F412988

General Info

Members Datasets Scaffolds Average Seq Length
337 190 674 497

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100011992|Ga0070665_1000119922
Length 553
Sequence MLRLTSPGSRMLGFSLQKPEKKMKIKKPNMTRMAFLLAVGTIAAVTARTSAMIPEQVKTETGLLAGTTAVGQTAVRVFKGIPFAAPPLGENRWRAPQPAAKWDGVRSATAFGAPCTAGAPLPGRGGSEDCLYANVWTSAASPGDKRPVMVWIYGGGFTGGSGGMAWYDGENLAAKGPVIVTFNYRLGSLGFYAHPELAKESGHNASGNYGMMDAIAALQWVKRNIAAFGGDPNNVTVAGESAGAIMVGALVGSPQAKGLFNRAIAESGGWMGLTMSRMRTSAEAQAGGAKAADALGVKTMAELRAKPLDELTGLLGTGLVVDGYLIPEDQSFTFTNGKQNAVDVLTGSNKDEANFGICGPGAGVAGRGGAGMTLDAFKSAADRKFGELASQYLRLYPATTDAEAQRQAHEACADEITWNMRQWAAGHAAKGKKAYTYFFSHIQTVNGQPSPQGATHTAEISFAWNNPKGQATQTWNEADLKLADQMSSYWVNFIKTGDPNGSGLPEWPRVKDLATSKVMVFGETPQAEASVPAAKLAFYQAAYQRLLKSPVSN

