ga0495604_0004468 | 3300047317 | Bacteria | 11080 |
| 140 | Ga0495674_0011854 | 3300047319 | Bacteria | 8218 |
| 141 | Ga0495680_0016739 | 3300047322 | Bacteria | 6287 |
| 142 | Ga0495680_0082049 | 3300047322 | Bacteria | 2433 |
| 143 | Ga0495687_012698 | 3300047443 | Bacteria | 4441 |
| 144 | Ga0495675_0007079 | 3300047444 | Bacteria | 6902 |
| 145 | Ga0495684_0156271 | 3300047471 | Bacteria | 1703 |
| 146 | Ga0495686_0156400 | 3300047472 | Bacteria | 1335 |
| 147 | Ga0495686_0162949 | 3300047472 | Bacteria | 1302 |
| 148 | Ga0495593_0172601 | 3300047673 | Bacteria | 1090 |
| 149 | Ga0495602_0002010 | 3300048088 | Bacteria | 20455 |
| 150 | Ga0496100_0037745 | 3300048903 | Bacteria | 3057 |
| 151 | Ga0496101_0052666 | 3300048904 | Bacteria | 2935 |
| 152 | Ga0496102_0084276 | 3300048905 | Bacteria | 2933 |
| 153 | Ga0496103_0015869 | 3300048906 | Bacteria | 4491 |
| 154 | Ga0496104_0032734 | 3300048907 | Bacteria | 4839 |
| 155 | Ga0496104_0066205 | 3300048907 | Bacteria | 3430 |
| 156 | Ga0496105_0091450 | 3300048908 | Bacteria | 2512 |
| 157 | Ga0496105_0105334 | 3300048908 | Bacteria | 2328 |
| 158 | Ga0496107_0130999 | 3300048910 | Bacteria | 1851 |
| 159 | Ga0496107_0144113 | 3300048910 | Bacteria | 1761 |
| 160 | Ga0496108_0004743 | 3300048911 | Bacteria | 10963 |
| 161 | Ga0496109_0092534 | 3300048912 | Bacteria | 2797 |
| 162 | Ga0496110_0308123 | 3300048913 | Bacteria | 1442 |
| 163 | Ga0496110_0741997 | 3300048913 | Bacteria | 885 |
| 164 | Ga0496112_0083283 | 3300048915 | Bacteria | 3163 |
| 165 | Ga0496112_0792961 | 3300048915 | Bacteria | 872 |
| 166 | Ga0496113_0216513 | 3300048916 | Bacteria | 1526 |
| 167 | Ga0496115_0109878 | 3300048918 | Bacteria | 2264 |
| 168 | Ga0496118_0088765 | 3300048921 | Bacteria | 2137 |
| 169 | Ga0496118_0145056 | 3300048921 | Bacteria | 1496 |
| 170 | Ga0496120_0018985 | 3300048923 | Bacteria | 4415 |
| 171 | Ga0496121_0044438 | 3300048924 | Bacteria | 3831 |
| 172 | Ga0496121_0092559 | 3300048924 | Bacteria | 2356 |
| 173 | Ga0496121_0184708 | 3300048924 | Bacteria | 1501 |
| 174 | Ga0496124_0230028 | 3300048927 | Bacteria | 1387 |
| 175 | Ga0496126_0046385 | 3300048929 | Bacteria | 3986 |
| 176 | Ga0496126_0327130 | 3300048929 | Bacteria | 1259 |
| 177 | Ga0501034_0198480 | 3300049571 | Bacteria | 1965 |
| 178 | Ga0501039_0185399 | 3300049575 | Bacteria | 1636 |
| 179 | Ga0501040_0006333 | 3300049576 | Bacteria | 7685 |
| 180 | Ga0501041_0028180 | 3300049577 | Bacteria | 3387 |
| 181 | Ga0501046_0148967 | 3300049580 | Bacteria | 1766 |
| 182 | Ga0501047_0107929 | 3300049581 | Bacteria | 2665 |
| 183 | Ga0501048_0072239 | 3300049582 | Bacteria | 2436 |
| 184 | Ga0501067_0042735 | 3300049583 | Bacteria | 2516 |
| 185 | Ga0501069_0033680 | 3300049585 | Bacteria | 2822 |
| 186 | Ga0501070_0080112 | 3300049586 | Bacteria | 2702 |
| 187 | Ga0501070_0096737 | 3300049586 | Bacteria | 2442 |
| 188 | Ga0501072_0001413 | 3300049588 | Bacteria | 18042 |
