F413367

General Info

Members Datasets Scaffolds Average Seq Length
338 197 676 307

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100177334|Ga0070683_1001773342
Length 315
Sequence MLSYAIRRLLGAIPTLFIIITLAFFMMRIAPGGPFDSQRRLPPEIEQNVKAAYNLDKPVYQQYFIYLGKLAHGDLGPSYKNKDFSVNEMIADGLPVSARLGLAAIFLAVLVGLVMGTVAALRQNRASDYSVMFIAMIGITIPTFVMAPILTLVFGVYGVSLFGYDISLPVGGWNGGALRNMILPVIVLALPQIAVIARLTRGSMVEVLHSNYVRTARAKGLSSVQVVLRHALRAAVLPLVSYLGPAIAGILTGSLVVEQIFGIPGIGRYFVQGALNRDYTLVLGVLIYYATFVILLNLLADVLYAILDPRVRYAR

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
114 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
115 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
116 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
117 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
118 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
119 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
120 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
121 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
122 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
123 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
124 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
125 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
126 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
127 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
128 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
129 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
130 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
131 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
132 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
133 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
134 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
135 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
136 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
137 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
138 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
139 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
140 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
141 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
142 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
143 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
144 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
145 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
146 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
147 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
148 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
149 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
150 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
151 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
152 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
153 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
154 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
155 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
156 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
157 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
158 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
159 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
160 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
161 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
162 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
163 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
164 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
173 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
174 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
175 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
176 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
177 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
178 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
180 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
181 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
182 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
183 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
184 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