Samples

Sample ID Description Type Environment
1 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
81 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
122 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
126 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
127 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
128 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
129 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
130 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
131 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
132 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
135 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
136 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
137 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
138 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
139 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
140 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
141 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
142 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
143 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
146 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
147 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
148 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
149 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
150 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
151 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
152 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
153 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
154 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
155 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
156 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
157 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
158 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
159 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
160 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
161 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
162 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
163 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
164 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
165 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
166 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
167 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
168 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
169 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
170 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
171 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
172 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
173 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
174 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
175 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
176 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
179 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
180 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
181 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
182 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
183 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
184 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
185 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
186 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
187 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
188 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
189 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
190 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.7
Metatranscriptomes 0
Isolates 0.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.3
Nodule 0.3
Rhizoplane 2.97
Rhizosphere 95.55
Stem 0
Stem Tuber 0
Unclassified 3.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070665_100011992 3300005548 Bacteria 8749
2 JGI25406J46586_10034959 3300003203 Bacteria 1838
3 Ga0070676_10010445 3300005328 Bacteria 5038
4 Ga0070676_10021313 3300005328 Bacteria 3627
5 Ga0070690_100075302 3300005330 Bacteria 2200
6 Ga0070670_100030960 3300005331 Bacteria 4608
7 Ga0070670_100123067 3300005331 Bacteria 2238
8 Ga0070677_10003409 3300005333 Bacteria 5123
9 Ga0070677_10007627 3300005333 Bacteria 3620
10 Ga0068869_100001443 3300005334 Bacteria 14071
11 Ga0068869_100011976 3300005334 Bacteria 5708
12 Ga0068869_100147570 3300005334 Bacteria 1821
13 Ga0070666_10012985 3300005335 Bacteria 5273
14 Ga0070666_10056580 3300005335 Bacteria 2649
15 Ga0070680_100005294 3300005336 Bacteria 9761
16 Ga0070682_100107242 3300005337 Bacteria 1855
17 Ga0068868_100011659 3300005338 Bacteria 6404