| 189 | Ga0501072_0027162 | 3300049588 | Bacteria | 4466 |
| 190 | Ga0501074_0104432 | 3300049590 | Bacteria | 2028 |
| 191 | Ga0501074_0234043 | 3300049590 | Bacteria | 1307 |
| 192 | Ga0501079_0045522 | 3300049741 | Bacteria | 3386 |
| 193 | Ga0501079_0093828 | 3300049741 | Bacteria | 2325 |
| 194 | Ga0501080_0021859 | 3300049742 | Bacteria | 5925 |
| 195 | Ga0501035_0069165 | 3300049822 | Bacteria | 3130 |
| 196 | Ga0501035_0132830 | 3300049822 | Bacteria | 2169 |
| 197 | Ga0501044_0061300 | 3300049823 | Bacteria | 3848 |
| 198 | Ga0501045_0075406 | 3300049824 | Bacteria | 2484 |
| 199 | nmdc:mga00v17_18144_c1 | 3300050491 | Bacteria | 3992 |
| 200 | nmdc:mga0yw44_32546_c1 | 3300050492 | Bacteria | 3039 |
| 201 | nmdc:mga0yw44_4139_c1 | 3300050492 | Bacteria | 2459 |
| 202 | nmdc:mga0k408_79893_c1 | 3300050493 | Bacteria | 1914 |
| 203 | nmdc:mga06z11_82458_c1 | 3300050494 | Bacteria | 1729 |
| 204 | nmdc:mga0rr50_183963_c1 | 3300050513 | Bacteria | 1709 |
| 205 | nmdc:mga0sz30_113562_c1 | 3300050516 | Bacteria | 1188 |
| 206 | Ga0495619_0304870 | 3300053085 | Bacteria | 1103 |
| 207 | Ga0500578_0194790 | 3300053086 | Bacteria | 1243 |
| 208 | Ga0500643_000019 | 3300053087 | Bacteria | 294301 |
| 209 | Ga0500643_046835 | 3300053087 | Bacteria | 1248 |
| 210 | Ga0500651_0321801 | 3300053093 | Bacteria | 883 |
| 211 | Ga0500566_0002434 | 3300053094 | Bacteria | 11036 |
| 212 | Ga0500555_007767 | 3300053103 | Bacteria | 3051 |
| 213 | Ga0500556_0011511 | 3300053104 | Bacteria | 2621 |
| 214 | Ga0500557_000039 | 3300053105 | Bacteria | 66862 |
| 215 | Ga0500642_0000285 | 3300053130 | Bacteria | 18457 |
| 216 | Ga0500568_0028521 | 3300053139 | Bacteria | 2326 |
| 217 | Ga0500568_0043169 | 3300053139 | Bacteria | 1803 |
| 218 | Ga0500568_0054666 | 3300053139 | Bacteria | 1560 |
| 219 | Ga0500577_0056665 | 3300053142 | Bacteria | 1493 |
| 220 | Ga0500622_0004934 | 3300053156 | Bacteria | 8134 |
| 221 | Ga0500622_0004962 | 3300053156 | Bacteria | 8109 |
| 222 | Ga0500638_036514 | 3300053162 | Bacteria | 2383 |
| 223 | Ga0500636_0000313 | 3300053177 | Bacteria | 26675 |
| 224 | Ga0500636_0122410 | 3300053177 | Bacteria | 1458 |
| 225 | Ga0500636_0154568 | 3300053177 | Bacteria | 1257 |
| 226 | Ga0500625_020232 | 3300053729 | Bacteria | 3131 |
| 227 | Ga0500599_004216 | 3300053736 | Bacteria | 1776 |
| 228 | Ga0500601_000294 | 3300053737 | Bacteria | 9383 |
| 229 | Ga0500601_005660 | 3300053737 | Bacteria | 1371 |
| 230 | Ga0501084_0018723 | 3300054114 | Bacteria | 5765 |
| 231 | Ga0501084_0176504 | 3300054114 | Bacteria | 1803 |
| 232 | Ga0501082_0036961 | 3300060353 | Bacteria | 4207 |
| 233 | 2507510110 | 2507262055 | Bacteria | 8048963 |
| 234 | 2508544112 | 2508501009 | Bacteria | 7784016 |
| 235 | 2508697948 | 2508501042 | Bacteria | 8719808 |
| 236 | 2513643828 | 2513237094 | Bacteria | 8789602 |
| 237 | 2513648922 | 2513237095 | Bacteria | 8976980 |
