F412905

General Info

Members Datasets Scaffolds Average Seq Length
337 226 674 139

Family's Representative Sequence

Representative Sequence 3300002077|JGI24744J21845_10005250|JGI24744J21845_100052502
Length 153
Sequence MRLVAGGWGRCGERPFSYDPGVGYQIADSSKLEWEERPPGAEGQKPRLAADVTTTAGLQQSRGRVWRYPVGTRGRRHADKAQEEVFVVISGALTMLLGDPPERVDVGPQSVVAVQPNTPLQVRNEGSEELVLYIYGAPPEQEGADFFDDPGDF

Samples

Sample ID Description Type Environment
1 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
2 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
153 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
154 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
155 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
156 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
157 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
158 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
159 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
161 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
162 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
163 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
164 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
165 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
166 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
167 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
168 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
169 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
170 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
171 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
172 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
173 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
174 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
175 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
176 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
177 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
178 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
179 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
180 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
181 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
182 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
183 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
184 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
185 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
186 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
187 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
188 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
189 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
190 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
191 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
192 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
193 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
194 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
195 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
196 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
197 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
198 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
199 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
200 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
201 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
202 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
203 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
204 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
205 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
206 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
207 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
208 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
209 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
210 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
211 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
212 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
213 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
214 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
215 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
216 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
217 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
218 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
219 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
220 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
221 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
222 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
223 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
224 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
225 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
226 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.7
Metatranscriptomes 0.3
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.59
Nodule 0
Rhizoplane 7.72
Rhizosphere 90.8
Stem 0
Stem Tuber 0
Unclassified 15.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24744J21845_10005250 3300002077 Bacteria 2679
2 JGI24744J21845_10005965 3300002077 Bacteria 2526
3 JGI24744J21845_10015785 3300002077 Bacteria 1506
4 JGI24742J22300_10012856 3300002244 Bacteria 1399
5 JGI24751J29686_10056893 3300002459 Bacteria 806
6 Ga0070676_10500824 3300005328 Bacteria 862
7 Ga0070690_100032529 3300005330 Unclassified 3259
8 Ga0068869_100320503 3300005334 Bacteria 1257
9 Ga0070666_10032366 3300005335 Bacteria 3454
10 Ga0070680_100085180 3300005336 Bacteria 2611
11 Ga0070680_100498343 3300005336 Unclassified 1042
12 Ga0070682_100482575 3300005337 Unclassified 956
13 Ga0068868_100034250 3300005338 Bacteria 3920
14 Ga0070660_100127122 3300005339 Bacteria 2037
15 Ga0070689_100001693 3300005340 Bacteria 14075
16 Ga0070691_10022909 3300005341 Bacteria 2899
17 Ga0070687_100105657 3300005343 Bacteria 1585
18 Ga0070692_10061350 3300005345 Bacteria 1982
19 Ga0070668_100057826 3300005347 Bacteria 2998
20 Ga0070675_100069965 3300005354 Bacteria 2908
21 Ga0070671_100014394 3300005355 Bacteria 6391
22 Ga0070671_100361213 3300005355 Unclassified 1240
23 Ga0070674_100015014 3300005356 Bacteria 4826
24 Ga0070673_100074498 3300005364 Bacteria 2736
25 Ga0070673_100756616 3300005364 Bacteria 895
26 Ga0070688_100008913 3300005365 Bacteria 5463
27 Ga0070659_100099502 3300005366 Bacteria 2339
28 Ga0070667_100834546 3300005367 Bacteria 856
29 Ga0070703_10043149 3300005406 Bacteria 1413
30 Ga0070709_10006375 3300005434 Bacteria 6426
31 Ga0070714_102185873 3300005435 Bacteria 539
32 Ga0070713_100359711 3300005436 Bacteria 1352
33 Ga0070710_10011759 3300005437 Bacteria 4333
34 Ga0070701_10000667 3300005438 Bacteria 12056
35 Ga0070711_100001144 3300005439 Bacteria 14228
36 Ga0070705_100002521 3300005440 Bacteria 9205
37 Ga0070705_100302356 3300005440 Unclassified 1147
38 Ga0070705_100784544 3300005440 Bacteria 756
39 Ga0070700_100022204 3300005441 Bacteria 3698
40 Ga0070694_100066182 3300005444 Bacteria 2478
41 Ga0070708_100115050 3300005445 Bacteria 2476
42 Ga0070708_100593929 3300005445 Unclassified 1044
43 Ga0070708_101123144 3300005445 Unclassified 736
44 Ga0070708_101244368 3300005445 Bacteria 696
45 Ga0070708_101447538 3300005445 Bacteria 640
46 Ga0070663_100112446 3300005455 Bacteria 2048
47 Ga0070678_100024539 3300005456 Bacteria 4039
48 Ga0070678_100266575 3300005456 Bacteria 1443
49 Ga0070662_100143449 3300005457 Bacteria 1853
50 Ga0070681_10300920 3300005458 Bacteria 1514
51 Ga0068867_100007911 3300005459 Bacteria 7510
52 Ga0070685_10005085 3300005466 Bacteria 6671
53 Ga0070706_100057769 3300005467 Bacteria 3581
54 Ga0070706_100082554 3300005467 Bacteria 2977
55 Ga0070707_100004675 3300005468 Bacteria 12824