185 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
186 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
187 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
188 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
189 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
190 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
191 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
192 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
193 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
194 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
195 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
196 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
197 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.82
Metatranscriptomes 0
Isolates 1.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.78
Nodule 0.3
Rhizoplane 1.48
Rhizosphere 93.79
Stem 0
Stem Tuber 0
Unclassified 0.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100177334 3300005329 Bacteria 2023
2 rootH2_10013874 3300003320 Bacteria 39180
3 Ga0065165_1000030 3300005262 Bacteria 218104
4 Ga0070683_100107793 3300005329 Bacteria 2626
5 Ga0070690_100053537 3300005330 Bacteria 2582
6 Ga0068869_100183660 3300005334 Bacteria 1641
7 Ga0070666_10004222 3300005335 Bacteria 8725
8 Ga0070680_100325855 3300005336 Bacteria 1304
9 Ga0070691_10000470 3300005341 Bacteria 15022
10 Ga0070691_10003138 3300005341 Bacteria 7398
11 Ga0070669_100014577 3300005353 Bacteria 5594
12 Ga0070671_100080167 3300005355 Bacteria 2729
13 Ga0070673_100273583 3300005364 Bacteria 1479
14 Ga0070659_100084259 3300005366 Bacteria 2542
15 Ga0070667_100032540 3300005367 Bacteria 4350
16 Ga0070709_10002111 3300005434 Bacteria 10755
17 Ga0070714_100054598 3300005435 Bacteria 3413
18 Ga0070714_100283779 3300005435 Bacteria 1539
19 Ga0070713_100000003 3300005436 Bacteria 245840
20 Ga0070711_100048674 3300005439 Bacteria 2900
21 Ga0070705_100204897 3300005440 Bacteria 1355
22 Ga0070678_100099569 3300005456 Bacteria 2249
23 Ga0070678_100111231 3300005456 Bacteria 2143
24 Ga0070681_10075685 3300005458 Bacteria 3326
25 Ga0070681_10127190 3300005458 Bacteria 2481
26 Ga0068867_100082014 3300005459 Bacteria 2432
27 Ga0070685_10062247 3300005466 Bacteria 2188
28 Ga0070698_100311831 3300005471 Bacteria 1504
29 Ga0070679_100026387 3300005530 Bacteria 5707
30 Ga0070684_100231136 3300005535 Bacteria 1689
31 Ga0070684_100351799 3300005535 Bacteria 1355
32 Ga0068853_100004892 3300005539 Bacteria 10427
33 Ga0068853_100017793 3300005539 Bacteria 5869
34 Ga0070672_100302898 3300005543 Bacteria 1355
35 Ga0070696_100031186 3300005546 Bacteria 3652
36 Ga0070696_100061434 3300005546 Bacteria 2629
37 Ga0070693_100066788 3300005547 Bacteria 2105
38 Ga0070665_100062101 3300005548 Bacteria 3746
39 Ga0070665_100524267 3300005548 Bacteria 1196
40 Ga0070704_100036928 3300005549 Bacteria 3333
41 Ga0068855_100044328 3300005563 Bacteria 5264
42 Ga0068855_100083089 3300005563 Bacteria 3710
43 Ga0068855_100331932 3300005563 Bacteria 1679
44 Ga0070664_100146424 3300005564 Bacteria 2083
45 Ga0068857_100000050 3300005577 Bacteria 65116
46 Ga0068857_100092748 3300005577 Bacteria 2704
47 Ga0068854_100022614 3300005578 Bacteria 4287
48 Ga0068856_100000075 3300005614 Bacteria 94156
49 Ga0068856_100002400 3300005614 Bacteria 19276
50 Ga0068852_100062592 3300005616 Bacteria 3237
51 Ga0068859_100291691 3300005617 Bacteria 1724
52 Ga0068861_100014246 3300005719 Bacteria 5578
53 Ga0068851_10051870 3300005834 Bacteria 2085
54 Ga0068863_100110364 3300005841 Bacteria 2619
55 Ga0068858_100014877 3300005842 Bacteria 7319
56 Ga0068858_100056758 3300005842 Bacteria 3618
57 Ga0068860_100074164 3300005843 Bacteria 3235
58 Ga0068860_100238005 3300005843 Bacteria 1770
59 Ga0068860_100316853 3300005843 Bacteria 1530
60 Ga0068862_100008856 3300005844 Bacteria 8328
61 Ga0068862_100013681 3300005844 Bacteria 6720
62 Ga0081455_10064590 3300005937 Bacteria 3064
63 Ga0081538_10001712 3300005981 Bacteria 22358
64 Ga0081538_10008773 3300005981 Bacteria 8522
65 Ga0081538_10011982 3300005981 Bacteria 6986
66 Ga0070712_100000027 3300006175 Bacteria 77007
67 Ga0070712_100000104 3300006175 Bacteria 43217