18 Ga0070689_100031742 3300005340 Bacteria 4015
19 Ga0070687_100044822 3300005343 Bacteria 2255
20 Ga0070661_100020068 3300005344 Bacteria 4764
21 Ga0070668_100013056 3300005347 Bacteria 6187
22 Ga0070668_100127562 3300005347 Bacteria 2039
23 Ga0070669_100003613 3300005353 Bacteria 11161
24 Ga0070669_100020978 3300005353 Unclassified 4668
25 Ga0070675_100009281 3300005354 Bacteria 7647
26 Ga0070675_100011761 3300005354 Bacteria 6854
27 Ga0070675_100017544 3300005354 Bacteria 5689
28 Ga0070675_100085987 3300005354 Bacteria 2628
29 Ga0070671_100006516 3300005355 Bacteria 9333
30 Ga0070671_100032182 3300005355 Bacteria 4337
31 Ga0070674_100000133 3300005356 Bacteria 34091
32 Ga0070673_100010891 3300005364 Bacteria 6182
33 Ga0070673_100025429 3300005364 Bacteria 4357
34 Ga0070673_100093283 3300005364 Unclassified 2465
35 Ga0070688_100009755 3300005365 Bacteria 5271
36 Ga0070688_100042042 3300005365 Bacteria 2809
37 Ga0070688_100115729 3300005365 Bacteria 1789
38 Ga0070667_100001784 3300005367 Bacteria 19160
39 Ga0070667_100013148 3300005367 Bacteria 6842
40 Ga0070705_100099296 3300005440 Bacteria 1834
41 Ga0070700_100053131 3300005441 Bacteria 2528
42 Ga0070678_100028365 3300005456 Bacteria 3817
43 Ga0070678_100034371 3300005456 Bacteria 3530
44 Ga0070662_100011707 3300005457 Bacteria 5790
45 Ga0070681_10090274 3300005458 Bacteria 3014
46 Ga0068867_100005906 3300005459 Bacteria 8684
47 Ga0070685_10005976 3300005466 Bacteria 6198
48 Ga0070679_100004670 3300005530 Bacteria 12639
49 Ga0070672_100006991 3300005543 Bacteria 7635
50 Ga0070672_100020204 3300005543 Bacteria 4853
51 Ga0070686_100010015 3300005544 Bacteria 5336
52 Ga0070686_100048003 3300005544 Bacteria 2703
53 Ga0070686_100051530 3300005544 Bacteria 2621
54 Ga0068855_100004608 3300005563 Bacteria 16829
55 Ga0070664_100001853 3300005564 Bacteria 16934
56 Ga0070664_100051905 3300005564 Bacteria 3472
57 Ga0070664_100115054 3300005564 Bacteria 2350
58 Ga0068856_100031373 3300005614 Bacteria 5198
59 Ga0068859_100009922 3300005617 Bacteria 9611
60 Ga0068859_100014400 3300005617 Bacteria 7935
61 Ga0068859_100035227 3300005617 Bacteria 5022
62 Ga0068859_100036341 3300005617 Bacteria 4945
63 Ga0068859_100185896 3300005617 Bacteria 2162
64 Ga0068859_100196110 3300005617 Bacteria 2104
65 Ga0068864_100009384 3300005618 Bacteria 8072
66 Ga0068864_100015344 3300005618 Bacteria 6368
67 Ga0068864_100024982 3300005618 Bacteria 5028
68 Ga0068861_100016711 3300005719 Bacteria 5198
69 Ga0068870_10000968 3300005840 Bacteria 11294
70 Ga0068870_10027063 3300005840 Bacteria 2865
71 Ga0068863_100006154 3300005841 Bacteria 11769
72 Ga0068858_100030981 3300005842 Bacteria 4967
73 Ga0068858_100049072 3300005842 Bacteria 3910
74 Ga0068858_100058487 3300005842 Bacteria 3565
75 Ga0068860_100001552 3300005843 Bacteria 24754
76 Ga0068862_100001221 3300005844 Bacteria 24241
77 Ga0068862_100148932 3300005844 Bacteria 2082
78 Ga0081539_10000013 3300005985 Bacteria 432395
79 Ga0081539_10000280 3300005985 Bacteria 115290
80 Ga0081539_10004629 3300005985 Bacteria 14978
81 Ga0097621_100072591 3300006237 Bacteria 2847
82 Ga0097621_100088521 3300006237 Bacteria 2587
83 Ga0097621_100090577 3300006237 Bacteria 2559
84 Ga0068871_100064828 3300006358 Unclassified 2991
85 Ga0068871_100098955 3300006358 Bacteria 2440
86 Ga0075428_100008864 3300006844 Bacteria 11157
87 Ga0075428_100032968 3300006844 Bacteria 5719
88 Ga0075428_100086974 3300006844 Bacteria 3409
89 Ga0075430_100023258 3300006846 Bacteria 5272
90 Ga0075431_100008828 3300006847 Bacteria 10101
91 Ga0075431_100009464 3300006847 Bacteria 9782
92 Ga0075433_10000070 3300006852 Bacteria 45584
93 Ga0075433_10003482 3300006852 Bacteria 12158
94 Ga0075433_10005756 3300006852 Bacteria 9751
95 Ga0075433_10045022 3300006852 Bacteria 3835
96 Ga0075433_10046179 3300006852 Bacteria 3787
97 Ga0075433_10073107 3300006852 Bacteria 3016
98 Ga0075434_100000166 3300006871 Bacteria 41896
99 Ga0075434_100005913 3300006871 Bacteria 11191
100 Ga0075434_100154778 3300006871 Bacteria 2312
101 Ga0075429_100013856 3300006880 Bacteria 6991
102 Ga0068865_100004621 3300006881 Bacteria 8315
103 Ga0068865_100006700 3300006881 Bacteria 7045
104 Ga0068865_100013565 3300006881 Bacteria 5153
105 Ga0068865_100129545 3300006881 Bacteria 1888
106 Ga0097620_100009922 3300006931 Bacteria 9611
107 Ga0097620_100014400 3300006931 Bacteria 7935
108 Ga0097620_100035227 3300006931 Bacteria 5022
109 Ga0097620_100036338 3300006931 Bacteria 4945
110 Ga0097620_100185898 3300006931 Bacteria 2162
111 Ga0097620_100196097 3300006931 Bacteria 2104
112 Ga0075435_100076718 3300007076 Bacteria 2739
113 Ga0105240_10014082 3300009093 Bacteria 10929
114 Ga0111539_10000235 3300009094 Bacteria 66044
