F412855

General Info

Members Datasets Scaffolds Average Seq Length
336 181 672 213

Family's Representative Sequence

Representative Sequence 3300050515|nmdc:mga0a205_552653_c1|nmdc:mga0a205_552653_c1_25_765
Length 246
Sequence MAMVKQRRPSNRPARSAAHADINVGAHGNVQTESQTSSTAHADRSDDRGSRLIAQKADAPSXXXXPQRRSTYFEAVALYERGLEALQRHEYRQATELLESVLRQYPEERELHERVRLYLNICQRQATQRVASPETVEERLYAATLAINGGQYDQAIAHLRLVRDEDPDNDHALYMLAVAHAQRDEHAEAVAHLERAIALNPENRSLARTDPDLEPLREDDAFRAALEAPIASRVDRRRPFRTRTAR

Samples

Sample ID Description Type Environment
1 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
136 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
137 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
138 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
139 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
140 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
141 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
142 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
143 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
144 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
145 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
146 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
147 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
148 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
149 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
150 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
151 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
152 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
153 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
154 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
155 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
156 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
158 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
159 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
160 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
161 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
162 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
163 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
164 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
165 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
166 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
167 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
168 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
169 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
170 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
171 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
172 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
173 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
174 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
175 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
176 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
177 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
178 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
179 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
180 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
181 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.38
Rhizosphere 97.62
Stem 0
Stem Tuber 0
Unclassified 9.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0a205_552653_c1 3300050515 Bacteria 1006
2 Ga0070658_10043207 3300005327 Bacteria 3641
3 Ga0070690_100052373 3300005330 Bacteria 2609
4 Ga0070690_100119322 3300005330 Bacteria 1769
5 Ga0070670_100093203 3300005331 Bacteria 2590
6 Ga0070677_10218031 3300005333 Bacteria 930
7 Ga0070666_10189229 3300005335 Bacteria 1446
8 Ga0070666_10230146 3300005335 Bacteria 1309
9 Ga0070666_10482820 3300005335 Unclassified 897
10 Ga0070680_100291379 3300005336 Bacteria 1384
11 Ga0068868_100293924 3300005338 Bacteria 1378
12 Ga0068868_100691983 3300005338 Bacteria 911
13 Ga0070660_100015537 3300005339 Bacteria 5501