68 Ga0070712_100132484 3300006175 Bacteria 1891
69 Ga0097621_100171645 3300006237 Bacteria 1869
70 Ga0075430_100321222 3300006846 Bacteria 1279
71 Ga0075431_100217471 3300006847 Bacteria 1950
72 Ga0075434_100029037 3300006871 Bacteria 5439
73 Ga0075434_100040144 3300006871 Bacteria 4636
74 Ga0068865_100024982 3300006881 Bacteria 3925
75 Ga0068865_100028123 3300006881 Bacteria 3721
76 Ga0075436_100000038 3300006914 Bacteria 82918
77 Ga0097620_100291709 3300006931 Bacteria 1724
78 Ga0075435_100030550 3300007076 Bacteria 4238
79 Ga0075435_100038530 3300007076 Bacteria 3811
80 Ga0105240_10004764 3300009093 Bacteria 20484
81 Ga0105240_10009051 3300009093 Bacteria 14138
82 Ga0105240_10089522 3300009093 Bacteria 3764
83 Ga0105240_10090560 3300009093 Bacteria 3738
84 Ga0105240_10281554 3300009093 Bacteria 1910
85 Ga0105240_10379286 3300009093 Bacteria 1597
86 Ga0111539_10001910 3300009094 Bacteria 27748
87 Ga0111539_10086682 3300009094 Bacteria 3679
88 Ga0114129_10216734 3300009147 Bacteria 2585
89 Ga0114129_10222402 3300009147 Bacteria 2546
90 Ga0105241_10015537 3300009174 Bacteria 5580
91 Ga0105241_10079006 3300009174 Bacteria 2572
92 Ga0105248_10000115 3300009177 Bacteria 90607
93 Ga0105237_10023827 3300009545 Bacteria 6264
94 Ga0105237_10370640 3300009545 Bacteria 1437
95 Ga0105237_10403971 3300009545 Bacteria 1371
96 Ga0105238_10003614 3300009551 Bacteria 15410
97 Ga0105238_10021903 3300009551 Bacteria 6511
98 Ga0105238_10031878 3300009551 Bacteria 5363
99 Ga0105238_10092993 3300009551 Bacteria 3003
100 Ga0105249_10128959 3300009553 Bacteria 2412
101 Ga0105239_10052961 3300010375 Bacteria 4451
102 Ga0105239_10182137 3300010375 Bacteria 2350
103 Ga0105239_10315735 3300010375 Bacteria 1762
104 Ga0105246_10003680 3300011119 Bacteria 9282
105 Ga0105246_10006742 3300011119 Bacteria 7021
106 Ga0157373_10005478 3300013100 Bacteria 9528
107 Ga0157371_10315060 3300013102 Bacteria 1134
108 Ga0157370_10001209 3300013104 Bacteria 32283
109 Ga0157370_10002547 3300013104 Bacteria 21885
110 Ga0157370_10241162 3300013104 Bacteria 1672
111 Ga0157369_10005836 3300013105 Bacteria 14313
112 Ga0157369_10084241 3300013105 Bacteria 3398
113 Ga0157369_10085684 3300013105 Bacteria 3366
114 Ga0157374_10026685 3300013296 Bacteria 5200
115 Ga0157378_10261069 3300013297 Bacteria 1662
116 Ga0163162_10014518 3300013306 Bacteria 7696
117 Ga0163162_10184022 3300013306 Bacteria 2216
118 Ga0157372_10009690 3300013307 Bacteria 10240
119 Ga0157372_10016943 3300013307 Bacteria 7823
120 Ga0157372_10308702 3300013307 Bacteria 1841
121 Ga0163163_10081326 3300014325 Bacteria 3241
122 Ga0163163_10138134 3300014325 Bacteria 2479
123 Ga0163163_10181490 3300014325 Bacteria 2152
124 Ga0163163_10279234 3300014325 Bacteria 1722
125 Ga0157379_10001643 3300014968 Bacteria 18470
126 Ga0157379_10010223 3300014968 Bacteria 8174
127 Ga0157376_10035389 3300014969 Bacteria 4039
128 Ga0163161_10087206 3300017792 Bacteria 2305
129 Ga0209148_1000387 3300025254 Bacteria 52738
130 Ga0209455_1000301 3300025272 Bacteria 50938
131 Ga0207699_10000178 3300025906 Bacteria 38460
132 Ga0207705_10000464 3300025909 Bacteria 34704
133 Ga0207705_10108942 3300025909 Bacteria 2045
134 Ga0207654_10032037 3300025911 Bacteria 2900
135 Ga0207654_10043879 3300025911 Bacteria 2536
136 Ga0207707_10009840 3300025912 Bacteria 8290
137 Ga0207707_10080797 3300025912 Bacteria 2839
138 Ga0207707_10204263 3300025912 Bacteria 1722
139 Ga0207695_10005790 3300025913 Bacteria 16269
140 Ga0207695_10018249 3300025913 Bacteria 8118
141 Ga0207695_10054568 3300025913 Bacteria 4172
142 Ga0207695_10094118 3300025913 Bacteria 3004
143 Ga0207695_10137817 3300025913 Bacteria 2392
144 Ga0207671_10057104 3300025914 Bacteria 2893
145 Ga0207693_10000369 3300025915 Bacteria 41242
146 Ga0207693_10012059 3300025915 Bacteria 6989
147 Ga0207657_10001994 3300025919 Bacteria 22061
148 Ga0207657_10274333 3300025919 Bacteria 1340
149 Ga0207649_10168302 3300025920 Bacteria 1524
150 Ga0207652_10001572 3300025921 Bacteria 20104
151 Ga0207681_10015320 3300025923 Bacteria 4781
152 Ga0207694_10029833 3300025924 Bacteria 4164
153 Ga0207694_10032050 3300025924 Bacteria 4020