115 Ga0111539_10027969 3300009094 Bacteria 6885
116 Ga0111539_10037556 3300009094 Bacteria 5847
117 Ga0111539_10038259 3300009094 Bacteria 5787
118 Ga0111539_10060767 3300009094 Bacteria 4478
119 Ga0111539_10065261 3300009094 Bacteria 4303
120 Ga0111539_10139124 3300009094 Bacteria 2843
121 Ga0111539_10227777 3300009094 Unclassified 2171
122 Ga0105245_10017680 3300009098 Bacteria 6223
123 Ga0105245_10019637 3300009098 Bacteria 5920
124 Ga0105245_10094343 3300009098 Bacteria 2758
125 Ga0114129_10007398 3300009147 Bacteria 15628
126 Ga0114129_10012815 3300009147 Bacteria 11933
127 Ga0105243_10010611 3300009148 Bacteria 6992
128 Ga0105242_10040639 3300009176 Bacteria 3748
129 Ga0105248_10009320 3300009177 Bacteria 10809
130 Ga0105248_10011617 3300009177 Bacteria 9701
131 Ga0105237_10039505 3300009545 Bacteria 4764
132 Ga0105237_10078577 3300009545 Bacteria 3289
133 Ga0105238_10006730 3300009551 Bacteria 11473
134 Ga0105238_10007609 3300009551 Bacteria 10853
135 Ga0105238_10216250 3300009551 Bacteria 1892
136 Ga0105249_10011034 3300009553 Bacteria 7937
137 Ga0105249_10153441 3300009553 Bacteria 2219
138 Ga0105239_10011244 3300010375 Bacteria 9986
139 Ga0105246_10071437 3300011119 Bacteria 2444
140 Ga0157371_10116386 3300013102 Bacteria 1899
141 Ga0157370_10001792 3300013104 Bacteria 26474
142 Ga0157369_10008374 3300013105 Bacteria 11859
143 Ga0157378_10022873 3300013297 Bacteria 5502
144 Ga0163162_10057738 3300013306 Bacteria 3909
145 Ga0163162_10074255 3300013306 Bacteria 3459
146 Ga0163162_10136094 3300013306 Bacteria 2567
147 Ga0157375_10072664 3300013308 Bacteria 3457
148 Ga0157375_10129255 3300013308 Bacteria 2644
149 Ga0163163_10004138 3300014325 Bacteria 12355
150 Ga0163163_10015002 3300014325 Bacteria 7142
151 Ga0163163_10021309 3300014325 Bacteria 6114
152 Ga0163163_10073757 3300014325 Bacteria 3404
153 Ga0163163_10175915 3300014325 Bacteria 2187
154 Ga0163163_10204193 3300014325 Unclassified 2024
155 Ga0157380_10005422 3300014326 Bacteria 8909
156 Ga0157380_10079387 3300014326 Bacteria 2680
157 Ga0157377_10008902 3300014745 Bacteria 4911
158 Ga0157377_10012129 3300014745 Bacteria 4326
159 Ga0157379_10017284 3300014968 Bacteria 6354
160 Ga0157376_10048352 3300014969 Bacteria 3517
161 Ga0157376_10059131 3300014969 Bacteria 3213
162 Ga0163161_10033146 3300017792 Bacteria 3691
163 Ga0163161_10082596 3300017792 Bacteria 2367
164 Ga0213875_10001501 3300021388 Bacteria 15006
165 Ga0207697_10001648 3300025315 Bacteria 12069
166 Ga0207682_10005597 3300025893 Bacteria 5108
167 Ga0207682_10011570 3300025893 Bacteria 3446
168 Ga0207710_10012099 3300025900 Bacteria 3627
169 Ga0207688_10005062 3300025901 Bacteria 7171
170 Ga0207680_10023717 3300025903 Bacteria 3355
171 Ga0207680_10032172 3300025903 Bacteria 2979
172 Ga0207680_10034059 3300025903 Bacteria 2911
173 Ga0207645_10003388 3300025907 Bacteria 12118
174 Ga0207645_10006821 3300025907 Bacteria 8151
175 Ga0207643_10002413 3300025908 Bacteria 10115
176 Ga0207643_10054312 3300025908 Unclassified 2277
177 Ga0207707_10000411 3300025912 Bacteria 44888
178 Ga0207695_10007491 3300025913 Bacteria 13865
179 Ga0207660_10005790 3300025917 Bacteria 8023
180 Ga0207662_10005021 3300025918 Bacteria 7005
181 Ga0207662_10048550 3300025918 Bacteria 2514
182 Ga0207652_10005406 3300025921 Bacteria 10365
183 Ga0207681_10022231 3300025923 Bacteria 4042
184 Ga0207694_10056521 3300025924 Bacteria 3048
185 Ga0207694_10088619 3300025924 Bacteria 2439
186 Ga0207650_10006447 3300025925 Bacteria 7993
187 Ga0207650_10045672 3300025925 Bacteria 3223
188 Ga0207659_10001111 3300025926 Bacteria 15946
189 Ga0207659_10002843 3300025926 Bacteria 10326
190 Ga0207659_10013175 3300025926 Bacteria 5290
191 Ga0207659_10015374 3300025926 Bacteria 4957
192 Ga0207659_10019940 3300025926 Bacteria 4423
193 Ga0207687_10037357 3300025927 Bacteria 3313
194 Ga0207687_10107760 3300025927 Bacteria 2062
195 Ga0207706_10014665 3300025933 Bacteria 7097
196 Ga0207709_10004203 3300025935 Bacteria 8355
197 Ga0207669_10020037 3300025937 Bacteria 3497
198 Ga0207704_10004007 3300025938 Bacteria 6705
199 Ga0207704_10013862 3300025938 Bacteria 4052
200 Ga0207704_10015148 3300025938 Bacteria 3920
201 Ga0207691_10004171 3300025940 Bacteria 14038
202 Ga0207691_10004401 3300025940 Bacteria 13655
203 Ga0207691_10005619 3300025940 Bacteria 12118
204 Ga0207691_10009874 3300025940 Bacteria 9164
205 Ga0207691_10010406 3300025940 Bacteria 8923
206 Ga0207711_10005224 3300025941 Bacteria 11004
207 Ga0207711_10017081 3300025941 Bacteria 6028
208 Ga0207711_10060171 3300025941 Bacteria 3272
209 Ga0207689_10000983 3300025942 Bacteria 27312
210 Ga0207689_10003959 3300025942 Bacteria 13486