56 Ga0070707_100029612 3300005468 Bacteria 5213
57 Ga0070707_100615370 3300005468 Bacteria 1049
58 Ga0070707_100914263 3300005468 Unclassified 842
59 Ga0070698_100007005 3300005471 Bacteria 12211
60 Ga0070698_100042651 3300005471 Unclassified 4654
61 Ga0070698_100288325 3300005471 Bacteria 1573
62 Ga0070699_101028078 3300005518 Archaea 756
63 Ga0070699_101682544 3300005518 Unclassified 581
64 Ga0070679_100368414 3300005530 Bacteria 1384
65 Ga0070697_100266149 3300005536 Bacteria 1468
66 Ga0068853_100011697 3300005539 Bacteria 7132
67 Ga0070672_100057832 3300005543 Bacteria 3045
68 Ga0070686_100009622 3300005544 Bacteria 5434
69 Ga0070686_100830103 3300005544 Unclassified 747
70 Ga0070695_100152922 3300005545 Bacteria 1612
71 Ga0070695_100707956 3300005545 Bacteria 800
72 Ga0070696_100027097 3300005546 Bacteria 3902
73 Ga0070696_100798230 3300005546 Bacteria 777
74 Ga0070696_100821200 3300005546 Bacteria 766
75 Ga0070696_101522243 3300005546 Unclassified 573
76 Ga0070693_100043776 3300005547 Bacteria 2530
77 Ga0070665_100034485 3300005548 Bacteria 5089
78 Ga0070704_100011254 3300005549 Bacteria 5477
79 Ga0068855_100206336 3300005563 Bacteria 2211
80 Ga0068854_100541297 3300005578 Unclassified 986
81 Ga0068856_100006244 3300005614 Bacteria 11694
82 Ga0070702_100004914 3300005615 Bacteria 6161
83 Ga0070702_100462440 3300005615 Unclassified 923
84 Ga0068852_100074116 3300005616 Bacteria 2996
85 Ga0068852_102441258 3300005616 Bacteria 543
86 Ga0068859_100086545 3300005617 Bacteria 3181
87 Ga0068866_10003985 3300005718 Bacteria 6061
88 Ga0068863_100227565 3300005841 Unclassified 1798
89 Ga0068858_100271569 3300005842 Bacteria 1614
90 Ga0068860_100605907 3300005843 Bacteria 1101
91 Ga0081455_10084012 3300005937 Bacteria 2600
92 Ga0081455_10185588 3300005937 Unclassified 1571
93 Ga0081539_10057031 3300005985 Bacteria 2164
94 Ga0070717_10178093 3300006028 Bacteria 1852
95 Ga0070717_10190867 3300006028 Bacteria 1790
96 Ga0075365_10006644 3300006038 Bacteria 6386
97 Ga0070716_100169944 3300006173 Bacteria 1422
98 Ga0070716_100643844 3300006173 Unclassified 803
99 Ga0070712_100002015 3300006175 Bacteria 12440
100 Ga0068871_100076245 3300006358 Bacteria 2769
101 Ga0075428_100307899 3300006844 Bacteria 1703
102 Ga0075431_100220942 3300006847 Bacteria 1933
103 Ga0075433_10830955 3300006852 Unclassified 807
104 Ga0068865_100007640 3300006881 Bacteria 6658
105 Ga0068865_100201578 3300006881 Bacteria 1545
106 Ga0097620_100086547 3300006931 Bacteria 3181
107 Ga0075435_100066891 3300007076 Bacteria 2925
108 Ga0105240_11957066 3300009093 Unclassified 609
109 Ga0105245_10010040 3300009098 Bacteria 8246
110 Ga0105245_10103812 3300009098 Bacteria 2634
111 Ga0105245_10291142 3300009098 Bacteria 1599
112 Ga0105247_10055379 3300009101 Bacteria 2447
113 Ga0114129_10354835 3300009147 Bacteria 1942
114 Ga0114129_10552692 3300009147 Bacteria 1497
115 Ga0114129_10883030 3300009147 Bacteria 1134
116 Ga0114129_11315819 3300009147 Unclassified 895
117 Ga0114129_11801262 3300009147 Unclassified 744
118 Ga0105243_10085284 3300009148 Bacteria 2588
119 Ga0105243_10731571 3300009148 Bacteria 968
120 Ga0105241_10047032 3300009174 Bacteria 3279
121 Ga0105242_10108824 3300009176 Bacteria 2359
122 Ga0105242_10719951 3300009176 Unclassified 979
123 Ga0105242_11670028 3300009176 Bacteria 672
124 Ga0105248_10006882 3300009177 Bacteria 12462
125 Ga0105248_10171345 3300009177 Unclassified 2446
126 Ga0105237_10072064 3300009545 Bacteria 3449
127 Ga0105238_10065340 3300009551 Bacteria 3639
128 Ga0105249_10013630 3300009553 Bacteria 7178
129 Ga0105249_10207878 3300009553 Archaea 1919
130 Ga0105239_10127044 3300010375 Bacteria 2835
131 Ga0105246_10089710 3300011119 Bacteria 2212
132 Ga0105246_12358233 3300011119 Unclassified 521
133 Ga0157369_10015240 3300013105 Bacteria 8674
134 Ga0157369_10031090 3300013105 Bacteria 5883