154 Ga0207694_10046667 3300025924 Bacteria 3348
155 Ga0207694_10296642 3300025924 Bacteria 1330
156 Ga0207700_10000010 3300025928 Bacteria 298473
157 Ga0207700_10193956 3300025928 Bacteria 1708
158 Ga0207664_10045597 3300025929 Bacteria 3439
159 Ga0207664_10220154 3300025929 Bacteria 1646
160 Ga0207690_10203011 3300025932 Bacteria 1507
161 Ga0207686_10025023 3300025934 Bacteria 3466
162 Ga0207704_10025979 3300025938 Bacteria 3205
163 Ga0207704_10098962 3300025938 Bacteria 1939
164 Ga0207667_10013272 3300025949 Bacteria 9439
165 Ga0207667_10051181 3300025949 Bacteria 4356
166 Ga0207667_10138855 3300025949 Bacteria 2502
167 Ga0207651_10329839 3300025960 Bacteria 1278
168 Ga0207712_10037275 3300025961 Bacteria 3316
169 Ga0207658_10022566 3300025986 Bacteria 4384
170 Ga0207677_10065303 3300026023 Bacteria 2538
171 Ga0207677_10321542 3300026023 Bacteria 1286
172 Ga0207703_10012765 3300026035 Bacteria 6549
173 Ga0207703_10042177 3300026035 Bacteria 3659
174 Ga0207639_10006946 3300026041 Bacteria 7712
175 Ga0207639_10036426 3300026041 Bacteria 3646
176 Ga0207702_10000013 3300026078 Bacteria 257468
177 Ga0207702_10014985 3300026078 Bacteria 6430
178 Ga0207674_10000026 3300026116 Bacteria 151359
179 Ga0207674_10041754 3300026116 Bacteria 4742
180 Ga0207675_100051265 3300026118 Bacteria 3850
181 Ga0207683_10019997 3300026121 Bacteria 5720
182 Ga0207683_10139871 3300026121 Bacteria 2181
183 Ga0207683_10281499 3300026121 Bacteria 1520
184 Ga0207698_10034775 3300026142 Bacteria 3678
185 Ga0207428_10000149 3300027907 Bacteria 95135
186 Ga0268266_10019577 3300028379 Bacteria 5766
187 Ga0268266_10070244 3300028379 Bacteria 3034
188 Ga0268266_10195970 3300028379 Bacteria 1846
189 Ga0268266_10275866 3300028379 Bacteria 1562
190 Ga0268265_10024941 3300028380 Bacteria 4238
191 Ga0268264_10314785 3300028381 Bacteria 1478
192 Ga0265337_1002455 3300028556 Bacteria 8482
193 Ga0265334_10008290 3300028573 Bacteria 4422
194 Ga0265338_10005761 3300028800 Bacteria 16028
195 Ga0265338_10038957 3300028800 Bacteria 4493
196 Ga0265338_10107200 3300028800 Bacteria 2260
197 Ga0265338_10224954 3300028800 Bacteria 1399
198 Ga0265338_10281012 3300028800 Bacteria 1216
199 Ga0265320_10000247 3300031240 Bacteria 44410
200 Ga0265325_10000235 3300031241 Bacteria 39445
201 Ga0265325_10001598 3300031241 Bacteria 15811
202 Ga0265325_10011597 3300031241 Bacteria 5062
203 Ga0265325_10017280 3300031241 Bacteria 4011
204 Ga0265325_10068423 3300031241 Bacteria 1787
205 Ga0265325_10087098 3300031241 Bacteria 1544
206 Ga0265329_10042629 3300031242 Bacteria 1453
207 Ga0265340_10003427 3300031247 Bacteria 8954
208 Ga0265340_10028456 3300031247 Bacteria 2811
209 Ga0265339_10004458 3300031249 Bacteria 9553
210 Ga0265339_10036183 3300031249 Bacteria 2765
211 Ga0265339_10040686 3300031249 Bacteria 2583
212 Ga0265331_10004156 3300031250 Bacteria 9076
213 Ga0265331_10085917 3300031250 Bacteria 1457
214 Ga0265316_10029209 3300031344 Bacteria 4537
215 Ga0265316_10037716 3300031344 Bacteria 3898
216 Ga0265316_10062553 3300031344 Bacteria 2888
217 Ga0265316_10093706 3300031344 Bacteria 2288
218 Ga0265316_10287266 3300031344 Bacteria 1201
219 Ga0265313_10000778 3300031595 Bacteria 32214
220 Ga0265313_10001565 3300031595 Bacteria 21230
221 Ga0265313_10014478 3300031595 Bacteria 4655
222 Ga0265313_10036349 3300031595 Bacteria 2473
223 Ga0265313_10037732 3300031595 Bacteria 2412
224 Ga0265313_10069800 3300031595 Bacteria 1621
225 Ga0265314_10003735 3300031711 Bacteria 14576
226 Ga0265314_10004923 3300031711 Bacteria 12197
227 Ga0265314_10018276 3300031711 Bacteria 5471
228 Ga0265314_10047471 3300031711 Bacteria 3021
229 Ga0265314_10072066 3300031711 Bacteria 2309
230 Ga0265314_10072647 3300031711 Bacteria 2297
231 Ga0265314_10116186 3300031711 Bacteria 1692
232 Ga0265342_10006719 3300031712 Bacteria 8523
233 Ga0265342_10019448 3300031712 Bacteria 4376
234 Ga0265342_10039666 3300031712 Bacteria 2859
235 Ga0316576_10004156 3300031727 Bacteria 8637
236 Ga0316577_10013039 3300031733 Bacteria 4534
237 Ga0307413_10023745 3300031824 Bacteria 3328
238 Ga0307410_10055433 3300031852 Bacteria 2691
239 Ga0307410_10265381 3300031852 Bacteria 1341