211 Ga0207689_10011433 3300025942 Bacteria 7607
212 Ga0207689_10042366 3300025942 Unclassified 3766
213 Ga0207689_10049875 3300025942 Bacteria 3453
214 Ga0207679_10033244 3300025945 Bacteria 3628
215 Ga0207679_10076893 3300025945 Bacteria 2538
216 Ga0207667_10012498 3300025949 Bacteria 9775
217 Ga0207651_10010913 3300025960 Bacteria 5057
218 Ga0207651_10028514 3300025960 Bacteria 3523
219 Ga0207712_10069216 3300025961 Bacteria 2532
220 Ga0207712_10140444 3300025961 Bacteria 1853
221 Ga0207668_10067345 3300025972 Unclassified 2542
222 Ga0207668_10086811 3300025972 Bacteria 2287
223 Ga0207658_10026093 3300025986 Bacteria 4094
224 Ga0207677_10002892 3300026023 Bacteria 9066
225 Ga0207677_10069791 3300026023 Bacteria 2473
226 Ga0207703_10018989 3300026035 Bacteria 5369
227 Ga0207703_10031322 3300026035 Bacteria 4204
228 Ga0207703_10046702 3300026035 Bacteria 3489
229 Ga0207678_10137970 3300026067 Bacteria 2081
230 Ga0207708_10003360 3300026075 Bacteria 11806
231 Ga0207708_10006488 3300026075 Bacteria 8666
232 Ga0207708_10055386 3300026075 Bacteria 3023
233 Ga0207641_10000068 3300026088 Bacteria 155114
234 Ga0207641_10006075 3300026088 Bacteria 10224
235 Ga0207641_10023337 3300026088 Bacteria 5097
236 Ga0207648_10012340 3300026089 Bacteria 8000
237 Ga0207648_10050053 3300026089 Bacteria 3654
238 Ga0207676_10112696 3300026095 Bacteria 2279
239 Ga0207675_100035609 3300026118 Bacteria 4643
240 Ga0207675_100057946 3300026118 Bacteria 3615
241 Ga0207675_100136681 3300026118 Unclassified 2326
242 Ga0207683_10006075 3300026121 Bacteria 10341
243 Ga0207683_10027872 3300026121 Bacteria 4882
244 Ga0207683_10031780 3300026121 Unclassified 4583
245 Ga0207698_10133930 3300026142 Bacteria 2123
246 Ga0207428_10006926 3300027907 Bacteria 10390
247 Ga0207428_10092341 3300027907 Bacteria 2349
248 Ga0268266_10027988 3300028379 Bacteria 4793
249 Ga0268265_10012300 3300028380 Bacteria 5799
250 Ga0268265_10083314 3300028380 Bacteria 2532
251 Ga0268264_10000311 3300028381 Bacteria 78071
252 Ga0268264_10058708 3300028381 Bacteria 3223
253 Ga0265332_10012576 3300031238 Bacteria 3753
254 Ga0265327_10000117 3300031251 Bacteria 173075
255 Ga0265314_10050248 3300031711 Bacteria 2914
256 Ga0307405_10009948 3300031731 Bacteria 4901
257 Ga0307413_10056205 3300031824 Bacteria 2399
258 Ga0307410_10028712 3300031852 Bacteria 3533
259 Ga0307407_10005819 3300031903 Bacteria 5399
260 Ga0307409_100011236 3300031995 Bacteria 5630
261 Ga0307416_100004450 3300032002 Bacteria 8449
262 Ga0307414_10006233 3300032004 Bacteria 6631
263 Ga0307411_10004931 3300032005 Bacteria 6489
264 Ga0307415_100020538 3300032126 Bacteria 4035
265 Ga0373943_0008052 3300035170 Bacteria 4727
266 Ga0373946_0013984 3300035171 Bacteria 3022
267 Ga0373924_0019863 3300035410 Bacteria 2606
268 Ga0373935_0023352 3300035692 Bacteria 3800
269 Ga0373927_0000336 3300035695 Bacteria 36904
270 Ga0373927_0000400 3300035695 Bacteria 33593
271 Ga0373947_0000694 3300035725 Bacteria 20049
272 Ga0373937_0012610 3300036401 Bacteria 7438
273 Ga0373937_0142677 3300036401 Bacteria 2241
274 Ga0373925_0000003 3300037068 Bacteria 362401
275 Ga0436364_0588342 3300037853 Bacteria 6227
276 Ga0436364_0628092 3300037853 Bacteria 3234
277 Ga0439435_0005853 3300042436 Bacteria 2729
278 Ga0451576_0191272 3300045051 Bacteria 2137
279 Ga0495592_0002162 3300046454 Bacteria 13852
280 Ga0495592_0054969 3300046454 Bacteria 2947
281 Ga0495629_0035413 3300046459 Bacteria 3528
282 Ga0495664_0022637 3300046477 Bacteria 3645
283 Ga0495630_0006982 3300046517 Bacteria 8050
284 Ga0495630_0068699 3300046517 Bacteria 2665
285 Ga0495643_0001348 3300046522 Bacteria 23107
286 Ga0495643_0017807 3300046522 Bacteria 4144
287 Ga0495642_0004827 3300046528 Bacteria 5209
288 Ga0495586_0084815 3300046535 Bacteria 1744
289 Ga0495597_0005276 3300046542 Bacteria 6864
290 Ga0495645_0132371 3300046543 Bacteria 1746
291 Ga0495667_0015324 3300046559 Bacteria 5178
292 Ga0495667_0031266 3300046559 Bacteria 3574
293 Ga0495661_0032617 3300046665 Bacteria 3291
294 Ga0495669_0006219 3300046684 Bacteria 4980
295 Ga0495613_0021556 3300046689 Unclassified 4800
296 Ga0495636_0046332 3300047318 Bacteria 1813
297 Ga0495674_0002261 3300047319 Bacteria 18920
298 Ga0495674_0012669 3300047319 Bacteria 7946
299 Ga0495674_0014757 3300047319 Bacteria 7308
300 Ga0495687_006191 3300047443 Bacteria 7397
301 Ga0495684_0000409 3300047471 Bacteria 35059
302 Ga0495686_0000049 3300047472 Bacteria 275004
303 Ga0496101_0001891 3300048904 Bacteria 12640
304 Ga0496102_0156540 3300048905 Bacteria 2142
305 Ga0496104_0007961 3300048907 Bacteria 9398
306 Ga0496105_0236566 3300048908 Bacteria 1483
307 Ga0496106_0035310 3300048909 Bacteria 3738