14 Ga0070689_100098375 3300005340 Bacteria 2314
15 Ga0070691_10000566 3300005341 Bacteria 14113
16 Ga0070687_100009453 3300005343 Bacteria 4179
17 Ga0070669_100027121 3300005353 Bacteria 4123
18 Ga0070669_100084739 3300005353 Bacteria 2366
19 Ga0070675_100024023 3300005354 Bacteria 4879
20 Ga0070671_100016497 3300005355 Bacteria 5970
21 Ga0070674_100011406 3300005356 Bacteria 5412
22 Ga0070674_100080102 3300005356 Bacteria 2331
23 Ga0070674_100110669 3300005356 Bacteria 2016
24 Ga0070674_100242966 3300005356 Bacteria 1410
25 Ga0070673_100015669 3300005364 Bacteria 5333
26 Ga0070673_100046543 3300005364 Bacteria 3370
27 Ga0070673_100140335 3300005364 Bacteria 2037
28 Ga0070673_100415628 3300005364 Bacteria 1205
29 Ga0070688_100039483 3300005365 Bacteria 2888
30 Ga0070688_100086959 3300005365 Bacteria 2035
31 Ga0070688_100139244 3300005365 Bacteria 1646
32 Ga0070659_100425020 3300005366 Bacteria 1124
33 Ga0070667_100071310 3300005367 Bacteria 2959
34 Ga0070713_100001677 3300005436 Bacteria 14228
35 Ga0070711_100064904 3300005439 Bacteria 2552
36 Ga0070711_100392965 3300005439 Unclassified 1124
37 Ga0070705_100034951 3300005440 Bacteria 2813
38 Ga0070700_100003240 3300005441 Bacteria 8374
39 Ga0070700_100437103 3300005441 Bacteria 992
40 Ga0070694_100008792 3300005444 Bacteria 6189
41 Ga0070708_100801079 3300005445 Bacteria 886
42 Ga0070678_100093548 3300005456 Bacteria 2312
43 Ga0070678_100443696 3300005456 Archaea 1135
44 Ga0070681_10041419 3300005458 Bacteria 4616
45 Ga0070681_10147800 3300005458 Bacteria 2278
46 Ga0068867_100021593 3300005459 Bacteria 4595
47 Ga0068867_100136777 3300005459 Bacteria 1911
48 Ga0068867_100216506 3300005459 Bacteria 1541
49 Ga0070706_100208402 3300005467 Unclassified 1825
50 Ga0070707_100229095 3300005468 Unclassified 1809
51 Ga0070707_100233111 3300005468 Bacteria 1792
52 Ga0070698_100043333 3300005471 Bacteria 4614
53 Ga0070698_100517736 3300005471 Bacteria 1131
54 Ga0070698_100541463 3300005471 Unclassified 1103
55 Ga0070699_100446820 3300005518 Bacteria 1172
56 Ga0070679_100006588 3300005530 Bacteria 10823
57 Ga0070684_100550948 3300005535 Bacteria 1070
58 Ga0068853_100665857 3300005539 Bacteria 991
59 Ga0070672_100012386 3300005543 Bacteria 5985
60 Ga0070672_100197595 3300005543 Bacteria 1681
61 Ga0070672_100344942 3300005543 Bacteria 1269
62 Ga0070686_100028461 3300005544 Bacteria 3389
63 Ga0070686_100411355 3300005544 Bacteria 1031
64 Ga0070695_100004675 3300005545 Bacteria 8051
65 Ga0070695_100143450 3300005545 Bacteria 1659
66 Ga0070696_100020228 3300005546 Bacteria 4511
67 Ga0070696_100035306 3300005546 Bacteria 3442
68 Ga0070693_100085073 3300005547 Bacteria 1894
69 Ga0070665_100001513 3300005548 Bacteria 26996
70 Ga0070665_100012585 3300005548 Bacteria 8518
71 Ga0070665_100096911 3300005548 Bacteria 2954
72 Ga0070665_100204738 3300005548 Bacteria 1974
73 Ga0070665_100652990 3300005548 Bacteria 1065
74 Ga0070704_100031690 3300005549 Bacteria 3559
75 Ga0070704_100062490 3300005549 Bacteria 2670
76 Ga0070704_100088225 3300005549 Bacteria 2304
77 Ga0068855_100003638 3300005563 Bacteria 18849
78 Ga0068854_100013949 3300005578 Bacteria 5286
79 Ga0068854_100107543 3300005578 Bacteria 2099
80 Ga0068856_100127541 3300005614 Bacteria 2548
81 Ga0070702_100014945 3300005615 Bacteria 3951
82 Ga0068859_100186041 3300005617 Bacteria 2161
83 Ga0068859_100466693 3300005617 Unclassified 1358
84 Ga0068859_100614998 3300005617 Bacteria 1179
85 Ga0068864_100115944 3300005618 Bacteria 2389
86 Ga0068864_100804962 3300005618 Bacteria 924
87 Ga0068864_100912302 3300005618 Bacteria 868
88 Ga0068866_10012996 3300005718 Bacteria 3641
89 Ga0068861_100062963 3300005719 Bacteria 2850
90 Ga0068861_100099518 3300005719 Bacteria 2310
91 Ga0068851_10045907 3300005834 Bacteria 2209
92 Ga0068863_100032362 3300005841 Bacteria 4985
93 Ga0068863_100154728 3300005841 Bacteria 2195
94 Ga0068863_100420331 3300005841 Bacteria 1309
95 Ga0068863_100551168 3300005841 Bacteria 1138