240 Ga0307406_10081603 3300031901 Bacteria 2151
241 Ga0307406_10296219 3300031901 Bacteria 1241
242 Ga0307409_100044937 3300031995 Bacteria 3331
243 Ga0307409_100368340 3300031995 Bacteria 1362
244 Ga0373932_0089316 3300035112 Bacteria 986
245 Ga0373936_0034828 3300035113 Bacteria 2002
246 Ga0373955_0123263 3300035172 Bacteria 1508
247 Ga0316574_0150884 3300035398 Bacteria 1497
248 Ga0373931_0025583 3300035691 Bacteria 2997
249 Ga0373935_0152504 3300035692 Bacteria 1569
250 Ga0373933_0092151 3300035724 Bacteria 1871
251 Ga0373933_0120169 3300035724 Bacteria 1645
252 Ga0373937_0002815 3300036401 Bacteria 14531
253 Ga0373937_0178305 3300036401 Bacteria 1995
254 Ga0373937_0276962 3300036401 Bacteria 1584
255 Ga0373937_0530473 3300036401 Bacteria 1118
256 Ga0373937_0747646 3300036401 Unclassified 925
257 Ga0395900_0086036 3300037418 Bacteria 3231
258 Ga0395898_0166022 3300037466 Bacteria 2111
259 Ga0395905_0348009 3300037471 Bacteria 1374
260 Ga0400483_128436 3300039062 Bacteria 19438
261 Ga0400483_168771 3300039062 Bacteria 15516
262 Ga0400483_225585 3300039062 Bacteria 2580
263 Ga0400483_272980 3300039062 Bacteria 1753
264 Ga0436365_0082781 3300039437 Bacteria 3457
265 Ga0436360_0926549 3300039438 Bacteria 2746
266 Ga0436363_1424133 3300039450 Bacteria 2831
267 Ga0436362_0319077 3300039453 Bacteria 1106
268 Ga0451576_0153073 3300045051 Bacteria 2405
269 Ga0495580_0196323 3300046472 Bacteria 1391
270 Ga0495582_0118256 3300046473 Bacteria 1492
271 Ga0495652_0285033 3300046529 Bacteria 1208
272 Ga0495621_0041825 3300046539 Bacteria 1611
273 Ga0495625_0387662 3300046660 Bacteria 875
274 Ga0495657_0314842 3300046675 Bacteria 931
275 Ga0495674_0012898 3300047319 Bacteria 7870
276 Ga0495676_0149680 3300047321 Bacteria 1663
277 Ga0495602_0119218 3300048088 Unclassified 2127
278 Ga0496100_0074424 3300048903 Bacteria 2276
279 Ga0496102_0029197 3300048905 Bacteria 4933
280 Ga0496106_0199424 3300048909 Bacteria 1593
281 Ga0496107_0224014 3300048910 Bacteria 1399
282 Ga0496112_0154987 3300048915 Bacteria 2258
283 Ga0496126_0000859 3300048929 Bacteria 53488
284 Ga0501031_0064966 3300049568 Bacteria 2377
285 Ga0501032_0011639 3300049569 Bacteria 6308
286 Ga0501032_0127929 3300049569 Bacteria 1677
287 Ga0501033_0008128 3300049570 Bacteria 8123
288 Ga0501034_0092233 3300049571 Bacteria 3026
289 Ga0501034_0123429 3300049571 Bacteria 2576
290 Ga0501034_0522916 3300049571 Bacteria 1098
291 Ga0501038_0077253 3300049574 Bacteria 2811
292 Ga0501038_0157480 3300049574 Bacteria 1848
293 Ga0501043_0074584 3300049579 Bacteria 2665
294 Ga0501043_0177340 3300049579 Bacteria 1661
295 Ga0501046_0118136 3300049580 Bacteria 2020
296 Ga0501047_0024096 3300049581 Bacteria 5845
297 Ga0501047_0041718 3300049581 Bacteria 4433
298 Ga0501047_0067781 3300049581 Bacteria 3438
299 Ga0501069_0068366 3300049585 Bacteria 1988
300 Ga0501070_0001234 3300049586 Bacteria 22905
301 Ga0501073_0001372 3300049589 Bacteria 17989
302 Ga0501079_0001099 3300049741 Bacteria 18808
303 Ga0501080_0004284 3300049742 Bacteria 12668
304 Ga0501080_0007642 3300049742 Bacteria 9776
305 Ga0501080_0277226 3300049742 Bacteria 1525
306 Ga0501080_0526386 3300049742 Unclassified 1054
307 Ga0501083_0021310 3300049744 Bacteria 4503
308 Ga0501083_0115759 3300049744 Bacteria 1760
309 Ga0501035_0005178 3300049822 Bacteria 12334
310 Ga0501035_0015983 3300049822 Bacteria 6927
311 Ga0501035_0016726 3300049822 Bacteria 6762
312 Ga0501044_0002915 3300049823 Bacteria 19480
313 Ga0501044_0004697 3300049823 Bacteria 15273
314 Ga0501044_0005028 3300049823 Bacteria 14762
315 Ga0501044_0241103 3300049823 Bacteria 1752
316 Ga0501044_0292351 3300049823 Bacteria 1560
317 nmdc:mga05p37_122643_c1 3300050507 Bacteria 3192
318 nmdc:mga0qj67_468157_c1 3300050509 Bacteria 1014
319 nmdc:mga06r32_315261_c1 3300050510 Bacteria 1549
320 nmdc:mga08y16_328388_c1 3300050511 Bacteria 1574
321 nmdc:mga08y16_53_c1 3300050511 Bacteria 103639
322 nmdc:mga0n895_46586_c1 3300050512 Bacteria 4236
323 nmdc:mga0n895_82382_c1 3300050512 Bacteria 3207
324 nmdc:mga0rr50_19685_c1 3300050513 Bacteria 4562
325 nmdc:mga0rr50_220066_c1 3300050513 Bacteria 1567
326 nmdc:mga08x19_95_c1 3300050514 Bacteria 78182