308 Ga0496109_0069369 3300048912 Bacteria 3233
309 Ga0496112_0131802 3300048915 Bacteria 2471
310 Ga0496113_0048825 3300048916 Bacteria 3150
311 Ga0496114_0000189 3300048917 Bacteria 44653
312 Ga0496115_0336177 3300048918 Bacteria 1233
313 Ga0501040_0003284 3300049576 Bacteria 10454
314 Ga0501041_0071418 3300049577 Bacteria 2132
315 Ga0501072_0143808 3300049588 Bacteria 1902
316 Ga0501074_0126030 3300049590 Bacteria 1832
317 Ga0501079_0036467 3300049741 Bacteria 3788
318 nmdc:mga05p37_125749_c1 3300050507 Bacteria 3149
319 nmdc:mga05p37_128781_c1 3300050507 Bacteria 3107
320 nmdc:mga0qj67_125776_c1 3300050509 Bacteria 2075
321 nmdc:mga0qj67_64386_c1 3300050509 Bacteria 2916
322 nmdc:mga06r32_121091_c1 3300050510 Bacteria 2581
323 nmdc:mga06r32_60422_c1 3300050510 Bacteria 3647
324 nmdc:mga08y16_1440_c1 3300050511 Bacteria 23832
325 nmdc:mga08y16_247547_c1 3300050511 Bacteria 1842
326 nmdc:mga08y16_33400_c1 3300050511 Bacteria 5403
327 nmdc:mga08y16_36823_c1 3300050511 Bacteria 5138
328 nmdc:mga0n895_14623_c1 3300050512 Bacteria 7135
329 nmdc:mga0n895_2039_c1 3300050512 Bacteria 15534
330 nmdc:mga0n895_65827_c1 3300050512 Bacteria 3588
331 nmdc:mga0rr50_25383_c1 3300050513 Bacteria 4119
332 nmdc:mga0a205_4439_c1 3300050515 Bacteria 12597
333 nmdc:mga0a205_86472_c1 3300050515 Bacteria 3028
334 nmdc:mga0a205_92_c1 3300050515 Bacteria 50403
335 Ga0495619_0120987 3300053085 Unclassified 1795
336 Ga0500641_0004456 3300053096 Bacteria 4951
337 3005597938 3005594810 Bacteria 8716512
338 Ga0070665_100011992
339 JGI25406J46586_10034959
340 Ga0070676_10010445
341 Ga0070676_10021313
342 Ga0070690_100075302
343 Ga0070670_100030960
344 Ga0070670_100123067
345 Ga0070677_10003409
346 Ga0070677_10007627
347 Ga0068869_100001443
348 Ga0068869_100011976
349 Ga0068869_100147570
350 Ga0070666_10012985
351 Ga0070666_10056580
352 Ga0070680_100005294
353 Ga0070682_100107242
354 Ga0068868_100011659
355 Ga0070689_100031742
356 Ga0070687_100044822
357 Ga0070661_100020068
358 Ga0070668_100013056
359 Ga0070668_100127562
360 Ga0070669_100003613
361 Ga0070669_100020978
362 Ga0070675_100009281
363 Ga0070675_100011761
364 Ga0070675_100017544
365 Ga0070675_100085987
366 Ga0070671_100006516
367 Ga0070671_100032182
368 Ga0070674_100000133
369 Ga0070673_100010891
370 Ga0070673_100025429
371 Ga0070673_100093283
372 Ga0070688_100009755
373 Ga0070688_100042042
374 Ga0070688_100115729
375 Ga0070667_100001784
376 Ga0070667_100013148
377 Ga0070705_100099296
378 Ga0070700_100053131
379 Ga0070678_100028365
380 Ga0070678_100034371
381 Ga0070662_100011707
382 Ga0070681_10090274
383 Ga0068867_100005906
384 Ga0070685_10005976
385 Ga0070679_100004670
386 Ga0070672_100006991
387 Ga0070672_100020204
388 Ga0070686_100010015
389 Ga0070686_100048003
390 Ga0070686_100051530
391 Ga0068855_100004608
392 Ga0070664_100001853
393 Ga0070664_100051905
394 Ga0070664_100115054
395 Ga0068856_100031373
396 Ga0068859_100009922
397 Ga0068859_100014400
398 Ga0068859_100035227
399 Ga0068859_100036341
400 Ga0068859_100185896
401 Ga0068859_100196110
402 Ga0068864_100009384
403 Ga0068864_100015344
404 Ga0068864_100024982
405 Ga0068861_100016711
406 Ga0068870_10000968
407 Ga0068870_10027063
408 Ga0068863_100006154
409 Ga0068858_100030981
410 Ga0068858_100049072
411 Ga0068858_100058487
412 Ga0068860_100001552
413 Ga0068862_100001221
414 Ga0068862_100148932
415 Ga0081539_10000013
416 Ga0081539_10000280
417 Ga0081539_10004629
418 Ga0097621_100072591
419 Ga0097621_100088521
420 Ga0097621_100090577
421 Ga0068871_100064828
422 Ga0068871_100098955
423 Ga0075428_100008864
424 Ga0075428_100032968
425 Ga0075428_100086974
426 Ga0075430_100023258
427 Ga0075431_100008828
428 Ga0075431_100009464
429 Ga0075433_10000070
430 Ga0075433_10003482
431 Ga0075433_10005756
432 Ga0075433_10045022
433 Ga0075433_10046179
434 Ga0075433_10073107
435 Ga0075434_100000166
436 Ga0075434_100005913
437 Ga0075434_100154778
438 Ga0075429_100013856
439 Ga0068865_100004621
440 Ga0068865_100006700
441 Ga0068865_100013565
442 Ga0068865_100129545
443 Ga0097620_100009922
444 Ga0097620_100014400
445 Ga0097620_100035227
446 Ga0097620_100036338
447 Ga0097620_100185898
448 Ga0097620_100196097
449 Ga0075435_100076718
450 Ga0105240_10014082
451 Ga0111539_10000235
452 Ga0111539_10027969
453 Ga0111539_10037556
454 Ga0111539_10038259
455 Ga0111539_10060767
456 Ga0111539_10065261
457 Ga0111539_10139124
458 Ga0111539_10227777
459 Ga0105245_10017680
460 Ga0105245_10019637
461 Ga0105245_10094343
462 Ga0114129_10007398
463 Ga0114129_10012815
464 Ga0105243_10010611
465 Ga0105242_10040639
466 Ga0105248_10009320
467 Ga0105248_10011617
468 Ga0105237_10039505
469 Ga0105237_10078577
470 Ga0105238_10006730
471 Ga0105238_10007609