| 238 | 2515629390 | 2515154112 | Bacteria | 8294334 |
| 239 | 2528849684 | 2528768022 | Bacteria | 10457665 |
| 240 | 2805919992 | 2802429603 | Bacteria | 8777136 |
| 241 | 2818241674 | 2816332527 | Bacteria | 8933356 |
| 242 | 2824668710 | 2824661429 | Bacteria | 9877870 |
| 243 | 2824698549 | 2824696289 | Bacteria | 8335049 |
| 244 | 2824713366 | 2824704595 | Bacteria | 9667483 |
| 245 | 2824758906 | 2824753945 | Bacteria | 9787441 |
| 246 | 2824766082 | 2824763712 | Bacteria | 9792355 |
| 247 | 2842038172 | 2842038055 | Bacteria | 8002051 |
| 248 | 2842048882 | 2842045827 | Bacteria | 8006841 |
| 249 | 2847945037 | 2847939898 | Bacteria | 8606328 |
| 250 | 2874593306 | 2874590934 | Bacteria | 8299676 |
| 251 | 2874623133 | 2874620515 | Bacteria | 8290088 |
| 252 | 2874636127 | 2874628541 | Bacteria | 8630250 |
| 253 | 2874652919 | 2874645413 | Bacteria | 8214782 |
| 254 | 2876773346 | 2876771140 | Bacteria | 8287509 |
| 255 | 2876821299 | 2876818435 | Bacteria | 8274608 |
| 256 | 2879077262 | 2879074833 | Bacteria | 8279565 |
| 257 | 2879107652 | 2879099564 | Bacteria | 10442239 |
| 258 | 2879130181 | 2879127579 | Bacteria | 8294491 |
| 259 | 2879146696 | 2879142872 | Bacteria | 8267021 |
| 260 | 2888382375 | 2888378607 | Bacteria | 9652610 |
| 261 | 2888388317 | 2888388044 | Bacteria | 7304136 |
| 262 | 2904669953 | 2904666416 | Bacteria | 8226587 |
| 263 | 2904718566 | 2904711408 | Bacteria | 9771557 |
| 264 | 2922375582 | |||
| 265 | 2929616320 | 2929615660 | Bacteria | 9193770 |
| 266 | 2929625064 | 2929624759 | Bacteria | 9339455 |
| 267 | 2932787011 | 2932784394 | Bacteria | 9704911 |
| 268 | 2932811213 | 2932809354 | Bacteria | 9135765 |
| 269 | 2932819914 | 2932818245 | Bacteria | 9955613 |
| 270 | 2932832399 | 2932828146 | Bacteria | 9745859 |
| 271 | 2933578396 | 2933577622 | Bacteria | 9116884 |
| 272 | 2935610984 | 2935608549 | Bacteria | 8203142 |
| 273 | 2935619103 | 2935616580 | Bacteria | 9032984 |
| 274 | 2935643077 | 2935638405 | Bacteria | 10015038 |
| 275 | 2935648416 | 2935648319 | Bacteria | 8801166 |
| 276 | 2935657596 | 2935656913 | Bacteria | 8965014 |
| 277 | 2935669704 | 2935665750 | Bacteria | 9571747 |
| 278 | 2935677155 | 2935675223 | Bacteria | 9928132 |
| 279 | 2935693190 | 2935684952 | Bacteria | 9590419 |
| 280 | 2935695315 | 2935694250 | Bacteria | 9291695 |
| 281 | 2935709577 | 2935703347 | Bacteria | 10242284 |
| 282 | 2935719798 | 2935713505 | Bacteria | 9608509 |
| 283 | 2935729435 | 2935722832 | Bacteria | 9608746 |
| 284 | 2935739681 | 2935732158 | Bacteria | 9706831 |
| 285 | 2935748719 | 2935741537 | Bacteria | 9707219 |
| 286 | 2935756694 | 2935750917 | Bacteria | 9590372 |
| 287 | 2935761322 | 2935760218 | Bacteria | 9817913 |
| 288 | 2935779094 | 2935777560 | Bacteria | 8077691 |
| 289 | 2935788298 | 2935785616 | Bacteria | 7962367 |
| 290 | 2935796937 | 2935793552 | Bacteria | 8012592 |
| 291 | 2935807227 | 2935801545 | Bacteria | 9301974 |