96 Ga0068858_100033879 3300005842 Bacteria 4737
97 Ga0068858_100089119 3300005842 Bacteria 2871
98 Ga0068858_100095442 3300005842 Bacteria 2771
99 Ga0068858_100800158 3300005842 Bacteria 920
100 Ga0068860_100533650 3300005843 Bacteria 1174
101 Ga0068862_100067278 3300005844 Bacteria 3088
102 Ga0068862_100113344 3300005844 Unclassified 2382
103 Ga0081455_10018897 3300005937 Bacteria 6538
104 Ga0081455_10270469 3300005937 Bacteria 1233
105 Ga0081539_10005487 3300005985 Bacteria 12890
106 Ga0070717_10163757 3300006028 Bacteria 1931
107 Ga0075432_10062477 3300006058 Bacteria 1328
108 Ga0070716_100275151 3300006173 Bacteria 1159
109 Ga0097621_100045106 3300006237 Bacteria 3559
110 Ga0097621_100087364 3300006237 Bacteria 2603
111 Ga0097621_100128201 3300006237 Bacteria 2157
112 Ga0097621_100172440 3300006237 Bacteria 1865
113 Ga0068871_100000134 3300006358 Bacteria 47412
114 Ga0068871_100018596 3300006358 Bacteria 5286
115 Ga0068871_100076993 3300006358 Bacteria 2756
116 Ga0068871_100116413 3300006358 Bacteria 2253
117 Ga0068871_100137843 3300006358 Bacteria 2073
118 Ga0068871_100200779 3300006358 Bacteria 1721
119 Ga0075428_100108317 3300006844 Bacteria 3028
120 Ga0075428_100897783 3300006844 Bacteria 940
121 Ga0075433_10122167 3300006852 Bacteria 2313
122 Ga0075433_10152597 3300006852 Bacteria 2055
123 Ga0075433_10187446 3300006852 Bacteria 1840
124 Ga0075433_10405250 3300006852 Bacteria 1203
125 Ga0075434_100053812 3300006871 Bacteria 3999
126 Ga0075434_100197137 3300006871 Bacteria 2033
127 Ga0075429_100121575 3300006880 Bacteria 2282
128 Ga0075429_100519325 3300006880 Bacteria 1043
129 Ga0068865_100112612 3300006881 Bacteria 2010
130 Ga0068865_100121751 3300006881 Bacteria 1941
131 Ga0068865_100175519 3300006881 Bacteria 1646
132 Ga0075436_100074553 3300006914 Bacteria 2349
133 Ga0097620_100186052 3300006931 Bacteria 2161
134 Ga0097620_100466768 3300006931 Unclassified 1358
135 Ga0097620_100615050 3300006931 Bacteria 1179
136 Ga0075435_100008735 3300007076 Bacteria 7288
137 Ga0075435_100149666 3300007076 Bacteria 1961
138 Ga0075435_100219035 3300007076 Bacteria 1616
139 Ga0075435_100248511 3300007076 Bacteria 1514
140 Ga0105240_10121049 3300009093 Bacteria 3151
141 Ga0105240_10340429 3300009093 Bacteria 1704
142 Ga0111539_10007478 3300009094 Bacteria 13987
143 Ga0111539_10044864 3300009094 Bacteria 5293
144 Ga0111539_10235087 3300009094 Unclassified 2134
145 Ga0111539_10738536 3300009094 Unclassified 1146
146 Ga0105245_10040879 3300009098 Bacteria 4132
147 Ga0105245_10139437 3300009098 Bacteria 2282
148 Ga0114129_10000426 3300009147 Bacteria 50026
149 Ga0114129_10000876 3300009147 Bacteria 39161
150 Ga0114129_10578592 3300009147 Bacteria 1457
151 Ga0114129_10617320 3300009147 Bacteria 1403
152 Ga0105242_10002040 3300009176 Bacteria 15907
153 Ga0105242_10071438 3300009176 Bacteria 2880
154 Ga0105242_10139304 3300009176 Bacteria 2103
155 Ga0105248_10001934 3300009177 Bacteria 23011
156 Ga0105248_10002519 3300009177 Bacteria 20391
157 Ga0105248_10034028 3300009177 Bacteria 5696
158 Ga0105248_10054680 3300009177 Bacteria 4477
159 Ga0105248_10273024 3300009177 Unclassified 1904
160 Ga0105248_10869733 3300009177 Unclassified 1018
161 Ga0105248_11546075 3300009177 Unclassified 751
162 Ga0105237_10773017 3300009545 Bacteria 967
163 Ga0105238_10534030 3300009551 Bacteria 1176
164 Ga0105238_10633428 3300009551 Bacteria 1079
165 Ga0105249_10183484 3300009553 Bacteria 2037
166 Ga0105249_10832722 3300009553 Bacteria 988
167 Ga0157374_10014472 3300013296 Bacteria 6903
168 Ga0163162_10046631 3300013306 Bacteria 4344
169 Ga0163162_10113186 3300013306 Bacteria 2812
170 Ga0157375_10075613 3300013308 Bacteria 3393
171 Ga0157375_10096895 3300013308 Bacteria 3023
172 Ga0163163_10018711 3300014325 Bacteria 6491
173 Ga0163163_10044699 3300014325 Bacteria 4346
174 Ga0163163_10137095 3300014325 Bacteria 2488
175 Ga0163163_10749076 3300014325 Bacteria 1040