472 Ga0105238_10216250
473 Ga0105249_10011034
474 Ga0105249_10153441
475 Ga0105239_10011244
476 Ga0105246_10071437
477 Ga0157371_10116386
478 Ga0157370_10001792
479 Ga0157369_10008374
480 Ga0157378_10022873
481 Ga0163162_10057738
482 Ga0163162_10074255
483 Ga0163162_10136094
484 Ga0157375_10072664
485 Ga0157375_10129255
486 Ga0163163_10004138
487 Ga0163163_10015002
488 Ga0163163_10021309
489 Ga0163163_10073757
490 Ga0163163_10175915
491 Ga0163163_10204193
492 Ga0157380_10005422
493 Ga0157380_10079387
494 Ga0157377_10008902
495 Ga0157377_10012129
496 Ga0157379_10017284
497 Ga0157376_10048352
498 Ga0157376_10059131
499 Ga0163161_10033146
500 Ga0163161_10082596
501 Ga0213875_10001501
502 Ga0207697_10001648
503 Ga0207682_10005597
504 Ga0207682_10011570
505 Ga0207710_10012099
506 Ga0207688_10005062
507 Ga0207680_10023717
508 Ga0207680_10032172
509 Ga0207680_10034059
510 Ga0207645_10003388
511 Ga0207645_10006821
512 Ga0207643_10002413
513 Ga0207643_10054312
514 Ga0207707_10000411
515 Ga0207695_10007491
516 Ga0207660_10005790
517 Ga0207662_10005021
518 Ga0207662_10048550
519 Ga0207652_10005406
520 Ga0207681_10022231
521 Ga0207694_10056521
522 Ga0207694_10088619
523 Ga0207650_10006447
524 Ga0207650_10045672
525 Ga0207659_10001111
526 Ga0207659_10002843
527 Ga0207659_10013175
528 Ga0207659_10015374
529 Ga0207659_10019940
530 Ga0207687_10037357
531 Ga0207687_10107760
532 Ga0207706_10014665
533 Ga0207709_10004203
534 Ga0207669_10020037
535 Ga0207704_10004007
536 Ga0207704_10013862
537 Ga0207704_10015148
538 Ga0207691_10004171
539 Ga0207691_10004401
540 Ga0207691_10005619
541 Ga0207691_10009874
542 Ga0207691_10010406
543 Ga0207711_10005224
544 Ga0207711_10017081
545 Ga0207711_10060171
546 Ga0207689_10000983
547 Ga0207689_10003959
548 Ga0207689_10011433
549 Ga0207689_10042366
550 Ga0207689_10049875
551 Ga0207679_10033244
552 Ga0207679_10076893
553 Ga0207667_10012498
554 Ga0207651_10010913
555 Ga0207651_10028514
556 Ga0207712_10069216
557 Ga0207712_10140444
558 Ga0207668_10067345
559 Ga0207668_10086811
560 Ga0207658_10026093
561 Ga0207677_10002892
562 Ga0207677_10069791
563 Ga0207703_10018989
564 Ga0207703_10031322
565 Ga0207703_10046702
566 Ga0207678_10137970
567 Ga0207708_10003360
568 Ga0207708_10006488
569 Ga0207708_10055386
570 Ga0207641_10000068
571 Ga0207641_10006075
572 Ga0207641_10023337
573 Ga0207648_10012340
574 Ga0207648_10050053
575 Ga0207676_10112696
576 Ga0207675_100035609
577 Ga0207675_100057946
578 Ga0207675_100136681
579 Ga0207683_10006075
580 Ga0207683_10027872
581 Ga0207683_10031780
582 Ga0207698_10133930
583 Ga0207428_10006926
584 Ga0207428_10092341
585 Ga0268266_10027988
586 Ga0268265_10012300
587 Ga0268265_10083314
588 Ga0268264_10000311
589 Ga0268264_10058708
590 Ga0265332_10012576
591 Ga0265327_10000117
592 Ga0265314_10050248
593 Ga0307405_10009948
594 Ga0307413_10056205
595 Ga0307410_10028712
596 Ga0307407_10005819
597 Ga0307409_100011236
598 Ga0307416_100004450
599 Ga0307414_10006233
600 Ga0307411_10004931
601 Ga0307415_100020538
602 Ga0373943_0008052
603 Ga0373946_0013984
604 Ga0373924_0019863
605 Ga0373935_0023352
606 Ga0373927_0000336
607 Ga0373927_0000400
608 Ga0373947_0000694
609 Ga0373937_0012610
610 Ga0373937_0142677
611 Ga0373925_0000003
612 Ga0436364_0588342
613 Ga0436364_0628092
614 Ga0439435_0005853
615 Ga0451576_0191272
616 Ga0495592_0002162
617 Ga0495592_0054969
618 Ga0495629_0035413
619 Ga0495664_0022637
620 Ga0495630_0006982
621 Ga0495630_0068699
622 Ga0495643_0001348
623 Ga0495643_0017807
624 Ga0495642_0004827
625 Ga0495586_0084815
626 Ga0495597_0005276
627 Ga0495645_0132371
628 Ga0495667_0015324
629 Ga0495667_0031266
630 Ga0495661_0032617
631 Ga0495669_0006219
632 Ga0495613_0021556
633 Ga0495636_0046332
634 Ga0495674_0002261
635 Ga0495674_0012669
636 Ga0495674_0014757
637 Ga0495687_006191
638 Ga0495684_0000409
639 Ga0495686_0000049
640 Ga0496101_0001891
641 Ga0496102_0156540
642 Ga0496104_0007961
643 Ga0496105_0236566
644 Ga0496106_0035310
645 Ga0496109_0069369
646 Ga0496112_0131802
647 Ga0496113_0048825
648 Ga0496114_0000189
649 Ga0496115_0336177
650 Ga0501040_0003284
651 Ga0501041_0071418
652 Ga0501072_0143808
653 Ga0501074_0126030
654 Ga0501079_0036467
655 nmdc:mga05p37_125749_c1
656 nmdc:mga05p37_128781_c1
657 nmdc:mga0qj67_125776_c1
658 nmdc:mga0qj67_64386_c1
659 nmdc:mga06r32_121091_c1
660 nmdc:mga06r32_60422_c1
661 nmdc:mga08y16_1440_c1
662 nmdc:mga08y16_247547_c1
663 nmdc:mga08y16_33400_c1
664 nmdc:mga08y16_36823_c1
665 nmdc:mga0n895_14623_c1
666 nmdc:mga0n895_2039_c1
667 nmdc:mga0n895_65827_c1
668 nmdc:mga0rr50_25383_c1
669 nmdc:mga0a205_4439_c1
670 nmdc:mga0a205_86472_c1
671 nmdc:mga0a205_92_c1
672 Ga0495619_0120987
673 Ga0500641_0004456
674 3005597938