135 Ga0157369_10803908 3300013105 Bacteria 966
136 Ga0157374_10317070 3300013296 Bacteria 1544
137 Ga0157378_10057695 3300013297 Bacteria 3461
138 Ga0163162_10012762 3300013306 Bacteria 8206
139 Ga0157375_10019957 3300013308 Bacteria 6111
140 Ga0157375_11085659 3300013308 Bacteria 936
141 Ga0157377_10005058 3300014745 Bacteria 6157
142 Ga0157379_10278712 3300014968 Bacteria 1521
143 Ga0157376_10026512 3300014969 Bacteria 4581
144 Ga0163161_10086104 3300017792 Bacteria 2319
145 Ga0206353_11491690 3300020082 Bacteria 1244
146 Ga0207653_10055841 3300025885 Bacteria 1323
147 Ga0207692_10014099 3300025898 Bacteria 3485
148 Ga0207642_10004406 3300025899 Bacteria 4540
149 Ga0207710_10089734 3300025900 Bacteria 1437
150 Ga0207688_10059339 3300025901 Bacteria 2155
151 Ga0207647_10079363 3300025904 Bacteria 1971
152 Ga0207685_10031382 3300025905 Bacteria 1902
153 Ga0207699_10026909 3300025906 Bacteria 3177
154 Ga0207684_10032079 3300025910 Bacteria 4468
155 Ga0207654_10160135 3300025911 Bacteria 1453
156 Ga0207707_10505904 3300025912 Unclassified 1030
157 Ga0207671_10263409 3300025914 Bacteria 1357
158 Ga0207693_10001754 3300025915 Bacteria 19046
159 Ga0207663_10033636 3300025916 Bacteria 3056
160 Ga0207660_10298454 3300025917 Bacteria 1282
161 Ga0207662_10035018 3300025918 Bacteria 2932
162 Ga0207657_10021891 3300025919 Bacteria 6003
163 Ga0207652_10710490 3300025921 Bacteria 896
164 Ga0207646_10005933 3300025922 Bacteria 12741
165 Ga0207646_10026291 3300025922 Bacteria 5314
166 Ga0207646_10131037 3300025922 Bacteria 2257
167 Ga0207646_10879315 3300025922 Bacteria 796
168 Ga0207646_11339538 3300025922 Bacteria 624
169 Ga0207646_11544890 3300025922 Bacteria 574
170 Ga0207694_10886007 3300025924 Unclassified 754
171 Ga0207659_10283191 3300025926 Bacteria 1356
172 Ga0207700_10391582 3300025928 Bacteria 1216
173 Ga0207644_10077803 3300025931 Bacteria 2444
174 Ga0207690_10160914 3300025932 Bacteria 1673
175 Ga0207690_11149076 3300025932 Bacteria 648
176 Ga0207686_10015372 3300025934 Bacteria 4279
177 Ga0207709_10007985 3300025935 Bacteria 5860
178 Ga0207670_10061955 3300025936 Bacteria 2555
179 Ga0207669_10003162 3300025937 Bacteria 7104
180 Ga0207669_10612032 3300025937 Bacteria 887
181 Ga0207704_10258162 3300025938 Bacteria 1312
182 Ga0207665_10060706 3300025939 Bacteria 2561
183 Ga0207665_10330540 3300025939 Unclassified 1146
184 Ga0207691_10015425 3300025940 Bacteria 7267
185 Ga0207711_10015451 3300025941 Bacteria 6335
186 Ga0207689_10329359 3300025942 Bacteria 1268
187 Ga0207651_10270679 3300025960 Bacteria 1399
188 Ga0207712_10184467 3300025961 Bacteria 1642
189 Ga0207668_10450572 3300025972 Bacteria 1098
190 Ga0207658_10747126 3300025986 Bacteria 886
191 Ga0207677_10122035 3300026023 Unclassified 1962
192 Ga0207703_10052555 3300026035 Bacteria 3309
193 Ga0207639_10041840 3300026041 Bacteria 3431
194 Ga0207678_10018155 3300026067 Bacteria 6178
195 Ga0207708_10001814 3300026075 Bacteria 15753
196 Ga0207641_10324972 3300026088 Unclassified 1460
197 Ga0207648_10000150 3300026089 Bacteria 70019
198 Ga0207648_10146974 3300026089 Bacteria 2079
199 Ga0207675_100551714 3300026118 Unclassified 1151
200 Ga0207683_10000131 3300026121 Bacteria 61423
201 Ga0209966_1033008 3300027695 Bacteria 1056
202 Ga0209998_10020009 3300027717 Bacteria 1429
203 Ga0268266_10067171 3300028379 Bacteria 3103
204 Ga0268265_11923003 3300028380 Unclassified 598
205 Ga0268264_10350523 3300028381 Bacteria 1405
206 Ga0265331_10272918 3300031250 Bacteria 758
207 Ga0373948_0189388 3300034817 Bacteria 532
208 Ga0373945_0346403 3300035116 Bacteria 644
209 Ga0373943_0102349 3300035170 Bacteria 1500
210 Ga0373946_0269935 3300035171 Unclassified 834
211 Ga0373946_0438871 3300035171 Unclassified 663
212 Ga0373935_0253675 3300035692 Bacteria 1232
213 Ga0373947_0107269 3300035725 Unclassified 1761