176 Ga0157380_10387378 3300014326 Bacteria 1321
177 Ga0157379_10023903 3300014968 Bacteria 5425
178 Ga0157379_10039104 3300014968 Bacteria 4232
179 Ga0157379_10060309 3300014968 Bacteria 3391
180 Ga0157379_10689161 3300014968 Bacteria 958
181 Ga0157376_10011672 3300014969 Bacteria 6485
182 Ga0157376_10014937 3300014969 Bacteria 5851
183 Ga0157376_10084834 3300014969 Bacteria 2728
184 Ga0157376_10331649 3300014969 Bacteria 1450
185 Ga0207680_10026522 3300025903 Bacteria 3213
186 Ga0207680_10085806 3300025903 Bacteria 1989
187 Ga0207699_10049258 3300025906 Bacteria 2479
188 Ga0207645_10006849 3300025907 Bacteria 8131
189 Ga0207645_10070181 3300025907 Bacteria 2241
190 Ga0207645_10153257 3300025907 Bacteria 1505
191 Ga0207705_10116119 3300025909 Bacteria 1981
192 Ga0207684_10344379 3300025910 Unclassified 1283
193 Ga0207684_10537660 3300025910 Unclassified 1000
194 Ga0207707_10141563 3300025912 Bacteria 2103
195 Ga0207707_10515435 3300025912 Bacteria 1019
196 Ga0207695_10107319 3300025913 Bacteria 2777
197 Ga0207663_10068975 3300025916 Bacteria 2273
198 Ga0207662_10048951 3300025918 Bacteria 2506
199 Ga0207662_10439720 3300025918 Bacteria 890
200 Ga0207657_10000489 3300025919 Bacteria 41785
201 Ga0207652_10207380 3300025921 Bacteria 1764
202 Ga0207652_10629256 3300025921 Bacteria 961
203 Ga0207646_10205061 3300025922 Bacteria 1781
204 Ga0207646_10245680 3300025922 Unclassified 1617
205 Ga0207681_10050606 3300025923 Bacteria 2812
206 Ga0207681_10072009 3300025923 Bacteria 2412
207 Ga0207681_10075130 3300025923 Bacteria 2369
208 Ga0207681_10154199 3300025923 Unclassified 1724
209 Ga0207681_10329380 3300025923 Archaea 1217
210 Ga0207650_10393072 3300025925 Bacteria 1146
211 Ga0207650_10674650 3300025925 Bacteria 872
212 Ga0207659_10325559 3300025926 Bacteria 1269
213 Ga0207659_10908061 3300025926 Bacteria 757
214 Ga0207687_10015139 3300025927 Bacteria 5054
215 Ga0207687_10061375 3300025927 Bacteria 2655
216 Ga0207687_10545074 3300025927 Bacteria 973
217 Ga0207687_10763421 3300025927 Bacteria 823
218 Ga0207700_10011515 3300025928 Bacteria 5645
219 Ga0207644_10029023 3300025931 Bacteria 3835
220 Ga0207686_10057168 3300025934 Bacteria 2455
221 Ga0207709_10020205 3300025935 Bacteria 3754
222 Ga0207670_10065299 3300025936 Bacteria 2497
223 Ga0207670_10128835 3300025936 Unclassified 1850
224 Ga0207669_10058335 3300025937 Bacteria 2355
225 Ga0207704_10029104 3300025938 Bacteria 3075
226 Ga0207704_10164215 3300025938 Unclassified 1584
227 Ga0207665_10132456 3300025939 Bacteria 1771
228 Ga0207691_10023457 3300025940 Bacteria 5809
229 Ga0207691_10029749 3300025940 Bacteria 5108
230 Ga0207711_10030953 3300025941 Bacteria 4514
231 Ga0207711_10107274 3300025941 Bacteria 2479
232 Ga0207711_10310563 3300025941 Bacteria 1456
233 Ga0207689_10661824 3300025942 Bacteria 880
234 Ga0207679_10785312 3300025945 Bacteria 868
235 Ga0207667_10790685 3300025949 Bacteria 946
236 Ga0207651_10045793 3300025960 Bacteria 2936
237 Ga0207651_10064897 3300025960 Bacteria 2558
238 Ga0207651_10089746 3300025960 Bacteria 2245
239 Ga0207651_10163653 3300025960 Bacteria 1747
240 Ga0207712_10479482 3300025961 Bacteria 1060
241 Ga0207668_10057679 3300025972 Bacteria 2710
242 Ga0207640_10053874 3300025981 Bacteria 2628
243 Ga0207640_10244543 3300025981 Bacteria 1388
244 Ga0207658_10139887 3300025986 Bacteria 1957
245 Ga0207677_10389785 3300026023 Bacteria 1178
246 Ga0207677_10390020 3300026023 Bacteria 1178
247 Ga0207677_10501036 3300026023 Bacteria 1050
248 Ga0207703_10046039 3300026035 Bacteria 3512
249 Ga0207703_10057623 3300026035 Bacteria 3169
250 Ga0207703_10260096 3300026035 Bacteria 1568
251 Ga0207703_10467844 3300026035 Bacteria 1180
252 Ga0207708_10006852 3300026075 Bacteria 8427
253 Ga0207702_10473137 3300026078 Bacteria 1218
254 Ga0207641_10000259 3300026088 Bacteria 67298
255 Ga0207641_10293005 3300026088 Bacteria 1534
256 Ga0207648_10007987 3300026089 Bacteria 10320