| 292 | 2935812359 | 2935810662 | Bacteria | 9401221 |
| 293 | 2935820469 | 2935819856 | Bacteria | 8261050 |
| 294 | 2935832778 | 2935827899 | Bacteria | 10038562 |
| 295 | 2935839141 | 2935837841 | Bacteria | 9454360 |
| 296 | 2935849522 | 2935847175 | Bacteria | 8228321 |
| 297 | 2935857468 | 2935855204 | Bacteria | 9035059 |
| 298 | 2935865000 | 2935864058 | Bacteria | 9784707 |
| 299 | 2935876778 | 2935873716 | Bacteria | 9632195 |
| 300 | 2935911705 | 2935908558 | Bacteria | 8568796 |
| 301 | 2935919360 | 2935916978 | Bacteria | 9113783 |
| 302 | 2935928734 | 2935926038 | Bacteria | 8601059 |
| 303 | 2935938379 | 2935934488 | Bacteria | 8602579 |
| 304 | 2935945729 | 2935942939 | Bacteria | 8599779 |
| 305 | 2935954664 | 2935951376 | Bacteria | 8602333 |
| 306 | 2935970551 | 2935967501 | Bacteria | 8603075 |
| 307 | 2935979207 | 2935975950 | Bacteria | 8347125 |
| 308 | 2935987775 | 2935984226 | Bacteria | 8302647 |
| 309 | 2935999610 | 2935992306 | Bacteria | 9802711 |
| 310 | 2936008368 | 2936002035 | Bacteria | 9362176 |
| 311 | 2936011326 | 2936011229 | Bacteria | 8801034 |
| 312 | 2936019921 | 2936019824 | Bacteria | 8804134 |
| 313 | 2936028517 | 2936028420 | Bacteria | 8965941 |
| 314 | 2936038952 | 2936037263 | Bacteria | 9446081 |
| 315 | 2936046644 | 2936046547 | Bacteria | 8903709 |
| 316 | 2936062337 | 2936055302 | Bacteria | 8785755 |
| 317 | 2940562608 | 2940556831 | Bacteria | 9590747 |
| 318 | 2941536301 | 2941531003 | Bacteria | 7653939 |
| 319 | 2941539831 | 2941538514 | Bacteria | 9402094 |
| 320 | 3005597388 | 3005594810 | Bacteria | 8716512 |
| 321 | 8016515201 | 8016511872 | Bacteria | 9921665 |
| 322 | 8016590749 | 8016583857 | Bacteria | 10421953 |
| 323 | 8016612312 | 8016603502 | Bacteria | 8731218 |
| 324 | 8016621494 | 8016613128 | Bacteria | 8794220 |
| 325 | 8016632669 | 8016630954 | Bacteria | 9217207 |
| 326 | 8017061257 | 8017057580 | Bacteria | 10023680 |
| 327 | 8019588462 | 8019586578 | Bacteria | 10212056 |
| 328 | 8019602875 | 8019597564 | Bacteria | 10041141 |
| 329 | 8019615680 | 8019608314 | Bacteria | 10042931 |
| 330 | 8019626432 | 8019619141 | Bacteria | 9218857 |
| 331 | 8019636062 | 8019629233 | Bacteria | 8687553 |
| 332 | 8019643604 | 8019638758 | Bacteria | 9062356 |
| 333 | 8019656393 | 8019648815 | Bacteria | 10014479 |
| 334 | 8019663829 | 8019659431 | Bacteria | 8577854 |
| 335 | 8019673458 | 8019668869 | Bacteria | 8791617 |
| 336 | 8019682673 | 8019678201 | Bacteria | 8863603 |
| 337 | 8019688351 | 8019687851 | Bacteria | 8712826 |
| 338 | 8055747966 | 8055742211 | Bacteria | 9226248 |
| 339 | Ga0207688_10055829 | |||
| 340 | JGI25153J46596_10002305 | |||
| 341 | JGI25160J50197_1003920 | |||
| 342 | JGI25160J50197_1029827 | |||
| 343 | Ga0065165_1001284 | |||
| 344 | Ga0065165_1001991 | |||
| 345 | Ga0065165_1016318 | |||
| 346 | Ga0070658_10043379 | |||
| 347 | Ga0070682_100022845 | |||
| 348 | Ga0070668_100047791 | |||
| 349 | Ga0070668_100288118 | |||
