F412903

General Info

Members Datasets Scaffolds Average Seq Length
337 169 674 111

Family's Representative Sequence

Representative Sequence 3300002067|JGI24735J21928_10122948|JGI24735J21928_101229482
Length 111
Sequence MEIPTTPVSGVPDPLPEGLLVLDVREDDEWRAGHVEGSLHVPLMKLGATYTQLPEADQTLVVCRVGSRSAYAAGFLIQQGIEAVNLEGGLVEWYAAGRPLVTDEDHPATVL

Samples

Sample ID Description Type Environment
1 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
40 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
41 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
91 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
94 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
95 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
96 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
97 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
98 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
99 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
100 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
101 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
102 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
103 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
104 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
105 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
106 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
107 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
108 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
109 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
110 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
111 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
112 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
113 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
114 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
115 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
116 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
117 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
118 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
119 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
120 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
121 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
122 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
123 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
124 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
125 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
138 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
139 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
140 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
141 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
142 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
143 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
144 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
145 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
146 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
147 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
148 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
149 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
150 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
151 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
153 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
154 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
155 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
156 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
157 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
158 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
159 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
160 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
161 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
162 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
163 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
164 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
165 2643221561 Nocardioides sp. Root151 Isolate Unclassified
166 2643221696 Nocardioides sp. Root140 Isolate Unclassified
167 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
168 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
169 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root