257 Ga0207648_10050062 3300026089 Bacteria 3654
258 Ga0207648_10063486 3300026089 Bacteria 3219
259 Ga0207676_10061216 3300026095 Bacteria 2980
260 Ga0207675_100022209 3300026118 Bacteria 5908
261 Ga0207675_100032274 3300026118 Bacteria 4878
262 Ga0207675_100105102 3300026118 Bacteria 2661
263 Ga0207675_100150283 3300026118 Unclassified 2216
264 Ga0207675_100343432 3300026118 Bacteria 1462
265 Ga0207683_10122415 3300026121 Bacteria 2336
266 Ga0207428_10025810 3300027907 Bacteria 4913
267 Ga0207428_10049831 3300027907 Bacteria 3353
268 Ga0268266_10078332 3300028379 Bacteria 2876
269 Ga0268266_10093760 3300028379 Bacteria 2634
270 Ga0268266_10143197 3300028379 Bacteria 2147
271 Ga0268265_10003282 3300028380 Bacteria 11730
272 Ga0268264_10508513 3300028381 Bacteria 1176
273 Ga0265329_10056548 3300031242 Bacteria 1244
274 Ga0373950_0001793 3300034818 Bacteria 2862
275 Ga0373958_0001231 3300034819 Bacteria 3426
276 Ga0373959_0002952 3300034820 Bacteria 2699
277 Ga0373938_0001809 3300034957 Bacteria 3413
278 Ga0373928_0004697 3300035084 Bacteria 2603
279 Ga0373929_0000810 3300035085 Bacteria 6083
280 Ga0373940_0032618 3300035088 Bacteria 1396
281 Ga0373951_0007704 3300035091 Bacteria 2443
282 Ga0373952_0006936 3300035092 Bacteria 2110
283 Ga0373932_0011413 3300035112 Bacteria 2170
284 Ga0373936_0090972 3300035113 Unclassified 1279
285 Ga0373939_0001026 3300035114 Bacteria 6884
286 Ga0373941_0011419 3300035115 Bacteria 2295
287 Ga0373960_0009218 3300035121 Bacteria 2384
288 Ga0373943_0005578 3300035170 Bacteria 5645
289 Ga0373946_0041925 3300035171 Bacteria 1879
290 Ga0373946_0064084 3300035171 Unclassified 1571
291 Ga0373955_0043597 3300035172 Unclassified 2414
292 Ga0373924_0024849 3300035410 Bacteria 2364
293 Ga0373935_0089292 3300035692 Unclassified 2015
294 Ga0373935_0329618 3300035692 Bacteria 1085
295 Ga0373947_0339105 3300035725 Bacteria 1007
296 Ga0373937_0159321 3300036401 Bacteria 2116
297 Ga0373937_0316949 3300036401 Unclassified 1475
298 Ga0373925_0009921 3300037068 Bacteria 6916
299 Ga0451576_0067153 3300045051 Bacteria 3732
300 Ga0495603_0171638 3300046455 Bacteria 1256
301 Ga0495629_0126274 3300046459 Bacteria 1782
302 Ga0495629_0415161 3300046459 Unclassified 914
303 Ga0495639_0142677 3300046475 Bacteria 1152
304 Ga0495656_0193279 3300046615 Bacteria 1006
305 Ga0495635_0276748 3300046663 Bacteria 1128
306 Ga0495659_0147437 3300046664 Bacteria 943
307 Ga0495658_0165448 3300046683 Unclassified 1366
308 Ga0495658_0283335 3300046683 Bacteria 1046
309 Ga0495669_0069021 3300046684 Unclassified 1609
310 Ga0495613_0133375 3300046689 Bacteria 1778
311 Ga0495674_0642838 3300047319 Archaea 837
312 Ga0496105_0324292 3300048908 Bacteria 1234
313 Ga0496106_0150912 3300048909 Bacteria 1833
314 Ga0496106_0322984 3300048909 Bacteria 1239
315 Ga0496107_0589180 3300048910 Bacteria 822
316 Ga0496111_0437674 3300048914 Bacteria 965
317 Ga0496112_0480941 3300048915 Bacteria 1178
318 Ga0496114_0029502 3300048917 Bacteria 4510
319 Ga0496114_0506862 3300048917 Bacteria 1067
320 nmdc:mga05p37_14784_c1 3300050507 Bacteria 9374
321 nmdc:mga05p37_214758_c1 3300050507 Bacteria 2324
322 nmdc:mga05p37_26389_c1 3300050507 Bacteria 7065
323 nmdc:mga05p37_8601_c1 3300050507 Bacteria 12070
324 nmdc:mga09592_95842_c1 3300050508 Bacteria 2538
325 nmdc:mga08y16_138036_c1 3300050511 Bacteria 2535
326 nmdc:mga08y16_194209_c1 3300050511 Unclassified 2105
327 nmdc:mga0n895_68518_c1 3300050512 Bacteria 3515
328 nmdc:mga0rr50_343425_c1 3300050513 Bacteria 1255
329 nmdc:mga08x19_145774_c1 3300050514 Bacteria 1601
330 nmdc:mga08x19_29209_c1 3300050514 Bacteria 3458
331 nmdc:mga0a205_26697_c1 3300050515 Bacteria 5509
332 nmdc:mga0a205_38118_c2 3300050515 Bacteria 3910
333 nmdc:mga0a205_476911_c1 3300050515 Unclassified 1106
334 Ga0495619_0130620 3300053085 Bacteria 1726
335 Ga0495619_0209583 3300053085 Unclassified 1350
336 Ga0495619_0215825 3300053085 Unclassified 1329
337 nmdc:mga0a205_552653_c1