| 350 | Ga0070669_100523622 | |||
| 351 | Ga0070671_100031562 | |||
| 352 | Ga0070709_10000905 | |||
| 353 | Ga0070713_100286856 | |||
| 354 | Ga0070710_10035611 | |||
| 355 | Ga0070663_100018929 | |||
| 356 | Ga0070663_100256969 | |||
| 357 | Ga0070679_100036624 | |||
| 358 | Ga0068853_100293653 | |||
| 359 | Ga0070665_100014065 | |||
| 360 | Ga0068855_100314383 | |||
| 361 | Ga0068856_100265394 | |||
| 362 | Ga0068858_100164216 | |||
| 363 | Ga0070717_10026821 | |||
| 364 | Ga0070717_10444187 | |||
| 365 | Ga0075365_10072255 | |||
| 366 | Ga0075365_10331237 | |||
| 367 | Ga0075368_10027067 | |||
| 368 | Ga0075364_10064426 | |||
| 369 | Ga0070715_10022688 | |||
| 370 | Ga0070712_100155151 | |||
| 371 | Ga0075369_10167045 | |||
| 372 | Ga0075366_10241282 | |||
| 373 | Ga0075370_10040938 | |||
| 374 | Ga0075370_10090066 | |||
| 375 | Ga0105240_10010309 | |||
| 376 | Ga0105245_10313500 | |||
| 377 | Ga0105247_10288808 | |||
| 378 | Ga0105243_10108383 | |||
| 379 | Ga0105248_10131786 | |||
| 380 | Ga0105237_10008586 | |||
| 381 | Ga0105237_10492189 | |||
| 382 | Ga0105238_10127702 | |||
| 383 | Ga0105238_10469951 | |||
| 384 | Ga0105239_10002709 | |||
| 385 | Ga0105239_10026761 | |||
| 386 | Ga0105239_10116899 | |||
| 387 | Ga0105246_10202071 | |||
| 388 | Ga0157370_10194751 | |||
| 389 | Ga0157370_10449387 | |||
| 390 | Ga0157375_10351003 | |||
| 391 | Ga0163163_10102904 | |||
| 392 | Ga0163163_10264047 | |||
| 393 | Ga0157376_10579850 | |||
| 394 | Ga0163161_10249539 | |||
| 395 | Ga0209563_104197 | |||
| 396 | Ga0207425_1011992 | |||
| 397 | Ga0209677_110106 | |||
| 398 | Ga0209455_1017589 | |||
| 399 | Ga0209758_1000407 | |||
| 400 | Ga0209758_1018713 | |||
| 401 | Ga0209758_1048633 | |||
| 402 | Ga0209256_1003878 | |||
| 403 | Ga0207426_1001843 | |||
| 404 | Ga0207426_1012545 | |||
| 405 | Ga0207426_1027900 | |||
| 406 | Ga0207426_1056588 | |||
| 407 | Ga0209257_1001136 | |||
| 408 | Ga0207697_10157561 | |||
| 409 | Ga0207656_10155495 | |||
| 410 | Ga0207647_10016650 | |||
| 411 | Ga0207647_10046971 | |||
| 412 | Ga0207654_10284255 | |||
| 413 | Ga0207707_10143374 | |||
| 414 | Ga0207695_10016767 | |||
| 415 | Ga0207671_10027278 | |||
| 416 | Ga0207693_10174626 | |||
| 417 | Ga0207663_10050578 | |||
| 418 | Ga0207660_10070309 | |||
| 419 | Ga0207657_10092551 | |||
| 420 | Ga0207652_10109369 | |||
| 421 | Ga0207694_10010847 | |||
| 422 | Ga0207700_10149562 | |||
| 423 | Ga0207665_10092493 | |||
| 424 | Ga0207689_10143671 | |||
| 425 | Ga0207658_10345892 | |||
| 426 | Ga0207703_10083453 | |||
| 427 | Ga0207639_10064323 | |||
| 428 | Ga0207678_10157852 | |||
| 429 | Ga0207702_10003596 | |||
| 430 | Ga0207702_10180217 | |||
| 431 | Ga0207702_10269772 | |||
| 432 | Ga0207674_10397189 | |||
| 433 | Ga0268266_10522140 | |||
| 434 | Ga0268264_10226442 | |||
| 435 | Ga0307517_10349996 | |||
| 436 | Ga0307508_10003624 | |||
| 437 | Ga0307516_10001159 | |||
| 438 | Ga0373929_0068118 | |||