214 Ga0373925_1362869 3300037068 Unclassified 581
215 Ga0395899_0007526 3300037312 Bacteria 8416
216 Ga0395899_0110785 3300037312 Bacteria 1974
217 Ga0395899_0159039 3300037312 Unclassified 1597
218 Ga0395899_0450270 3300037312 Bacteria 843
219 Ga0395900_0005387 3300037418 Bacteria 13404
220 Ga0395900_0027974 3300037418 Bacteria 5773
221 Ga0395900_0035629 3300037418 Bacteria 5126
222 Ga0395900_0203421 3300037418 Bacteria 2002
223 Ga0395900_0330618 3300037418 Bacteria 1502
224 Ga0395900_0425292 3300037418 Bacteria 1288
225 Ga0395900_0738894 3300037418 Bacteria 915
226 Ga0395898_0012536 3300037466 Bacteria 8767
227 Ga0395898_0016654 3300037466 Bacteria 7513
228 Ga0395898_0050611 3300037466 Bacteria 4065
229 Ga0395898_0068719 3300037466 Bacteria 3428
230 Ga0395898_0108301 3300037466 Bacteria 2664
231 Ga0395898_0350550 3300037466 Bacteria 1408
232 Ga0395898_0389752 3300037466 Bacteria 1328
233 Ga0395898_0846127 3300037466 Bacteria 854
234 Ga0395898_0889060 3300037466 Bacteria 829
235 Ga0395898_1424358 3300037466 Unclassified 620
236 Ga0395905_0001912 3300037471 Bacteria 23920
237 Ga0395905_0103609 3300037471 Bacteria 2671
238 Ga0395905_0177311 3300037471 Bacteria 2000
239 Ga0395905_0185690 3300037471 Bacteria 1951
240 Ga0395905_0374020 3300037471 Bacteria 1318
241 Ga0395905_0406416 3300037471 Bacteria 1257
242 Ga0395905_0798285 3300037471 Bacteria 847
243 Ga0395901_0005580 3300038443 Bacteria 12735
244 Ga0395901_0033406 3300038443 Bacteria 5311
245 Ga0395901_0047516 3300038443 Bacteria 4456
246 Ga0395901_0050575 3300038443 Bacteria 4317
247 Ga0395901_0054136 3300038443 Bacteria 4170
248 Ga0395901_0095780 3300038443 Bacteria 3110
249 Ga0395901_0099114 3300038443 Bacteria 3055
250 Ga0395901_0222559 3300038443 Bacteria 1972
251 Ga0395901_0493532 3300038443 Bacteria 1247
252 Ga0395901_0626410 3300038443 Unclassified 1082
253 Ga0395901_0858666 3300038443 Bacteria 892
254 Ga0395901_1265188 3300038443 Unclassified 701
255 Ga0436363_0003014 3300039450 Unclassified 813
256 Ga0451853_3562842 3300041512 Unclassified 527
257 Ga0451853_4080472 3300041512 Bacteria 864
258 Ga0466969_0058074 3300044656 Bacteria 1884
259 Ga0466961_0187121 3300044693 Bacteria 1284
260 Ga0466968_0000957 3300044735 Bacteria 10171
261 Ga0466960_0241837 3300044901 Bacteria 1000
262 Ga0466959_0095060 3300045049 Bacteria 2137
263 Ga0451576_0486824 3300045051 Bacteria 1296
264 Ga0466958_0352089 3300045836 Unclassified 948
265 Ga0495603_0010014 3300046455 Bacteria 5735
266 Ga0495603_0214717 3300046455 Bacteria 1110
267 Ga0495641_0030884 3300046461 Bacteria 2564
268 Ga0495582_0304975 3300046473 Bacteria 915
269 Ga0495582_0314059 3300046473 Bacteria 901
270 Ga0495639_0003989 3300046475 Bacteria 6335
271 Ga0495662_0085879 3300046476 Bacteria 1533
272 Ga0495584_0087279 3300046491 Bacteria 1572
273 Ga0495585_0134506 3300046492 Bacteria 1299
274 Ga0495585_0526683 3300046492 Bacteria 560
275 Ga0495596_0028183 3300046500 Bacteria 2256
276 Ga0495607_0078930 3300046501 Bacteria 1815
277 Ga0495607_0247031 3300046501 Unclassified 861
278 Ga0495616_0366068 3300046513 Bacteria 598
279 Ga0495630_0189907 3300046517 Bacteria 1567
280 Ga0495644_0089080 3300046523 Bacteria 1164
281 Ga0495665_0127809 3300046531 Bacteria 1331
282 Ga0495609_0145783 3300046538 Bacteria 1009
283 Ga0495609_0203120 3300046538 Bacteria 827
284 Ga0495667_0725053 3300046559 Bacteria 615
285 Ga0495611_0097954 3300046648 Bacteria 1360
286 Ga0495588_0123943 3300046674 Bacteria 1362
287 Ga0495647_0457386 3300046681 Unclassified 591
288 Ga0495658_0074725 3300046683 Bacteria 1976
289 Ga0495613_0339393 3300046689 Unclassified 1034
290 Ga0495624_0051459 3300046690 Bacteria 2606
291 Ga0495670_0230945 3300046691 Unclassified 984
292 Ga0495671_0048869 3300046692 Bacteria 2110
293 Ga0495671_0527956 3300046692 Bacteria 562
294 Ga0495589_0174967 3300046794 Bacteria 1019