Type Distribution

Type Percentage (%)
Metagenomes 98.52
Metatranscriptomes 0
Isolates 1.48

Biome Distribution

Category Percentage (%)
Aerial Root 0.59
Bulb 0
Endosphere 33.23
Nodule 0
Rhizoplane 5.64
Rhizosphere 58.46
Stem 0
Stem Tuber 0
Unclassified 8.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10122948 3300002067 Unclassified 747
2 Ga0070658_10034215 3300005327 Bacteria 4089
3 Ga0070683_100001276 3300005329 Bacteria 19154
4 Ga0070683_101283280 3300005329 Bacteria 704
5 Ga0070670_100381359 3300005331 Unclassified 1242
6 Ga0068869_100289536 3300005334 Bacteria 1319
7 Ga0070666_11014689 3300005335 Bacteria 616
8 Ga0070682_100290855 3300005337 Bacteria 1195
9 Ga0068868_100248653 3300005338 Bacteria 1496
10 Ga0070660_100024420 3300005339 Bacteria 4482
11 Ga0070692_10058441 3300005345 Bacteria 2025
12 Ga0070692_10292215 3300005345 Bacteria 992
13 Ga0070675_100204127 3300005354 Bacteria 1716
14 Ga0070675_100806711 3300005354 Unclassified 858
15 Ga0070671_100879048 3300005355 Unclassified 782
16 Ga0070659_100129572 3300005366 Bacteria 2048
17 Ga0070667_100100665 3300005367 Bacteria 2496
18 Ga0070667_100575041 3300005367 Bacteria 1037
19 Ga0070701_10757394 3300005438 Unclassified 658
20 Ga0070705_100331056 3300005440 Bacteria 1103
21 Ga0070708_100483590 3300005445 Bacteria 1168
22 Ga0070663_100485649 3300005455 Unclassified 1023
23 Ga0070663_101612917 3300005455 Bacteria 579
24 Ga0070681_11581061 3300005458 Bacteria 581
25 Ga0068867_100635061 3300005459 Bacteria 935
26 Ga0070679_100525353 3300005530 Unclassified 1127
27 Ga0070684_100005763 3300005535 Bacteria 9523
28 Ga0070684_101014921 3300005535 Bacteria 779
29 Ga0070684_101398091 3300005535 Bacteria 659
30 Ga0070672_101041648 3300005543 Bacteria 726
31 Ga0070695_100933899 3300005545 Bacteria 702
32 Ga0070696_100315236 3300005546 Bacteria 1202
33 Ga0070696_100546794 3300005546 Unclassified 927
34 Ga0070693_100248610 3300005547 Bacteria 1178
35 Ga0070665_100215746 3300005548 Bacteria 1920
36 Ga0070665_100708187 3300005548 Bacteria 1020
37 Ga0070704_100754904 3300005549 Unclassified 866
38 Ga0068855_100266405 3300005563 Bacteria 1907
39 Ga0070664_100129176 3300005564 Bacteria 2219
40 Ga0070664_101023299 3300005564 Bacteria 777
41 Ga0068857_100020930 3300005577 Bacteria 5753
42 Ga0068856_100017647 3300005614 Bacteria 6918
43 Ga0068852_101366215 3300005616 Bacteria 730
44 Ga0068864_100016072 3300005618 Bacteria 6227
45 Ga0068864_101467386 3300005618 Bacteria 685
46 Ga0068861_102368344 3300005719 Unclassified 533
47 Ga0068863_100868767 3300005841 Unclassified 901
48 Ga0068863_102622545 3300005841 Bacteria 513
49 Ga0068860_100000253 3300005843 Bacteria 79802
50 Ga0068860_100068377 3300005843 Bacteria 3375
51 Ga0068862_100742751 3300005844 Unclassified 954
52 Ga0075365_10008312 3300006038 Bacteria 5883
53 Ga0075365_10023217 3300006038 Bacteria 3898
54 Ga0075365_10049495 3300006038 Bacteria 2769
55 Ga0075365_10070044 3300006038 Bacteria 2358
56 Ga0075365_10090414 3300006038 Bacteria 2085
57 Ga0075365_10114255 3300006038 Bacteria 1857
58 Ga0075365_10129172 3300006038 Bacteria 1748
59 Ga0075365_10164262 3300006038 Bacteria 1548
60 Ga0075365_10237682 3300006038 Bacteria 1279
61 Ga0075365_10256647 3300006038 Bacteria 1229
62 Ga0075365_10261036 3300006038 Unclassified 1218
63 Ga0075365_10261241 3300006038 Bacteria 1217
64 Ga0075365_10270598 3300006038 Bacteria 1195
65 Ga0075365_10371599 3300006038 Bacteria 1008
66 Ga0075365_10562040 3300006038 Bacteria 807
67 Ga0075368_10002404 3300006042 Bacteria 6101
68 Ga0075368_10004097 3300006042 Bacteria 4904
69 Ga0075368_10005458 3300006042 Bacteria 4371
70 Ga0075368_10085863 3300006042 Unclassified 1284
71 Ga0075363_100002192 3300006048 Bacteria 7872
72 Ga0075363_100009728 3300006048 Bacteria 4529
73 Ga0075363_100009880 3300006048 Bacteria 4503
74 Ga0075363_100023975 3300006048 Bacteria 3098
75 Ga0075363_100067094 3300006048 Bacteria 1943
76 Ga0075363_100115727 3300006048 Bacteria 1493
77 Ga0075363_100166162 3300006048 Bacteria 1251
78 Ga0075363_100644387 3300006048 Bacteria 637
79 Ga0075364_10011227 3300006051 Bacteria 5438