338 Ga0070658_10043207
339 Ga0070690_100052373
340 Ga0070690_100119322
341 Ga0070670_100093203
342 Ga0070677_10218031
343 Ga0070666_10189229
344 Ga0070666_10230146
345 Ga0070666_10482820
346 Ga0070680_100291379
347 Ga0068868_100293924
348 Ga0068868_100691983
349 Ga0070660_100015537
350 Ga0070689_100098375
351 Ga0070691_10000566
352 Ga0070687_100009453
353 Ga0070669_100027121
354 Ga0070669_100084739
355 Ga0070675_100024023
356 Ga0070671_100016497
357 Ga0070674_100011406
358 Ga0070674_100080102
359 Ga0070674_100110669
360 Ga0070674_100242966
361 Ga0070673_100015669
362 Ga0070673_100046543
363 Ga0070673_100140335
364 Ga0070673_100415628
365 Ga0070688_100039483
366 Ga0070688_100086959
367 Ga0070688_100139244
368 Ga0070659_100425020
369 Ga0070667_100071310
370 Ga0070713_100001677
371 Ga0070711_100064904
372 Ga0070711_100392965
373 Ga0070705_100034951
374 Ga0070700_100003240
375 Ga0070700_100437103
376 Ga0070694_100008792
377 Ga0070708_100801079
378 Ga0070678_100093548
379 Ga0070678_100443696
380 Ga0070681_10041419
381 Ga0070681_10147800
382 Ga0068867_100021593
383 Ga0068867_100136777
384 Ga0068867_100216506
385 Ga0070706_100208402
386 Ga0070707_100229095
387 Ga0070707_100233111
388 Ga0070698_100043333
389 Ga0070698_100517736
390 Ga0070698_100541463
391 Ga0070699_100446820
392 Ga0070679_100006588
393 Ga0070684_100550948
394 Ga0068853_100665857
395 Ga0070672_100012386
396 Ga0070672_100197595
397 Ga0070672_100344942
398 Ga0070686_100028461
399 Ga0070686_100411355
400 Ga0070695_100004675
401 Ga0070695_100143450
402 Ga0070696_100020228
403 Ga0070696_100035306
404 Ga0070693_100085073
405 Ga0070665_100001513
406 Ga0070665_100012585
407 Ga0070665_100096911
408 Ga0070665_100204738
409 Ga0070665_100652990
410 Ga0070704_100031690
411 Ga0070704_100062490
412 Ga0070704_100088225
413 Ga0068855_100003638
414 Ga0068854_100013949
415 Ga0068854_100107543
416 Ga0068856_100127541
417 Ga0070702_100014945
418 Ga0068859_100186041
419 Ga0068859_100466693
420 Ga0068859_100614998
421 Ga0068864_100115944
422 Ga0068864_100804962
423 Ga0068864_100912302
424 Ga0068866_10012996
425 Ga0068861_100062963
426 Ga0068861_100099518
427 Ga0068851_10045907
428 Ga0068863_100032362
429 Ga0068863_100154728
430 Ga0068863_100420331
431 Ga0068863_100551168
432 Ga0068858_100033879
433 Ga0068858_100089119
434 Ga0068858_100095442
435 Ga0068858_100800158
436 Ga0068860_100533650
437 Ga0068862_100067278
438 Ga0068862_100113344
439 Ga0081455_10018897
440 Ga0081455_10270469
441 Ga0081539_10005487
442 Ga0070717_10163757
443 Ga0075432_10062477
444 Ga0070716_100275151
445 Ga0097621_100045106
446 Ga0097621_100087364
447 Ga0097621_100128201
448 Ga0097621_100172440
449 Ga0068871_100000134
450 Ga0068871_100018596
451 Ga0068871_100076993
452 Ga0068871_100116413
453 Ga0068871_100137843
454 Ga0068871_100200779
455 Ga0075428_100108317
456 Ga0075428_100897783
457 Ga0075433_10122167
458 Ga0075433_10152597
459 Ga0075433_10187446
460 Ga0075433_10405250
461 Ga0075434_100053812
462 Ga0075434_100197137
463 Ga0075429_100121575
464 Ga0075429_100519325
465 Ga0068865_100112612
466 Ga0068865_100121751
467 Ga0068865_100175519
468 Ga0075436_100074553
469 Ga0097620_100186052
470 Ga0097620_100466768
471 Ga0097620_100615050
472 Ga0075435_100008735
473 Ga0075435_100149666
474 Ga0075435_100219035
475 Ga0075435_100248511
476 Ga0105240_10121049
477 Ga0105240_10340429
478 Ga0111539_10007478
479 Ga0111539_10044864
480 Ga0111539_10235087
481 Ga0111539_10738536
482 Ga0105245_10040879
483 Ga0105245_10139437
484 Ga0114129_10000426
485 Ga0114129_10000876
486 Ga0114129_10578592
487 Ga0114129_10617320
488 Ga0105242_10002040
489 Ga0105242_10071438
490 Ga0105242_10139304
491 Ga0105248_10001934
492 Ga0105248_10002519
493 Ga0105248_10034028
494 Ga0105248_10054680
495 Ga0105248_10273024
496 Ga0105248_10869733
497 Ga0105248_11546075
498 Ga0105237_10773017
499 Ga0105238_10534030
500 Ga0105238_10633428
501 Ga0105249_10183484
502 Ga0105249_10832722