295 Ga0495581_0011955 3300047315 Bacteria 5022
296 Ga0495581_0079186 3300047315 Bacteria 1901
297 Ga0495676_0070543 3300047321 Bacteria 2690
298 Ga0495676_0399331 3300047321 Bacteria 912
299 Ga0495680_0476988 3300047322 Bacteria 850
300 Ga0495615_0266468 3300048090 Unclassified 547
301 Ga0496100_0436943 3300048903 Bacteria 1001
302 Ga0496101_0169473 3300048904 Bacteria 1677
303 Ga0496102_0036105 3300048905 Bacteria 4451
304 Ga0496103_0142501 3300048906 Bacteria 1533
305 Ga0496104_0023441 3300048907 Bacteria 5674
306 Ga0496104_0954294 3300048907 Bacteria 762
307 Ga0496105_0259160 3300048908 Bacteria 1407
308 Ga0496106_0442323 3300048909 Bacteria 1044
309 Ga0496106_1420048 3300048909 Bacteria 536
310 Ga0496107_0091882 3300048910 Bacteria 2218
311 Ga0496107_0589188 3300048910 Archaea 822
312 Ga0496108_0046603 3300048911 Bacteria 3622
313 Ga0496108_1023848 3300048911 Bacteria 704
314 Ga0496108_1705277 3300048911 Unclassified 518
315 Ga0496109_0059385 3300048912 Bacteria 3493
316 Ga0496109_0129229 3300048912 Bacteria 2357
317 Ga0496109_0223296 3300048912 Unclassified 1772
318 Ga0496110_0105673 3300048913 Unclassified 2526
319 Ga0496111_0266532 3300048914 Bacteria 1271
320 Ga0496112_0137742 3300048915 Bacteria 2410
321 Ga0496112_0177006 3300048915 Unclassified 2098
322 Ga0496112_0233925 3300048915 Unclassified 1792
323 Ga0496113_0140601 3300048916 Bacteria 1899
324 Ga0496113_0145050 3300048916 Bacteria 1870
325 Ga0496114_0003767 3300048917 Bacteria 11693
326 Ga0496115_0131647 3300048918 Bacteria 2061
327 Ga0501074_0397196 3300049590 Unclassified 978
328 Ga0501080_0158361 3300049742 Bacteria 2092
329 nmdc:mga0yw44_394115_c1 3300050492 Bacteria 936
330 nmdc:mga05p37_326242_c2 3300050507 Bacteria 1372
331 nmdc:mga05p37_639136_c1 3300050507 Bacteria 1194
332 nmdc:mga0n895_256234_c1 3300050512 Bacteria 1775
333 nmdc:mga08x19_649374_c1 3300050514 Bacteria 748
334 nmdc:mga0a205_946294_c1 3300050515 Bacteria 708
335 Ga0501084_0814633 3300054114 Bacteria 786
336 Ga0501082_0363956 3300060353 Bacteria 1261
337 Ga0501082_1465263 3300060353 Bacteria 596
338 JGI24744J21845_10005250
339 JGI24744J21845_10005965
340 JGI24744J21845_10015785
341 JGI24742J22300_10012856
342 JGI24751J29686_10056893
343 Ga0070676_10500824
344 Ga0070690_100032529
345 Ga0068869_100320503
346 Ga0070666_10032366
347 Ga0070680_100085180
348 Ga0070680_100498343
349 Ga0070682_100482575
350 Ga0068868_100034250
351 Ga0070660_100127122
352 Ga0070689_100001693
353 Ga0070691_10022909
354 Ga0070687_100105657
355 Ga0070692_10061350
356 Ga0070668_100057826
357 Ga0070675_100069965
358 Ga0070671_100014394
359 Ga0070671_100361213
360 Ga0070674_100015014
361 Ga0070673_100074498
362 Ga0070673_100756616
363 Ga0070688_100008913
364 Ga0070659_100099502
365 Ga0070667_100834546
366 Ga0070703_10043149
367 Ga0070709_10006375
368 Ga0070714_102185873
369 Ga0070713_100359711
370 Ga0070710_10011759
371 Ga0070701_10000667
372 Ga0070711_100001144
373 Ga0070705_100002521
374 Ga0070705_100302356
375 Ga0070705_100784544
376 Ga0070700_100022204
377 Ga0070694_100066182
378 Ga0070708_100115050
379 Ga0070708_100593929
380 Ga0070708_101123144
381 Ga0070708_101244368
382 Ga0070708_101447538
383 Ga0070663_100112446
384 Ga0070678_100024539
385 Ga0070678_100266575
386 Ga0070662_100143449
387 Ga0070681_10300920
388 Ga0068867_100007911
389 Ga0070685_10005085
390 Ga0070706_100057769
391 Ga0070706_100082554
392 Ga0070707_100004675
393 Ga0070707_100029612
394 Ga0070707_100615370
395 Ga0070707_100914263
396 Ga0070698_100007005
397 Ga0070698_100042651
398 Ga0070698_100288325
399 Ga0070699_101028078
400 Ga0070699_101682544
401 Ga0070679_100368414
402 Ga0070697_100266149
403 Ga0068853_100011697
404 Ga0070672_100057832
405 Ga0070686_100009622
406 Ga0070686_100830103
407 Ga0070695_100152922
408 Ga0070695_100707956
409 Ga0070696_100027097