80 Ga0075364_10039061 3300006051 Bacteria 3075
81 Ga0075364_10049636 3300006051 Bacteria 2737
82 Ga0075364_10050708 3300006051 Bacteria 2709
83 Ga0075364_10136735 3300006051 Bacteria 1647
84 Ga0075364_10173673 3300006051 Bacteria 1457
85 Ga0075364_10179611 3300006051 Bacteria 1432
86 Ga0075364_10256098 3300006051 Bacteria 1189
87 Ga0075364_10317617 3300006051 Bacteria 1061
88 Ga0075362_10005478 3300006177 Bacteria 4649
89 Ga0075362_10069590 3300006177 Bacteria 1605
90 Ga0075362_10478070 3300006177 Bacteria 635
91 Ga0075367_10006509 3300006178 Bacteria 5905
92 Ga0075367_10017811 3300006178 Bacteria 3906
93 Ga0075367_10034639 3300006178 Bacteria 2918
94 Ga0075367_10046851 3300006178 Bacteria 2542
95 Ga0075367_10252034 3300006178 Bacteria 1107
96 Ga0075367_10399017 3300006178 Bacteria 870
97 Ga0075367_10438908 3300006178 Bacteria 827
98 Ga0075367_10555246 3300006178 Bacteria 729
99 Ga0097621_100257853 3300006237 Bacteria 1529
100 Ga0075370_10005130 3300006353 Bacteria 6461
101 Ga0075370_10043837 3300006353 Bacteria 2529
102 Ga0075370_10082255 3300006353 Bacteria 1851
103 Ga0075370_10087674 3300006353 Bacteria 1793
104 Ga0075370_10090773 3300006353 Bacteria 1762
105 Ga0075370_10213327 3300006353 Bacteria 1140
106 Ga0075370_10721992 3300006353 Bacteria 606
107 Ga0068865_100038423 3300006881 Bacteria 3240
108 Ga0075435_100827738 3300007076 Unclassified 806
109 Ga0105245_10006300 3300009098 Bacteria 10445
110 Ga0105241_10846239 3300009174 Unclassified 846
111 Ga0105242_10141018 3300009176 Bacteria 2091
112 Ga0105238_11005613 3300009551 Unclassified 855
113 Ga0105249_10508053 3300009553 Bacteria 1251
114 Ga0105239_10052652 3300010375 Bacteria 4464
115 Ga0105246_10001468 3300011119 Bacteria 14003
116 Ga0105246_10920382 3300011119 Bacteria 786
117 Ga0157371_11047568 3300013102 Unclassified 624
118 Ga0157371_11377375 3300013102 Bacteria 547
119 Ga0157369_10289077 3300013105 Bacteria 1707
120 Ga0163162_10024505 3300013306 Bacteria 5956
121 Ga0157372_10002605 3300013307 Bacteria 19511
122 Ga0157375_10010263 3300013308 Bacteria 8241
123 Ga0157375_10187050 3300013308 Bacteria 2225
124 Ga0163163_10144636 3300014325 Bacteria 2421
125 Ga0163163_10866804 3300014325 Bacteria 966
126 Ga0157377_10419245 3300014745 Unclassified 916
127 Ga0157379_10015034 3300014968 Bacteria 6789
128 Ga0207688_10019080 3300025901 Bacteria 3732
129 Ga0207647_10238421 3300025904 Bacteria 1045
130 Ga0207657_10019264 3300025919 Bacteria 6485
131 Ga0207652_10587175 3300025921 Unclassified 1000
132 Ga0207694_10266699 3300025924 Bacteria 1404
133 Ga0207650_10384998 3300025925 Unclassified 1159
134 Ga0207650_11445820 3300025925 Bacteria 585
135 Ga0207659_10329376 3300025926 Bacteria 1262
136 Ga0207687_10215457 3300025927 Bacteria 1509
137 Ga0207687_10278235 3300025927 Bacteria 1340
138 Ga0207690_10025058 3300025932 Bacteria 3742
139 Ga0207690_11861023 3300025932 Bacteria 502
140 Ga0207686_10112294 3300025934 Bacteria 1840
141 Ga0207709_10890851 3300025935 Bacteria 723
142 Ga0207704_10188948 3300025938 Bacteria 1496
143 Ga0207691_10925551 3300025940 Bacteria 729
144 Ga0207661_10304957 3300025944 Bacteria 1428
145 Ga0207661_11294700 3300025944 Bacteria 670
146 Ga0207679_10120295 3300025945 Bacteria 2089
147 Ga0207679_10631725 3300025945 Bacteria 967
148 Ga0207712_10167660 3300025961 Bacteria 1713
149 Ga0207658_10033691 3300025986 Bacteria 3655
150 Ga0207658_10106578 3300025986 Bacteria 2207
151 Ga0207658_10514339 3300025986 Bacteria 1068
152 Ga0207677_10440814 3300026023 Unclassified 1114
153 Ga0207703_11703865 3300026035 Unclassified 606
154 Ga0207678_11400801 3300026067 Bacteria 618
155 Ga0207702_10080599 3300026078 Bacteria 2825
156 Ga0207641_10889640 3300026088 Unclassified 884
157 Ga0207676_10094638 3300026095 Bacteria 2462
158 Ga0207674_10002987 3300026116 Bacteria 20973
159 Ga0207675_101255498 3300026118 Unclassified 761
160 Ga0207698_11097257 3300026142 Bacteria 808
161 Ga0209813_10002249 3300027866 Bacteria 4411
162 Ga0209813_10004610 3300027866 Bacteria 3299
163 Ga0209813_10011993 3300027866 Bacteria 2278
164 Ga0268266_10177899 3300028379 Bacteria 1935