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00135

COesterase

Carboxylesterase family

53

539

0.8

PF07859

Abhydrolase_3

alpha/beta hydrolase fold

206

307

0.77

PF20434

BD-FAE

BD-FAE

137

269

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
5hcu-assembly1.cif.gz_B crystal structure of mouse acetylchoinesterase inhibited by dfp 0.8499 26 494
3lii-assembly1.cif.gz_A recombinant human acetylcholinesterase 0.8459 26 498
6wuv-assembly1.cif.gz_B crystal structure of recombinant human acetylcholinesterase inhibited by ga 0.8454 26 497
5ydj-assembly1.cif.gz_A-2 crystal structure of anopheles gambiae acetylcholinesterase in complex with pmsf 0.8443 25 500
4m0f-assembly1.cif.gz_A structure of human acetylcholinesterase in complex with territrem b 0.8424 26 497
ID Description Score Start End Superfamily
af_Q9XW75_31_277_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8498 27 235 3.40.50.1820
af_Q54RL3_36_542_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8357 26 490 3.40.50.1820
af_Q9U295_30_581_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8344 27 494 3.40.50.1820
1xlwA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8339 27 493 3.40.50.1820
af_G3V7J5_37_561_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8329 23 498 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A2V8DPW9-F1-model_v4 Carboxylic ester hydrolase (EC 3.1.1.-) 0.9271 17 500 GO:0016787
AF-A0A4V4JSF6-F1-model_v4 Carboxylic ester hydrolase (EC 3.1.1.-) 0.9174 18 234 GO:0016787
AF-A0A6L7WSY2-F1-model_v4 Carboxylesterase family protein 0.9171 19 225
AF-A0A520JGK1-F1-model_v4 Carboxylic ester hydrolase (EC 3.1.1.-) 0.9149 27 232 GO:0016787
AF-V4PHE6-F1-model_v4 Carboxylesterase type B domain-containing protein 0.9114 27 204

Map