327 Ga0495601_0009321 3300053077 Bacteria 5806
328 Ga0500641_0003357 3300053096 Bacteria 5663
329 Ga0500594_0007955 3300053118 Bacteria 2408
330 Ga0500604_0001749 3300053151 Bacteria 6077
331 Ga0501084_0290268 3300054114 Bacteria 1381
332 Ga0590071_004135 3300059421 Bacteria 3541
333 Ga0501082_0004056 3300060353 Bacteria 12770
334 Ga0501082_0376437 3300060353 Bacteria 1239
335 2842339539 2842333319 Bacteria 8899485
336 2883296110 2883291878 Bacteria 5894118
337 2883358867 2883354860 Bacteria 5865246
338 8005660055 8005658619 Bacteria 4500593
339 Ga0070683_100177334
340 rootH2_10013874
341 Ga0065165_1000030
342 Ga0070683_100107793
343 Ga0070690_100053537
344 Ga0068869_100183660
345 Ga0070666_10004222
346 Ga0070680_100325855
347 Ga0070691_10000470
348 Ga0070691_10003138
349 Ga0070669_100014577
350 Ga0070671_100080167
351 Ga0070673_100273583
352 Ga0070659_100084259
353 Ga0070667_100032540
354 Ga0070709_10002111
355 Ga0070714_100054598
356 Ga0070714_100283779
357 Ga0070713_100000003
358 Ga0070711_100048674
359 Ga0070705_100204897
360 Ga0070678_100099569
361 Ga0070678_100111231
362 Ga0070681_10075685
363 Ga0070681_10127190
364 Ga0068867_100082014
365 Ga0070685_10062247
366 Ga0070698_100311831
367 Ga0070679_100026387
368 Ga0070684_100231136
369 Ga0070684_100351799
370 Ga0068853_100004892
371 Ga0068853_100017793
372 Ga0070672_100302898
373 Ga0070696_100031186
374 Ga0070696_100061434
375 Ga0070693_100066788
376 Ga0070665_100062101
377 Ga0070665_100524267
378 Ga0070704_100036928
379 Ga0068855_100044328
380 Ga0068855_100083089
381 Ga0068855_100331932
382 Ga0070664_100146424
383 Ga0068857_100000050
384 Ga0068857_100092748
385 Ga0068854_100022614
386 Ga0068856_100000075
387 Ga0068856_100002400
388 Ga0068852_100062592
389 Ga0068859_100291691
390 Ga0068861_100014246
391 Ga0068851_10051870
392 Ga0068863_100110364
393 Ga0068858_100014877
394 Ga0068858_100056758
395 Ga0068860_100074164
396 Ga0068860_100238005
397 Ga0068860_100316853
398 Ga0068862_100008856
399 Ga0068862_100013681
400 Ga0081455_10064590
401 Ga0081538_10001712
402 Ga0081538_10008773
403 Ga0081538_10011982
404 Ga0070712_100000027
405 Ga0070712_100000104
406 Ga0070712_100132484
407 Ga0097621_100171645
408 Ga0075430_100321222
409 Ga0075431_100217471
410 Ga0075434_100029037
411 Ga0075434_100040144
412 Ga0068865_100024982
413 Ga0068865_100028123
414 Ga0075436_100000038
415 Ga0097620_100291709
416 Ga0075435_100030550
417 Ga0075435_100038530
418 Ga0105240_10004764
419 Ga0105240_10009051
420 Ga0105240_10089522
421 Ga0105240_10090560
422 Ga0105240_10281554
423 Ga0105240_10379286
424 Ga0111539_10001910
425 Ga0111539_10086682
426 Ga0114129_10216734
427 Ga0114129_10222402
428 Ga0105241_10015537
429 Ga0105241_10079006
430 Ga0105248_10000115
431 Ga0105237_10023827
432 Ga0105237_10370640
433 Ga0105237_10403971
434 Ga0105238_10003614
435 Ga0105238_10021903
436 Ga0105238_10031878
437 Ga0105238_10092993
438 Ga0105249_10128959
439 Ga0105239_10052961
440 Ga0105239_10182137
441 Ga0105239_10315735
442 Ga0105246_10003680
443 Ga0105246_10006742
444 Ga0157373_10005478
445 Ga0157371_10315060
446 Ga0157370_10001209
447 Ga0157370_10002547
448 Ga0157370_10241162
449 Ga0157369_10005836
450 Ga0157369_10084241
451 Ga0157369_10085684
452 Ga0157374_10026685
453 Ga0157378_10261069
454 Ga0163162_10014518
455 Ga0163162_10184022
456 Ga0157372_10009690
457 Ga0157372_10016943
458 Ga0157372_10308702
459 Ga0163163_10081326
460 Ga0163163_10138134
461 Ga0163163_10181490
462 Ga0163163_10279234
463 Ga0157379_10001643
464 Ga0157379_10010223
465 Ga0157376_10035389
466 Ga0163161_10087206
467 Ga0209148_1000387
468 Ga0209455_1000301
469 Ga0207699_10000178
470 Ga0207705_10000464
471 Ga0207705_10108942
472 Ga0207654_10032037
473 Ga0207654_10043879
474 Ga0207707_10009840
475 Ga0207707_10080797
476 Ga0207707_10204263
477 Ga0207695_10005790
478 Ga0207695_10018249
479 Ga0207695_10054568
480 Ga0207695_10094118
481 Ga0207695_10137817
482 Ga0207671_10057104
483 Ga0207693_10000369
484 Ga0207693_10012059
485 Ga0207657_10001994
486 Ga0207657_10274333
487 Ga0207649_10168302
488 Ga0207652_10001572
489 Ga0207681_10015320
490 Ga0207694_10029833
491 Ga0207694_10032050
492 Ga0207694_10046667