410 Ga0070696_100798230
411 Ga0070696_100821200
412 Ga0070696_101522243
413 Ga0070693_100043776
414 Ga0070665_100034485
415 Ga0070704_100011254
416 Ga0068855_100206336
417 Ga0068854_100541297
418 Ga0068856_100006244
419 Ga0070702_100004914
420 Ga0070702_100462440
421 Ga0068852_100074116
422 Ga0068852_102441258
423 Ga0068859_100086545
424 Ga0068866_10003985
425 Ga0068863_100227565
426 Ga0068858_100271569
427 Ga0068860_100605907
428 Ga0081455_10084012
429 Ga0081455_10185588
430 Ga0081539_10057031
431 Ga0070717_10178093
432 Ga0070717_10190867
433 Ga0075365_10006644
434 Ga0070716_100169944
435 Ga0070716_100643844
436 Ga0070712_100002015
437 Ga0068871_100076245
438 Ga0075428_100307899
439 Ga0075431_100220942
440 Ga0075433_10830955
441 Ga0068865_100007640
442 Ga0068865_100201578
443 Ga0097620_100086547
444 Ga0075435_100066891
445 Ga0105240_11957066
446 Ga0105245_10010040
447 Ga0105245_10103812
448 Ga0105245_10291142
449 Ga0105247_10055379
450 Ga0114129_10354835
451 Ga0114129_10552692
452 Ga0114129_10883030
453 Ga0114129_11315819
454 Ga0114129_11801262
455 Ga0105243_10085284
456 Ga0105243_10731571
457 Ga0105241_10047032
458 Ga0105242_10108824
459 Ga0105242_10719951
460 Ga0105242_11670028
461 Ga0105248_10006882
462 Ga0105248_10171345
463 Ga0105237_10072064
464 Ga0105238_10065340
465 Ga0105249_10013630
466 Ga0105249_10207878
467 Ga0105239_10127044
468 Ga0105246_10089710
469 Ga0105246_12358233
470 Ga0157369_10015240
471 Ga0157369_10031090
472 Ga0157369_10803908
473 Ga0157374_10317070
474 Ga0157378_10057695
475 Ga0163162_10012762
476 Ga0157375_10019957
477 Ga0157375_11085659
478 Ga0157377_10005058
479 Ga0157379_10278712
480 Ga0157376_10026512
481 Ga0163161_10086104
482 Ga0206353_11491690
483 Ga0207653_10055841
484 Ga0207692_10014099
485 Ga0207642_10004406
486 Ga0207710_10089734
487 Ga0207688_10059339
488 Ga0207647_10079363
489 Ga0207685_10031382
490 Ga0207699_10026909
491 Ga0207684_10032079
492 Ga0207654_10160135
493 Ga0207707_10505904
494 Ga0207671_10263409
495 Ga0207693_10001754
496 Ga0207663_10033636
497 Ga0207660_10298454
498 Ga0207662_10035018
499 Ga0207657_10021891
500 Ga0207652_10710490
501 Ga0207646_10005933
502 Ga0207646_10026291
503 Ga0207646_10131037
504 Ga0207646_10879315
505 Ga0207646_11339538
506 Ga0207646_11544890
507 Ga0207694_10886007
508 Ga0207659_10283191
509 Ga0207700_10391582
510 Ga0207644_10077803
511 Ga0207690_10160914
512 Ga0207690_11149076
513 Ga0207686_10015372
514 Ga0207709_10007985
515 Ga0207670_10061955
516 Ga0207669_10003162
517 Ga0207669_10612032
518 Ga0207704_10258162
519 Ga0207665_10060706
520 Ga0207665_10330540
521 Ga0207691_10015425
522 Ga0207711_10015451
523 Ga0207689_10329359
524 Ga0207651_10270679
525 Ga0207712_10184467
526 Ga0207668_10450572
527 Ga0207658_10747126
528 Ga0207677_10122035
529 Ga0207703_10052555
530 Ga0207639_10041840
531 Ga0207678_10018155
532 Ga0207708_10001814
533 Ga0207641_10324972
534 Ga0207648_10000150
535 Ga0207648_10146974
536 Ga0207675_100551714
537 Ga0207683_10000131
538 Ga0209966_1033008
539 Ga0209998_10020009
540 Ga0268266_10067171
541 Ga0268265_11923003
542 Ga0268264_10350523
543 Ga0265331_10272918
544 Ga0373948_0189388
545 Ga0373945_0346403
546 Ga0373943_0102349
547 Ga0373946_0269935
548 Ga0373946_0438871
549 Ga0373935_0253675
550 Ga0373947_0107269
551 Ga0373925_1362869
552 Ga0395899_0007526
553 Ga0395899_0110785
554 Ga0395899_0159039
555 Ga0395899_0450270
556 Ga0395900_0005387
557 Ga0395900_0027974
558 Ga0395900_0035629
559 Ga0395900_0203421
560 Ga0395900_0330618
561 Ga0395900_0425292
562 Ga0395900_0738894
563 Ga0395898_0012536
564 Ga0395898_0016654
565 Ga0395898_0050611
566 Ga0395898_0068719
567 Ga0395898_0108301
568 Ga0395898_0350550
569 Ga0395898_0389752
570 Ga0395898_0846127
571 Ga0395898_0889060
572 Ga0395898_1424358
573 Ga0395905_0001912
574 Ga0395905_0103609
575 Ga0395905_0177311