165 Ga0268266_11633324 3300028379 Bacteria 620
166 Ga0268264_10000220 3300028381 Bacteria 111692
167 Ga0268264_10335856 3300028381 Bacteria 1434
168 Ga0268264_10663775 3300028381 Bacteria 1033
169 Ga0307413_10365121 3300031824 Bacteria 1119
170 Ga0307410_10808443 3300031852 Bacteria 798
171 Ga0307407_11493846 3300031903 Bacteria 534
172 Ga0307409_100049350 3300031995 Bacteria 3209
173 Ga0307409_100187819 3300031995 Bacteria 1836
174 Ga0307409_100294610 3300031995 Bacteria 1506
175 Ga0307409_101455265 3300031995 Bacteria 712
176 Ga0307415_100465676 3300032126 Bacteria 1096
177 Ga0395900_0335482 3300037418 Bacteria 1489
178 Ga0395898_1608521 3300037466 Bacteria 574
179 Ga0395905_0343527 3300037471 Bacteria 1384
180 Ga0451789_1142868 3300041443 Bacteria 535
181 Ga0451791_1384610 3300041451 Unclassified 557
182 Ga0451807_1840872 3300041486 Bacteria 1070
183 Ga0451807_2284591 3300041486 Bacteria 528
184 Ga0451839_1592577 3300041496 Bacteria 545
185 Ga0451847_0424915 3300041503 Bacteria 733
186 Ga0451853_2123912 3300041512 Bacteria 537
187 Ga0450907_015735 3300042146 Bacteria 1262
188 Ga0466968_0457419 3300044735 Bacteria 632
189 Ga0466970_0040929 3300044765 Bacteria 2462
190 Ga0466970_0146453 3300044765 Bacteria 1303
191 Ga0466957_0064437 3300044842 Bacteria 2255
192 Ga0466960_0046507 3300044901 Bacteria 2078
193 Ga0451576_0825339 3300045051 Bacteria 973
194 Ga0466967_0887636 3300045976 Bacteria 886
195 Ga0496101_0400787 3300048904 Unclassified 1080
196 Ga0496101_1172445 3300048904 Bacteria 602
197 Ga0496101_1569649 3300048904 Bacteria 512
198 Ga0496102_0096885 3300048905 Bacteria 2735
199 Ga0496102_0497671 3300048905 Bacteria 1141
200 Ga0496103_0051198 3300048906 Bacteria 2556
201 Ga0496106_0093231 3300048909 Bacteria 2327
202 Ga0496107_0290272 3300048910 Bacteria 1217
203 Ga0496108_0140284 3300048911 Bacteria 2082
204 Ga0496109_0030446 3300048912 Bacteria 4837
205 Ga0496110_0008364 3300048913 Bacteria 8323
206 Ga0496111_0003092 3300048914 Bacteria 10230
207 Ga0496111_0517278 3300048914 Bacteria 878
208 Ga0496114_0047614 3300048917 Bacteria 3566
209 Ga0496114_1171892 3300048917 Bacteria 654
210 Ga0496124_0035196 3300048927 Bacteria 4384
211 Ga0501031_0363159 3300049568 Bacteria 937
212 Ga0501031_0680728 3300049568 Bacteria 661
213 Ga0501031_0896151 3300049568 Bacteria 568
214 Ga0501032_0055599 3300049569 Bacteria 2663
215 Ga0501033_0178036 3300049570 Bacteria 1525
216 Ga0501033_0425293 3300049570 Bacteria 925
217 Ga0501033_0712315 3300049570 Bacteria 682
218 Ga0501034_0005809 3300049571 Bacteria 13420
219 Ga0501036_0450512 3300049572 Bacteria 1072
220 Ga0501039_0043339 3300049575 Bacteria 3476
221 Ga0501039_0052430 3300049575 Bacteria 3157
222 Ga0501040_0150241 3300049576 Bacteria 1643
223 Ga0501040_0789694 3300049576 Bacteria 687
224 Ga0501041_0084107 3300049577 Bacteria 1961
225 Ga0501041_0093898 3300049577 Bacteria 1853
226 Ga0501042_0191610 3300049578 Bacteria 1475
227 Ga0501042_0219240 3300049578 Bacteria 1372
228 Ga0501042_0380733 3300049578 Bacteria 1022
229 Ga0501043_0778986 3300049579 Bacteria 693
230 Ga0501046_0731547 3300049580 Bacteria 696
231 Ga0501048_0178022 3300049582 Bacteria 1507
232 Ga0501048_0352294 3300049582 Bacteria 1050
233 Ga0501048_1338013 3300049582 Bacteria 515
234 Ga0501067_0036502 3300049583 Bacteria 2728
235 Ga0501068_0011087 3300049584 Bacteria 5074
236 Ga0501069_0136830 3300049585 Bacteria 1404
237 Ga0501069_0684124 3300049585 Bacteria 618
238 Ga0501070_0078672 3300049586 Bacteria 2728
239 Ga0501070_0144813 3300049586 Bacteria 1961
240 Ga0501070_0333825 3300049586 Bacteria 1232
241 Ga0501071_0026030 3300049587 Bacteria 4103
242 Ga0501071_0152905 3300049587 Bacteria 1722
243 Ga0501071_0181979 3300049587 Bacteria 1575
244 Ga0501071_0296098 3300049587 Bacteria 1226
245 Ga0501071_0916299 3300049587 Bacteria 676
246 Ga0501072_0023195 3300049588 Bacteria 4819
247 Ga0501072_0264692 3300049588 Bacteria 1368
248 Ga0501072_0484101 3300049588 Bacteria 979
249 Ga0501072_0897287 3300049588 Bacteria 692
250 Ga0501073_0013668 3300049589 Bacteria 5905
251 Ga0501074_0003698 3300049590 Bacteria 10844