| 439 | Ga0373940_0012197 | |||
| 440 | Ga0373949_0005871 | |||
| 441 | Ga0373941_0053389 | |||
| 442 | Ga0373924_0074358 | |||
| 443 | Ga0373931_0014014 | |||
| 444 | Ga0451839_0573886 | |||
| 445 | Ga0451841_0248838 | |||
| 446 | Ga0466966_0001015 | |||
| 447 | Ga0466961_0004635 | |||
| 448 | Ga0466959_0051213 | |||
| 449 | Ga0466967_0048940 | |||
| 450 | Ga0495592_0042785 | |||
| 451 | Ga0495592_0143040 | |||
| 452 | Ga0495590_0067766 | |||
| 453 | Ga0495638_0004908 | |||
| 454 | Ga0495651_0002101 | |||
| 455 | Ga0495580_0004600 | |||
| 456 | Ga0495664_0017489 | |||
| 457 | Ga0495596_0076526 | |||
| 458 | Ga0495606_0153212 | |||
| 459 | Ga0495606_0238146 | |||
| 460 | Ga0495632_0121803 | |||
| 461 | Ga0495643_0038478 | |||
| 462 | Ga0495652_0015538 | |||
| 463 | Ga0495586_0177173 | |||
| 464 | Ga0495587_0005502 | |||
| 465 | Ga0495645_0002752 | |||
| 466 | Ga0495667_0021116 | |||
| 467 | Ga0495668_0036802 | |||
| 468 | Ga0495634_0039020 | |||
| 469 | Ga0495611_0147310 | |||
| 470 | Ga0495625_0105919 | |||
| 471 | Ga0495635_0025208 | |||
| 472 | Ga0495657_0002643 | |||
| 473 | Ga0495599_0015152 | |||
| 474 | Ga0495623_0030903 | |||
| 475 | Ga0495646_0014214 | |||
| 476 | Ga0495624_0039317 | |||
| 477 | Ga0495604_0004468 | |||
| 478 | Ga0495674_0011854 | |||
| 479 | Ga0495680_0016739 | |||
| 480 | Ga0495680_0082049 | |||
| 481 | Ga0495687_012698 | |||
| 482 | Ga0495675_0007079 | |||
| 483 | Ga0495684_0156271 | |||
| 484 | Ga0495686_0156400 | |||
| 485 | Ga0495686_0162949 | |||
| 486 | Ga0495593_0172601 | |||
| 487 | Ga0495602_0002010 | |||
| 488 | Ga0496100_0037745 | |||
| 489 | Ga0496101_0052666 | |||
| 490 | Ga0496102_0084276 | |||
| 491 | Ga0496103_0015869 | |||
| 492 | Ga0496104_0032734 | |||
| 493 | Ga0496104_0066205 | |||
| 494 | Ga0496105_0091450 | |||
| 495 | Ga0496105_0105334 | |||
| 496 | Ga0496107_0130999 | |||
| 497 | Ga0496107_0144113 | |||
| 498 | Ga0496108_0004743 | |||
| 499 | Ga0496109_0092534 | |||
| 500 | Ga0496110_0308123 | |||
| 501 | Ga0496110_0741997 | |||
| 502 | Ga0496112_0083283 | |||
| 503 | Ga0496112_0792961 | |||
| 504 | Ga0496113_0216513 | |||
| 505 | Ga0496115_0109878 | |||
| 506 | Ga0496118_0088765 | |||
| 507 | Ga0496118_0145056 | |||
| 508 | Ga0496120_0018985 | |||
| 509 | Ga0496121_0044438 | |||
| 510 | Ga0496121_0092559 | |||
| 511 | Ga0496121_0184708 | |||
| 512 | Ga0496124_0230028 | |||
| 513 | Ga0496126_0046385 | |||
| 514 | Ga0496126_0327130 | |||
| 515 | Ga0501034_0198480 | |||
| 516 | Ga0501039_0185399 | |||
| 517 | Ga0501040_0006333 | |||
| 518 | Ga0501041_0028180 | |||
| 519 | Ga0501046_0148967 | |||
| 520 | Ga0501047_0107929 | |||
| 521 | Ga0501048_0072239 | |||
| 522 | Ga0501067_0042735 | |||
| 523 | Ga0501069_0033680 | |||
| 524 | Ga0501070_0080112 | |||
| 525 | Ga0501070_0096737 | |||
| 526 | Ga0501072_0001413 | |||
| 527 | Ga0501072_0027162 | |||
| 528 | Ga0501074_0104432 | |||
| 529 | Ga0501074_0234043 | |||