503 Ga0157374_10014472
504 Ga0163162_10046631
505 Ga0163162_10113186
506 Ga0157375_10075613
507 Ga0157375_10096895
508 Ga0163163_10018711
509 Ga0163163_10044699
510 Ga0163163_10137095
511 Ga0163163_10749076
512 Ga0157380_10387378
513 Ga0157379_10023903
514 Ga0157379_10039104
515 Ga0157379_10060309
516 Ga0157379_10689161
517 Ga0157376_10011672
518 Ga0157376_10014937
519 Ga0157376_10084834
520 Ga0157376_10331649
521 Ga0207680_10026522
522 Ga0207680_10085806
523 Ga0207699_10049258
524 Ga0207645_10006849
525 Ga0207645_10070181
526 Ga0207645_10153257
527 Ga0207705_10116119
528 Ga0207684_10344379
529 Ga0207684_10537660
530 Ga0207707_10141563
531 Ga0207707_10515435
532 Ga0207695_10107319
533 Ga0207663_10068975
534 Ga0207662_10048951
535 Ga0207662_10439720
536 Ga0207657_10000489
537 Ga0207652_10207380
538 Ga0207652_10629256
539 Ga0207646_10205061
540 Ga0207646_10245680
541 Ga0207681_10050606
542 Ga0207681_10072009
543 Ga0207681_10075130
544 Ga0207681_10154199
545 Ga0207681_10329380
546 Ga0207650_10393072
547 Ga0207650_10674650
548 Ga0207659_10325559
549 Ga0207659_10908061
550 Ga0207687_10015139
551 Ga0207687_10061375
552 Ga0207687_10545074
553 Ga0207687_10763421
554 Ga0207700_10011515
555 Ga0207644_10029023
556 Ga0207686_10057168
557 Ga0207709_10020205
558 Ga0207670_10065299
559 Ga0207670_10128835
560 Ga0207669_10058335
561 Ga0207704_10029104
562 Ga0207704_10164215
563 Ga0207665_10132456
564 Ga0207691_10023457
565 Ga0207691_10029749
566 Ga0207711_10030953
567 Ga0207711_10107274
568 Ga0207711_10310563
569 Ga0207689_10661824
570 Ga0207679_10785312
571 Ga0207667_10790685
572 Ga0207651_10045793
573 Ga0207651_10064897
574 Ga0207651_10089746
575 Ga0207651_10163653
576 Ga0207712_10479482
577 Ga0207668_10057679
578 Ga0207640_10053874
579 Ga0207640_10244543
580 Ga0207658_10139887
581 Ga0207677_10389785
582 Ga0207677_10390020
583 Ga0207677_10501036
584 Ga0207703_10046039
585 Ga0207703_10057623
586 Ga0207703_10260096
587 Ga0207703_10467844
588 Ga0207708_10006852
589 Ga0207702_10473137
590 Ga0207641_10000259
591 Ga0207641_10293005
592 Ga0207648_10007987
593 Ga0207648_10050062
594 Ga0207648_10063486
595 Ga0207676_10061216
596 Ga0207675_100022209
597 Ga0207675_100032274
598 Ga0207675_100105102
599 Ga0207675_100150283
600 Ga0207675_100343432
601 Ga0207683_10122415
602 Ga0207428_10025810
603 Ga0207428_10049831
604 Ga0268266_10078332
605 Ga0268266_10093760
606 Ga0268266_10143197
607 Ga0268265_10003282
608 Ga0268264_10508513
609 Ga0265329_10056548
610 Ga0373950_0001793
611 Ga0373958_0001231
612 Ga0373959_0002952
613 Ga0373938_0001809
614 Ga0373928_0004697
615 Ga0373929_0000810
616 Ga0373940_0032618
617 Ga0373951_0007704
618 Ga0373952_0006936
619 Ga0373932_0011413
620 Ga0373936_0090972
621 Ga0373939_0001026
622 Ga0373941_0011419
623 Ga0373960_0009218
624 Ga0373943_0005578
625 Ga0373946_0041925
626 Ga0373946_0064084
627 Ga0373955_0043597
628 Ga0373924_0024849
629 Ga0373935_0089292
630 Ga0373935_0329618
631 Ga0373947_0339105
632 Ga0373937_0159321
633 Ga0373937_0316949
634 Ga0373925_0009921
635 Ga0451576_0067153
636 Ga0495603_0171638
637 Ga0495629_0126274
638 Ga0495629_0415161
639 Ga0495639_0142677
640 Ga0495656_0193279
641 Ga0495635_0276748
642 Ga0495659_0147437
643 Ga0495658_0165448
644 Ga0495658_0283335
645 Ga0495669_0069021
646 Ga0495613_0133375
647 Ga0495674_0642838
648 Ga0496105_0324292
649 Ga0496106_0150912
650 Ga0496106_0322984
651 Ga0496107_0589180
652 Ga0496111_0437674
653 Ga0496112_0480941
654 Ga0496114_0029502
655 Ga0496114_0506862
656 nmdc:mga05p37_14784_c1
657 nmdc:mga05p37_214758_c1
658 nmdc:mga05p37_26389_c1
659 nmdc:mga05p37_8601_c1
660 nmdc:mga09592_95842_c1
661 nmdc:mga08y16_138036_c1
662 nmdc:mga08y16_194209_c1
663 nmdc:mga0n895_68518_c1
664 nmdc:mga0rr50_343425_c1
665 nmdc:mga08x19_145774_c1
666 nmdc:mga08x19_29209_c1
667 nmdc:mga0a205_26697_c1
668 nmdc:mga0a205_38118_c2
669 nmdc:mga0a205_476911_c1
670 Ga0495619_0130620
671 Ga0495619_0209583
672 Ga0495619_0215825