252 Ga0501074_0131429 3300049590 Bacteria 1791
253 Ga0501075_1025416 3300049591 Bacteria 627
254 Ga0501075_1543710 3300049591 Bacteria 502
255 Ga0501076_0844124 3300049592 Bacteria 755
256 Ga0501076_1298471 3300049592 Bacteria 598
257 Ga0501077_0012606 3300049593 Bacteria 5294
258 Ga0501077_0510986 3300049593 Bacteria 770
259 Ga0501077_1069017 3300049593 Bacteria 519
260 Ga0501079_0007138 3300049741 Bacteria 8432
261 Ga0501079_0361512 3300049741 Bacteria 1138
262 Ga0501079_0400490 3300049741 Bacteria 1076
263 Ga0501080_0025913 3300049742 Bacteria 5447
264 Ga0501080_0350651 3300049742 Bacteria 1333
265 Ga0501080_1474935 3300049742 Bacteria 579
266 Ga0501083_0014915 3300049744 Bacteria 5435
267 Ga0501035_0480236 3300049822 Bacteria 1025
268 Ga0501044_0550167 3300049823 Bacteria 1051
269 nmdc:mga03683_2588_c1 3300050489 Bacteria 5649
270 nmdc:mga03683_265534_c1 3300050489 Bacteria 799
271 nmdc:mga03n38_13461_c1 3300050490 Bacteria 3109
272 nmdc:mga03n38_158861_c1 3300050490 Bacteria 1143
273 nmdc:mga03n38_17014_c1 3300050490 Bacteria 2840
274 nmdc:mga03n38_38966_c1 3300050490 Bacteria 2059
275 nmdc:mga03n38_45515_c1 3300050490 Bacteria 1932
276 nmdc:mga03n38_50705_c1 3300050490 Bacteria 1851
277 nmdc:mga03n38_6614_c1 3300050490 Bacteria 4042
278 nmdc:mga00v17_1073872_c1 3300050491 Bacteria 505
279 nmdc:mga00v17_115309_c1 3300050491 Bacteria 1707
280 nmdc:mga00v17_137979_c1 3300050491 Bacteria 1157
281 nmdc:mga00v17_155691_c1 3300050491 Bacteria 1469
282 nmdc:mga00v17_206686_c1 3300050491 Bacteria 1270
283 nmdc:mga00v17_273716_c1 3300050491 Bacteria 1096
284 nmdc:mga00v17_279443_c1 3300050491 Bacteria 1084
285 nmdc:mga00v17_311860_c1 3300050491 Bacteria 1022
286 nmdc:mga00v17_33192_c1 3300050491 Bacteria 3057
287 nmdc:mga00v17_355866_c1 3300050491 Bacteria 952
288 nmdc:mga00v17_514946_c1 3300050491 Bacteria 775
289 nmdc:mga00v17_530934_c1 3300050491 Bacteria 762
290 nmdc:mga00v17_670512_c1 3300050491 Bacteria 666
291 nmdc:mga0yw44_112387_c1 3300050492 Bacteria 1747
292 nmdc:mga0yw44_127189_c1 3300050492 Bacteria 1647
293 nmdc:mga0yw44_128810_c1 3300050492 Bacteria 1636
294 nmdc:mga0yw44_155964_c1 3300050492 Bacteria 1492
295 nmdc:mga0yw44_164664_c1 3300050492 Bacteria 1453
296 nmdc:mga0yw44_186622_c1 3300050492 Bacteria 1366
297 nmdc:mga0yw44_230993_c1 3300050492 Unclassified 1228
298 nmdc:mga0yw44_236933_c1 3300050492 Bacteria 1212
299 nmdc:mga0yw44_243446_c1 3300050492 Bacteria 1196
300 nmdc:mga0yw44_31158_c1 3300050492 Bacteria 3098
301 nmdc:mga0yw44_3496_c1 3300050492 Bacteria 6988
302 nmdc:mga0yw44_428_c1 3300050492 Bacteria 14762
303 nmdc:mga0yw44_50604_c1 3300050492 Bacteria 2513
304 nmdc:mga0yw44_516394_c1 3300050492 Bacteria 811
305 nmdc:mga0yw44_602082_c1 3300050492 Bacteria 747
306 nmdc:mga0yw44_618483_c1 3300050492 Bacteria 736
307 nmdc:mga0yw44_655026_c1 3300050492 Bacteria 714
308 nmdc:mga06z11_11544_c1 3300050494 Bacteria 3814
309 nmdc:mga06z11_194464_c1 3300050494 Unclassified 1175
310 nmdc:mga06z11_37733_c1 3300050494 Bacteria 2394
311 nmdc:mga06z11_469026_c1 3300050494 Bacteria 762
312 nmdc:mga06z11_57787_c1 3300050494 Bacteria 2011
313 nmdc:mga06z11_699263_c1 3300050494 Bacteria 617
314 nmdc:mga04h51_13006_c1 3300050495 Bacteria 2349
315 nmdc:mga04h51_14077_c1 3300050495 Bacteria 2278
316 nmdc:mga04h51_81916_c1 3300050495 Bacteria 1147
317 nmdc:mga04h51_820_c1 3300050495 Bacteria 7196
318 nmdc:mga07m45_124296_c1 3300050496 Bacteria 1491
319 nmdc:mga07m45_136090_c1 3300050496 Bacteria 1062
320 nmdc:mga07m45_19245_c1 3300050496 Bacteria 3698
321 nmdc:mga07m45_289338_c1 3300050496 Bacteria 953
322 nmdc:mga07m45_408294_c1 3300050496 Bacteria 788
323 nmdc:mga0rr50_809392_c1 3300050513 Unclassified 799
324 Ga0500620_021014 3300053155 Bacteria 1945
325 Ga0501084_0009890 3300054114 Bacteria 7882
326 Ga0501084_0236532 3300054114 Bacteria 1542
327 Ga0501082_0014619 3300060353 Bacteria 6760
328 Ga0501082_0232958 3300060353 Bacteria 1603
329 Ga0501082_0336484 3300060353 Bacteria 1315
330 Ga0530510_0173621 3300061734 Bacteria 1597
331 Ga0530510_0221074 3300061734 Bacteria 1408