| 530 | Ga0501079_0045522 | |||
| 531 | Ga0501079_0093828 | |||
| 532 | Ga0501080_0021859 | |||
| 533 | Ga0501035_0069165 | |||
| 534 | Ga0501035_0132830 | |||
| 535 | Ga0501044_0061300 | |||
| 536 | Ga0501045_0075406 | |||
| 537 | nmdc:mga00v17_18144_c1 | |||
| 538 | nmdc:mga0yw44_32546_c1 | |||
| 539 | nmdc:mga0yw44_4139_c1 | |||
| 540 | nmdc:mga0k408_79893_c1 | |||
| 541 | nmdc:mga06z11_82458_c1 | |||
| 542 | nmdc:mga0rr50_183963_c1 | |||
| 543 | nmdc:mga0sz30_113562_c1 | |||
| 544 | Ga0495619_0304870 | |||
| 545 | Ga0500578_0194790 | |||
| 546 | Ga0500643_000019 | |||
| 547 | Ga0500643_046835 | |||
| 548 | Ga0500651_0321801 | |||
| 549 | Ga0500566_0002434 | |||
| 550 | Ga0500555_007767 | |||
| 551 | Ga0500556_0011511 | |||
| 552 | Ga0500557_000039 | |||
| 553 | Ga0500642_0000285 | |||
| 554 | Ga0500568_0028521 | |||
| 555 | Ga0500568_0043169 | |||
| 556 | Ga0500568_0054666 | |||
| 557 | Ga0500577_0056665 | |||
| 558 | Ga0500622_0004934 | |||
| 559 | Ga0500622_0004962 | |||
| 560 | Ga0500638_036514 | |||
| 561 | Ga0500636_0000313 | |||
| 562 | Ga0500636_0122410 | |||
| 563 | Ga0500636_0154568 | |||
| 564 | Ga0500625_020232 | |||
| 565 | Ga0500599_004216 | |||
| 566 | Ga0500601_000294 | |||
| 567 | Ga0500601_005660 | |||
| 568 | Ga0501084_0018723 | |||
| 569 | Ga0501084_0176504 | |||
| 570 | Ga0501082_0036961 | |||
| 571 | 2507510110 | |||
| 572 | 2508544112 | |||
| 573 | 2508697948 | |||
| 574 | 2513643828 | |||
| 575 | 2513648922 | |||
| 576 | 2515629390 | |||
| 577 | 2528849684 | |||
| 578 | 2805919992 | |||
| 579 | 2818241674 | |||
| 580 | 2824668710 | |||
| 581 | 2824698549 | |||
| 582 | 2824713366 | |||
| 583 | 2824758906 | |||
| 584 | 2824766082 | |||
| 585 | 2842038172 | |||
| 586 | 2842048882 | |||
| 587 | 2847945037 | |||
| 588 | 2874593306 | |||
| 589 | 2874623133 | |||
| 590 | 2874636127 | |||
| 591 | 2874652919 | |||
| 592 | 2876773346 | |||
| 593 | 2876821299 | |||
| 594 | 2879077262 | |||
| 595 | 2879107652 | |||
| 596 | 2879130181 | |||
| 597 | 2879146696 | |||
| 598 | 2888382375 | |||
| 599 | 2888388317 | |||
| 600 | 2904669953 | |||
| 601 | 2904718566 | |||
| 602 | 2922375582 | |||
| 603 | 2929616320 | |||
| 604 | 2929625064 | |||
| 605 | 2932787011 | |||
| 606 | 2932811213 | |||
| 607 | 2932819914 | |||
| 608 | 2932832399 | |||
| 609 | 2933578396 | |||
| 610 | 2935610984 | |||
| 611 | 2935619103 | |||
| 612 | 2935643077 | |||
| 613 | 2935648416 | |||
| 614 | 2935657596 | |||
| 615 | 2935669704 | |||
| 616 | 2935677155 | |||
| 617 | 2935693190 | |||
| 618 | 2935695315 | |||
| 619 | 2935709577 | |||
| 620 | 2935719798 | |||
| 621 | 2935729435 | |||
| 622 | 2935739681 | |||
| 623 | 2935748719 | |||
| 624 | 2935756694 | |||
| 625 | 2935761322 | |||
| 626 | 2935779094 | |||
| 627 | 2935788298 | |||
| 628 | 2935796937 | |||
| 629 | 2935807227 | |||
| 630 | 2935812359 | |||
| 631 | 2935820469 | |||
| 632 | 2935832778 | |||
| 633 | 2935839141 | |||
| 634 | 2935849522 | |||