576 Ga0395905_0185690
577 Ga0395905_0374020
578 Ga0395905_0406416
579 Ga0395905_0798285
580 Ga0395901_0005580
581 Ga0395901_0033406
582 Ga0395901_0047516
583 Ga0395901_0050575
584 Ga0395901_0054136
585 Ga0395901_0095780
586 Ga0395901_0099114
587 Ga0395901_0222559
588 Ga0395901_0493532
589 Ga0395901_0626410
590 Ga0395901_0858666
591 Ga0395901_1265188
592 Ga0436363_0003014
593 Ga0451853_3562842
594 Ga0451853_4080472
595 Ga0466969_0058074
596 Ga0466961_0187121
597 Ga0466968_0000957
598 Ga0466960_0241837
599 Ga0466959_0095060
600 Ga0451576_0486824
601 Ga0466958_0352089
602 Ga0495603_0010014
603 Ga0495603_0214717
604 Ga0495641_0030884
605 Ga0495582_0304975
606 Ga0495582_0314059
607 Ga0495639_0003989
608 Ga0495662_0085879
609 Ga0495584_0087279
610 Ga0495585_0134506
611 Ga0495585_0526683
612 Ga0495596_0028183
613 Ga0495607_0078930
614 Ga0495607_0247031
615 Ga0495616_0366068
616 Ga0495630_0189907
617 Ga0495644_0089080
618 Ga0495665_0127809
619 Ga0495609_0145783
620 Ga0495609_0203120
621 Ga0495667_0725053
622 Ga0495611_0097954
623 Ga0495588_0123943
624 Ga0495647_0457386
625 Ga0495658_0074725
626 Ga0495613_0339393
627 Ga0495624_0051459
628 Ga0495670_0230945
629 Ga0495671_0048869
630 Ga0495671_0527956
631 Ga0495589_0174967
632 Ga0495581_0011955
633 Ga0495581_0079186
634 Ga0495676_0070543
635 Ga0495676_0399331
636 Ga0495680_0476988
637 Ga0495615_0266468
638 Ga0496100_0436943
639 Ga0496101_0169473
640 Ga0496102_0036105
641 Ga0496103_0142501
642 Ga0496104_0023441
643 Ga0496104_0954294
644 Ga0496105_0259160
645 Ga0496106_0442323
646 Ga0496106_1420048
647 Ga0496107_0091882
648 Ga0496107_0589188
649 Ga0496108_0046603
650 Ga0496108_1023848
651 Ga0496108_1705277
652 Ga0496109_0059385
653 Ga0496109_0129229
654 Ga0496109_0223296
655 Ga0496110_0105673
656 Ga0496111_0266532
657 Ga0496112_0137742
658 Ga0496112_0177006
659 Ga0496112_0233925
660 Ga0496113_0140601
661 Ga0496113_0145050
662 Ga0496114_0003767
663 Ga0496115_0131647
664 Ga0501074_0397196
665 Ga0501080_0158361
666 nmdc:mga0yw44_394115_c1
667 nmdc:mga05p37_326242_c2
668 nmdc:mga05p37_639136_c1
669 nmdc:mga0n895_256234_c1
670 nmdc:mga08x19_649374_c1
671 nmdc:mga0a205_946294_c1
672 Ga0501084_0814633
673 Ga0501082_0363956
674 Ga0501082_1465263

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

64

135

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pfw-assembly1.cif.gz_B crystal structure of a rmlc-like cupin (sfri_3105) from shewanella frigidimarina ncimb 400 at 1.90 a resolution 0.9025 26 140
7zyb-assembly1.cif.gz_A bekdgf with ca 0.8952 26 140
6m9s-assembly2.cif.gz_C crystal structure of semet sznf from streptomyces achromogenes var. streptozoticus nrrl 2697 0.8932 61 139
6m9s-assembly1.cif.gz_A crystal structure of semet sznf from streptomyces achromogenes var. streptozoticus nrrl 2697 0.8914 61 139
6m9s-assembly2.cif.gz_D crystal structure of semet sznf from streptomyces achromogenes var. streptozoticus nrrl 2697 0.8912 61 139
ID Description Score Start End Superfamily
af_P24174_373_472_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9171 60 148 2.60.120.10
af_A0A1D8PPZ7_421_512_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9161 47 138 2.60.120.10
2pfwB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9021 28 140 2.60.120.10
3fjsA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8885 59 138 2.60.120.10
af_A0A0R0L0M3_22_151_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8855 58 145 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A538DHL2-F1-model_v4 Cupin domain-containing protein 0.9873 22 153
AF-A0A538DHL2-F1-model_v4 Cupin domain-containing protein 0.9799 22 153
AF-A0A7W0Q0T2-F1-model_v4 Cupin domain-containing protein 0.971 57 150
AF-A0A538ID37-F1-model_v4 Cupin domain-containing protein 0.9667 62 152
AF-A0A538CH66-F1-model_v4 Cupin domain-containing protein 0.9663 22 150

Map