332 Ga0530510_0501277 3300061734 Bacteria 920
333 2643825105 2643221561 Bacteria 4984412
334 2644534591 2643221696 Bacteria 5431823
335 2857485767 2857481737 Bacteria 4761446
336 2984577950 2984576629 Bacteria 4248407
337 2990260080 2990256926 Bacteria 4252839
338 JGI24735J21928_10122948
339 Ga0070658_10034215
340 Ga0070683_100001276
341 Ga0070683_101283280
342 Ga0070670_100381359
343 Ga0068869_100289536
344 Ga0070666_11014689
345 Ga0070682_100290855
346 Ga0068868_100248653
347 Ga0070660_100024420
348 Ga0070692_10058441
349 Ga0070692_10292215
350 Ga0070675_100204127
351 Ga0070675_100806711
352 Ga0070671_100879048
353 Ga0070659_100129572
354 Ga0070667_100100665
355 Ga0070667_100575041
356 Ga0070701_10757394
357 Ga0070705_100331056
358 Ga0070708_100483590
359 Ga0070663_100485649
360 Ga0070663_101612917
361 Ga0070681_11581061
362 Ga0068867_100635061
363 Ga0070679_100525353
364 Ga0070684_100005763
365 Ga0070684_101014921
366 Ga0070684_101398091
367 Ga0070672_101041648
368 Ga0070695_100933899
369 Ga0070696_100315236
370 Ga0070696_100546794
371 Ga0070693_100248610
372 Ga0070665_100215746
373 Ga0070665_100708187
374 Ga0070704_100754904
375 Ga0068855_100266405
376 Ga0070664_100129176
377 Ga0070664_101023299
378 Ga0068857_100020930
379 Ga0068856_100017647
380 Ga0068852_101366215
381 Ga0068864_100016072
382 Ga0068864_101467386
383 Ga0068861_102368344
384 Ga0068863_100868767
385 Ga0068863_102622545
386 Ga0068860_100000253
387 Ga0068860_100068377
388 Ga0068862_100742751
389 Ga0075365_10008312
390 Ga0075365_10023217
391 Ga0075365_10049495
392 Ga0075365_10070044
393 Ga0075365_10090414
394 Ga0075365_10114255
395 Ga0075365_10129172
396 Ga0075365_10164262
397 Ga0075365_10237682
398 Ga0075365_10256647
399 Ga0075365_10261036
400 Ga0075365_10261241
401 Ga0075365_10270598
402 Ga0075365_10371599
403 Ga0075365_10562040
404 Ga0075368_10002404
405 Ga0075368_10004097
406 Ga0075368_10005458
407 Ga0075368_10085863
408 Ga0075363_100002192
409 Ga0075363_100009728
410 Ga0075363_100009880
411 Ga0075363_100023975
412 Ga0075363_100067094
413 Ga0075363_100115727
414 Ga0075363_100166162
415 Ga0075363_100644387
416 Ga0075364_10011227
417 Ga0075364_10039061
418 Ga0075364_10049636
419 Ga0075364_10050708
420 Ga0075364_10136735
421 Ga0075364_10173673
422 Ga0075364_10179611
423 Ga0075364_10256098
424 Ga0075364_10317617
425 Ga0075362_10005478
426 Ga0075362_10069590
427 Ga0075362_10478070
428 Ga0075367_10006509
429 Ga0075367_10017811
430 Ga0075367_10034639
431 Ga0075367_10046851
432 Ga0075367_10252034
433 Ga0075367_10399017
434 Ga0075367_10438908
435 Ga0075367_10555246
436 Ga0097621_100257853
437 Ga0075370_10005130
438 Ga0075370_10043837
439 Ga0075370_10082255
440 Ga0075370_10087674
441 Ga0075370_10090773
442 Ga0075370_10213327
443 Ga0075370_10721992
444 Ga0068865_100038423
445 Ga0075435_100827738
446 Ga0105245_10006300
447 Ga0105241_10846239
448 Ga0105242_10141018
449 Ga0105238_11005613
450 Ga0105249_10508053
451 Ga0105239_10052652
452 Ga0105246_10001468
453 Ga0105246_10920382
454 Ga0157371_11047568
455 Ga0157371_11377375
456 Ga0157369_10289077
457 Ga0163162_10024505
458 Ga0157372_10002605
459 Ga0157375_10010263
460 Ga0157375_10187050
461 Ga0163163_10144636
462 Ga0163163_10866804
463 Ga0157377_10419245
464 Ga0157379_10015034
465 Ga0207688_10019080
466 Ga0207647_10238421
467 Ga0207657_10019264
468 Ga0207652_10587175
469 Ga0207694_10266699
470 Ga0207650_10384998
471 Ga0207650_11445820
472 Ga0207659_10329376
473 Ga0207687_10215457
474 Ga0207687_10278235
475 Ga0207690_10025058
476 Ga0207690_11861023
477 Ga0207686_10112294
478 Ga0207709_10890851
479 Ga0207704_10188948
480 Ga0207691_10925551
481 Ga0207661_10304957
482 Ga0207661_11294700
483 Ga0207679_10120295
484 Ga0207679_10631725
485 Ga0207712_10167660
486 Ga0207658_10033691
487 Ga0207658_10106578
488 Ga0207658_10514339
489 Ga0207677_10440814
490 Ga0207703_11703865
491 Ga0207678_11400801
492 Ga0207702_10080599
493 Ga0207641_10889640
494 Ga0207676_10094638
495 Ga0207674_10002987
496 Ga0207675_101255498
497 Ga0207698_11097257
498 Ga0209813_10002249
499 Ga0209813_10004610
500 Ga0209813_10011993
501 Ga0268266_10177899