| 635 | 2935857468 | |||
| 636 | 2935865000 | |||
| 637 | 2935876778 | |||
| 638 | 2935911705 | |||
| 639 | 2935919360 | |||
| 640 | 2935928734 | |||
| 641 | 2935938379 | |||
| 642 | 2935945729 | |||
| 643 | 2935954664 | |||
| 644 | 2935970551 | |||
| 645 | 2935979207 | |||
| 646 | 2935987775 | |||
| 647 | 2935999610 | |||
| 648 | 2936008368 | |||
| 649 | 2936011326 | |||
| 650 | 2936019921 | |||
| 651 | 2936028517 | |||
| 652 | 2936038952 | |||
| 653 | 2936046644 | |||
| 654 | 2936062337 | |||
| 655 | 2940562608 | |||
| 656 | 2941536301 | |||
| 657 | 2941539831 | |||
| 658 | 3005597388 | |||
| 659 | 8016515201 | |||
| 660 | 8016590749 | |||
| 661 | 8016612312 | |||
| 662 | 8016621494 | |||
| 663 | 8016632669 | |||
| 664 | 8017061257 | |||
| 665 | 8019588462 | |||
| 666 | 8019602875 | |||
| 667 | 8019615680 | |||
| 668 | 8019626432 | |||
| 669 | 8019636062 | |||
| 670 | 8019643604 | |||
| 671 | 8019656393 | |||
| 672 | 8019663829 | |||
| 673 | 8019673458 | |||
| 674 | 8019682673 | |||
| 675 | 8019688351 | |||
| 676 | 8055747966 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7bw1-assembly1.cif.gz_A | crystal structure of steroid 5-alpha-reductase 2 in complex with finasteride | 0.4058 | 7 | 241 |
| 4a2n-assembly1.cif.gz_B | crystal structure of ma-icmt | 0.3997 | 53 | 238 |
| 7bw1-assembly1.cif.gz_A | crystal structure of steroid 5-alpha-reductase 2 in complex with finasteride | 0.3902 | 7 | 241 |
| 4a2n-assembly1.cif.gz_B | crystal structure of ma-icmt | 0.3862 | 53 | 238 |
| 7c83-assembly1.cif.gz_A | crystal structure of an integral membrane steroid 5-alpha-reductase pbsrd5a | 0.3442 | 7 | 240 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O05883_47_239_1.20.120.1630 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); | 0.9606 | 49 | 238 | 1.20.120.1630 |
| af_O05883_47_239_1.20.120.1630 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); | 0.9413 | 49 | 238 | 1.20.120.1630 |
| af_Q9VEG9_60_228_1.20.120.1630 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); | 0.8217 | 50 | 209 | 1.20.120.1630 |
| af_Q54JG5_70_234_1.20.120.1630 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); | 0.8159 | 50 | 208 | 1.20.120.1630 |
| af_Q6MG14_62_250_1.20.120.1630 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); | 0.8003 | 50 | 218 | 1.20.120.1630 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6I6SQV3-F1-model_v4 | methanethiol S-methyltransferase (EC 2.1.1.334) | 0.9774 | 4 | 238 |
GO:0008168
GO:0016020 GO:0032259 |
| AF-A0A836U4A6-F1-model_v4 | methanethiol S-methyltransferase (EC 2.1.1.334) | 0.9746 | 3 | 238 |
GO:0008168
GO:0016020 GO:0032259 |
| AF-A0A0M9TZ98-F1-model_v4 | deleted | 0.9723 | 3 | 240 |
|
| AF-A0A0Q2U2U2-F1-model_v4 | methanethiol S-methyltransferase (EC 2.1.1.334) | 0.9718 | 2 | 238 |
GO:0008168
GO:0016020 GO:0032259 |
| AF-K8P644-F1-model_v4 | methanethiol S-methyltransferase (EC 2.1.1.334) | 0.9716 | 3 | 238 |
GO:0008168
GO:0016020 GO:0032259 |