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07719

TPR_2

Tetratricopeptide repeat

171

203

0.97

PF13181

TPR_8

Tetratricopeptide repeat

170

203

0.96

PF13174

TPR_6

Tetratricopeptide repeat

171

203

0.95

PF13174

TPR_6

Tetratricopeptide repeat

139

169

0.94

PF14559

TPR_19

Tetratricopeptide repeat

146

209

0.94

PF13432

TPR_16

Tetratricopeptide repeat

141

204

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2avp-assembly1.cif.gz_A crystal structure of an 8 repeat consensus tpr superhelix 0.9769 106 170
4cgq-assembly1.cif.gz_A full length tah1 bound to hsp90 peptide srmeevd 0.9416 103 169
2avp-assembly1.cif.gz_A crystal structure of an 8 repeat consensus tpr superhelix 0.9216 106 170
1na3-assembly2.cif.gz_B design of stable alpha-helical arrays from an idealized tpr motif 0.8981 105 187
1na3-assembly1.cif.gz_A design of stable alpha-helical arrays from an idealized tpr motif 0.8958 105 187
ID Description Score Start End Superfamily
af_A4I5Y0_647_715_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9825 108 170 1.25.40.10
2avpA00 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9769 106 170 1.25.40.10
af_A4I5Y0_716_784_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9736 108 171 1.25.40.10
af_G3UYY4_1393_1473_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.958 102 169 1.25.40.10
af_A4I5Y0_574_646_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.956 104 172 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A0P8Y2M0-F1-model_v4 deleted 0.9776 104 195
AF-X1BVF4-F1-model_v4 Tetratricopeptide repeat protein 0.9765 108 198
AF-A0A3N5UCX0-F1-model_v4 Uncharacterized protein 0.9753 104 195
AF-A0A1F4YPU7-F1-model_v4 Uncharacterized protein 0.9591 105 198
AF-A0A7C1J455-F1-model_v4 DUF1028 domain-containing protein 0.9482 105 195

Map