502 Ga0268266_11633324
503 Ga0268264_10000220
504 Ga0268264_10335856
505 Ga0268264_10663775
506 Ga0307413_10365121
507 Ga0307410_10808443
508 Ga0307407_11493846
509 Ga0307409_100049350
510 Ga0307409_100187819
511 Ga0307409_100294610
512 Ga0307409_101455265
513 Ga0307415_100465676
514 Ga0395900_0335482
515 Ga0395898_1608521
516 Ga0395905_0343527
517 Ga0451789_1142868
518 Ga0451791_1384610
519 Ga0451807_1840872
520 Ga0451807_2284591
521 Ga0451839_1592577
522 Ga0451847_0424915
523 Ga0451853_2123912
524 Ga0450907_015735
525 Ga0466968_0457419
526 Ga0466970_0040929
527 Ga0466970_0146453
528 Ga0466957_0064437
529 Ga0466960_0046507
530 Ga0451576_0825339
531 Ga0466967_0887636
532 Ga0496101_0400787
533 Ga0496101_1172445
534 Ga0496101_1569649
535 Ga0496102_0096885
536 Ga0496102_0497671
537 Ga0496103_0051198
538 Ga0496106_0093231
539 Ga0496107_0290272
540 Ga0496108_0140284
541 Ga0496109_0030446
542 Ga0496110_0008364
543 Ga0496111_0003092
544 Ga0496111_0517278
545 Ga0496114_0047614
546 Ga0496114_1171892
547 Ga0496124_0035196
548 Ga0501031_0363159
549 Ga0501031_0680728
550 Ga0501031_0896151
551 Ga0501032_0055599
552 Ga0501033_0178036
553 Ga0501033_0425293
554 Ga0501033_0712315
555 Ga0501034_0005809
556 Ga0501036_0450512
557 Ga0501039_0043339
558 Ga0501039_0052430
559 Ga0501040_0150241
560 Ga0501040_0789694
561 Ga0501041_0084107
562 Ga0501041_0093898
563 Ga0501042_0191610
564 Ga0501042_0219240
565 Ga0501042_0380733
566 Ga0501043_0778986
567 Ga0501046_0731547
568 Ga0501048_0178022
569 Ga0501048_0352294
570 Ga0501048_1338013
571 Ga0501067_0036502
572 Ga0501068_0011087
573 Ga0501069_0136830
574 Ga0501069_0684124
575 Ga0501070_0078672
576 Ga0501070_0144813
577 Ga0501070_0333825
578 Ga0501071_0026030
579 Ga0501071_0152905
580 Ga0501071_0181979
581 Ga0501071_0296098
582 Ga0501071_0916299
583 Ga0501072_0023195
584 Ga0501072_0264692
585 Ga0501072_0484101
586 Ga0501072_0897287
587 Ga0501073_0013668
588 Ga0501074_0003698
589 Ga0501074_0131429
590 Ga0501075_1025416
591 Ga0501075_1543710
592 Ga0501076_0844124
593 Ga0501076_1298471
594 Ga0501077_0012606
595 Ga0501077_0510986
596 Ga0501077_1069017
597 Ga0501079_0007138
598 Ga0501079_0361512
599 Ga0501079_0400490
600 Ga0501080_0025913
601 Ga0501080_0350651
602 Ga0501080_1474935
603 Ga0501083_0014915
604 Ga0501035_0480236
605 Ga0501044_0550167
606 nmdc:mga03683_2588_c1
607 nmdc:mga03683_265534_c1
608 nmdc:mga03n38_13461_c1
609 nmdc:mga03n38_158861_c1
610 nmdc:mga03n38_17014_c1
611 nmdc:mga03n38_38966_c1
612 nmdc:mga03n38_45515_c1
613 nmdc:mga03n38_50705_c1
614 nmdc:mga03n38_6614_c1
615 nmdc:mga00v17_1073872_c1
616 nmdc:mga00v17_115309_c1
617 nmdc:mga00v17_137979_c1
618 nmdc:mga00v17_155691_c1
619 nmdc:mga00v17_206686_c1
620 nmdc:mga00v17_273716_c1
621 nmdc:mga00v17_279443_c1
622 nmdc:mga00v17_311860_c1
623 nmdc:mga00v17_33192_c1
624 nmdc:mga00v17_355866_c1
625 nmdc:mga00v17_514946_c1
626 nmdc:mga00v17_530934_c1
627 nmdc:mga00v17_670512_c1
628 nmdc:mga0yw44_112387_c1
629 nmdc:mga0yw44_127189_c1
630 nmdc:mga0yw44_128810_c1
631 nmdc:mga0yw44_155964_c1
632 nmdc:mga0yw44_164664_c1
633 nmdc:mga0yw44_186622_c1
634 nmdc:mga0yw44_230993_c1
635 nmdc:mga0yw44_236933_c1
636 nmdc:mga0yw44_243446_c1
637 nmdc:mga0yw44_31158_c1
638 nmdc:mga0yw44_3496_c1
639 nmdc:mga0yw44_428_c1
640 nmdc:mga0yw44_50604_c1
641 nmdc:mga0yw44_516394_c1
642 nmdc:mga0yw44_602082_c1
643 nmdc:mga0yw44_618483_c1
644 nmdc:mga0yw44_655026_c1
645 nmdc:mga06z11_11544_c1
646 nmdc:mga06z11_194464_c1
647 nmdc:mga06z11_37733_c1
648 nmdc:mga06z11_469026_c1
649 nmdc:mga06z11_57787_c1
650 nmdc:mga06z11_699263_c1
651 nmdc:mga04h51_13006_c1
652 nmdc:mga04h51_14077_c1
653 nmdc:mga04h51_81916_c1
654 nmdc:mga04h51_820_c1
655 nmdc:mga07m45_124296_c1
656 nmdc:mga07m45_136090_c1
657 nmdc:mga07m45_19245_c1
658 nmdc:mga07m45_289338_c1
659 nmdc:mga07m45_408294_c1
660 nmdc:mga0rr50_809392_c1
661 Ga0500620_021014
662 Ga0501084_0009890
663 Ga0501084_0236532
664 Ga0501082_0014619
665 Ga0501082_0232958
666 Ga0501082_0336484
667 Ga0530510_0173621
668 Ga0530510_0221074
669 Ga0530510_0501277
670 2643825105
671 2644534591
672 2857485767
673 2984577950
674 2990260080