493 Ga0207694_10296642
494 Ga0207700_10000010
495 Ga0207700_10193956
496 Ga0207664_10045597
497 Ga0207664_10220154
498 Ga0207690_10203011
499 Ga0207686_10025023
500 Ga0207704_10025979
501 Ga0207704_10098962
502 Ga0207667_10013272
503 Ga0207667_10051181
504 Ga0207667_10138855
505 Ga0207651_10329839
506 Ga0207712_10037275
507 Ga0207658_10022566
508 Ga0207677_10065303
509 Ga0207677_10321542
510 Ga0207703_10012765
511 Ga0207703_10042177
512 Ga0207639_10006946
513 Ga0207639_10036426
514 Ga0207702_10000013
515 Ga0207702_10014985
516 Ga0207674_10000026
517 Ga0207674_10041754
518 Ga0207675_100051265
519 Ga0207683_10019997
520 Ga0207683_10139871
521 Ga0207683_10281499
522 Ga0207698_10034775
523 Ga0207428_10000149
524 Ga0268266_10019577
525 Ga0268266_10070244
526 Ga0268266_10195970
527 Ga0268266_10275866
528 Ga0268265_10024941
529 Ga0268264_10314785
530 Ga0265337_1002455
531 Ga0265334_10008290
532 Ga0265338_10005761
533 Ga0265338_10038957
534 Ga0265338_10107200
535 Ga0265338_10224954
536 Ga0265338_10281012
537 Ga0265320_10000247
538 Ga0265325_10000235
539 Ga0265325_10001598
540 Ga0265325_10011597
541 Ga0265325_10017280
542 Ga0265325_10068423
543 Ga0265325_10087098
544 Ga0265329_10042629
545 Ga0265340_10003427
546 Ga0265340_10028456
547 Ga0265339_10004458
548 Ga0265339_10036183
549 Ga0265339_10040686
550 Ga0265331_10004156
551 Ga0265331_10085917
552 Ga0265316_10029209
553 Ga0265316_10037716
554 Ga0265316_10062553
555 Ga0265316_10093706
556 Ga0265316_10287266
557 Ga0265313_10000778
558 Ga0265313_10001565
559 Ga0265313_10014478
560 Ga0265313_10036349
561 Ga0265313_10037732
562 Ga0265313_10069800
563 Ga0265314_10003735
564 Ga0265314_10004923
565 Ga0265314_10018276
566 Ga0265314_10047471
567 Ga0265314_10072066
568 Ga0265314_10072647
569 Ga0265314_10116186
570 Ga0265342_10006719
571 Ga0265342_10019448
572 Ga0265342_10039666
573 Ga0316576_10004156
574 Ga0316577_10013039
575 Ga0307413_10023745
576 Ga0307410_10055433
577 Ga0307410_10265381
578 Ga0307406_10081603
579 Ga0307406_10296219
580 Ga0307409_100044937
581 Ga0307409_100368340
582 Ga0373932_0089316
583 Ga0373936_0034828
584 Ga0373955_0123263
585 Ga0316574_0150884
586 Ga0373931_0025583
587 Ga0373935_0152504
588 Ga0373933_0092151
589 Ga0373933_0120169
590 Ga0373937_0002815
591 Ga0373937_0178305
592 Ga0373937_0276962
593 Ga0373937_0530473
594 Ga0373937_0747646
595 Ga0395900_0086036
596 Ga0395898_0166022
597 Ga0395905_0348009
598 Ga0400483_128436
599 Ga0400483_168771
600 Ga0400483_225585
601 Ga0400483_272980
602 Ga0436365_0082781
603 Ga0436360_0926549
604 Ga0436363_1424133
605 Ga0436362_0319077
606 Ga0451576_0153073
607 Ga0495580_0196323
608 Ga0495582_0118256
609 Ga0495652_0285033
610 Ga0495621_0041825
611 Ga0495625_0387662
612 Ga0495657_0314842
613 Ga0495674_0012898
614 Ga0495676_0149680
615 Ga0495602_0119218
616 Ga0496100_0074424
617 Ga0496102_0029197
618 Ga0496106_0199424
619 Ga0496107_0224014
620 Ga0496112_0154987
621 Ga0496126_0000859
622 Ga0501031_0064966
623 Ga0501032_0011639
624 Ga0501032_0127929
625 Ga0501033_0008128
626 Ga0501034_0092233
627 Ga0501034_0123429
628 Ga0501034_0522916
629 Ga0501038_0077253
630 Ga0501038_0157480
631 Ga0501043_0074584
632 Ga0501043_0177340
633 Ga0501046_0118136
634 Ga0501047_0024096
635 Ga0501047_0041718
636 Ga0501047_0067781
637 Ga0501069_0068366
638 Ga0501070_0001234
639 Ga0501073_0001372
640 Ga0501079_0001099
641 Ga0501080_0004284
642 Ga0501080_0007642
643 Ga0501080_0277226
644 Ga0501080_0526386
645 Ga0501083_0021310
646 Ga0501083_0115759
647 Ga0501035_0005178
648 Ga0501035_0015983
649 Ga0501035_0016726
650 Ga0501044_0002915
651 Ga0501044_0004697
652 Ga0501044_0005028
653 Ga0501044_0241103
654 Ga0501044_0292351
655 nmdc:mga05p37_122643_c1
656 nmdc:mga0qj67_468157_c1
657 nmdc:mga06r32_315261_c1
658 nmdc:mga08y16_328388_c1
659 nmdc:mga08y16_53_c1
660 nmdc:mga0n895_46586_c1
661 nmdc:mga0n895_82382_c1
662 nmdc:mga0rr50_19685_c1
663 nmdc:mga0rr50_220066_c1
664 nmdc:mga08x19_95_c1
665 Ga0495601_0009321
666 Ga0500641_0003357
667 Ga0500594_0007955
668 Ga0500604_0001749
669 Ga0501084_0290268
670 Ga0590071_004135
671 Ga0501082_0004056
672 Ga0501082_0376437
673 2842339539
674 2883296110
675 2883358867
676 8005660055