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00581

Rhodanese

Rhodanese-like domain

11

96

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ve4-assembly2.cif.gz_B crystal structure of persulfide dioxygenase-rhodanese fusion protein with rhodanese domain inactivating mutation (c314s) from burkholderia phytofirmans 0.9375 18 100
3gk5-assembly1.cif.gz_A crystal structure of rhodanese-related protein (tvg0868615) from thermoplasma volcanium, northeast structural genomics consortium target tvr109a 0.9362 4 103
8a56-assembly1.cif.gz_B coenzyme a-persulfide reductase (coapr) from enterococcus faecalis 0.9234 3 91
5ve5-assembly3.cif.gz_C crystal structure of persulfide dioxygenase rhodanese fusion protein with rhodanese domain inactivating mutation (c314s) from burkholderia phytofirmans in complex with glutathione 0.9214 18 104
3tp9-assembly1.cif.gz_B crystal structure of alicyclobacillus acidocaldarius protein with beta-lactamase and rhodanese domains 0.9203 1 101
ID Description Score Start End Superfamily
3gk5A00 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.9362 4 103 3.40.250.10
3tp9B03 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.9252 17 101 3.40.250.10
3gk5A00 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.9185 4 103 3.40.250.10
3ntaA03 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.9109 2 96 3.40.250.10
af_O08446_114_219_3.40.250.10 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.9083 18 102 3.40.250.10
ID Description Score Start End GO Terms
AF-A0A7L5YXJ6-F1-model_v4 Rhodanese-like domain-containing protein 0.981 1 111
AF-A0A6J6RG55-F1-model_v4 Unannotated protein 0.9762 2 111
AF-A0A347PRR2-F1-model_v4 deleted 0.9741 20 111
AF-A0A7L5YXJ6-F1-model_v4 Rhodanese-like domain-containing protein 0.9723 1 111
AF-A0A7C3PAC2-F1-model_v4 MBL fold metallo-hydrolase 0.9711 18 101 GO:0004792
GO:0006749
GO:0016787
GO:0050313
GO:0070813

Map