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

108

313

0.97

PF19300

BPD_transp_1_N

Binding-prot-dependent transport system membrane comp, N-term

1

101

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tui-assembly2.cif.gz_E inward facing conformations of the metni methionine abc transporter: cy5 native crystal form 0.6694 88 296
3tuz-assembly2.cif.gz_F inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form 0.6653 88 296
3tui-assembly2.cif.gz_E inward facing conformations of the metni methionine abc transporter: cy5 native crystal form 0.648 88 296
3tuz-assembly2.cif.gz_F inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form 0.644 88 296
7mc0-assembly1.cif.gz_B inward facing conformation of the metni methionine abc transporter 0.6208 86 296
ID Description Score Start End Superfamily
af_P0AFH2_84_300_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.838 84 294 1.10.3720.10
af_P33591_90_303_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8276 88 296 1.10.3720.10
af_P0AFH2_84_300_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8123 84 294 1.10.3720.10
af_P33591_90_303_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8063 88 296 1.10.3720.10
af_P75798_87_300_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7989 87 296 1.10.3720.10
ID Description Score Start End GO Terms
AF-C0Q387-F1-model_v4 Oligopeptide permease ABC transporter membrane component 0.8876 1 300 GO:0005886
GO:0055085
AF-A0A7C2FKI6-F1-model_v4 ABC transporter permease 0.8861 1 302 GO:0005886
GO:0055085
AF-A0A7C2FKI6-F1-model_v4 ABC transporter permease 0.8833 1 302 GO:0005886
GO:0055085
AF-C0Q387-F1-model_v4 Oligopeptide permease ABC transporter membrane component 0.8791 1 300 GO:0005886
GO:0055085
AF-A0A7V3NIV5-F1-model_v4 ABC transporter permease 0.8771 1 302 GO:0005886
GO:0055085

Map