F412788

General Info

Members Datasets Scaffolds Average Seq Length
336 224 672 341

Family's Representative Sequence

Representative Sequence 3300046492|Ga0495585_0057808|Ga0495585_0057808_31_1161
Length 371
Sequence MNHNTPLSPRPLQHLDDCRQRVLSAAQLKAHGINSAALNEQCGPDGPWQQILPGVYLLHPGPPTADERLHAVLLYAGRPQTRTPVAVPTQTTPDEPHPQAPYANAMITGLAALALHRFVSAPPLLSLDRIDVMVPRTRRLRSTGFARLVRSHGMPTPQRISGVPVAPVPRALADAVAQLSHAGEVRRLLTEAVRGGHCEPAAVVRELNQARLLTRPHVIDAVDSLLAEGRAIAEDRMYEMVREYGLPDPLWNVDLRLPGGPHLGGVDAYWPDQAVAVELDTSPSSRLRSSRGGPNAPRHGLRPELQEESDGLEWSEYARKREHLERLGITVVHITPRKLRESLEQQATVVRTALMASVDREPAAYVMVLPR

Samples

Sample ID Description Type Environment
1 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
6 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
7 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
8 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
9 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
10 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
11 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
12 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
13 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
14 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
15 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
16 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
17 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
18 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
19 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
20 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
21 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
22 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
23 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
24 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
25 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
26 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
27 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
28 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
29 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
30 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
31 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
32 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
33 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
34 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
35 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
36 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
37 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
38 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
39 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
40 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
41 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
42 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
43 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
44 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
45 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
46 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
47 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
48 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
49 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
50 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
51 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
52 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
53 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
54 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
55 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
56 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
57 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
58 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
59 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
60 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
61 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
62 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
63 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
64 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
65 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
66 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
67 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
68 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
69 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
70 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
71 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
72 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
73 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
74 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
75 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
76 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
77 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
78 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
79 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
80 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
81 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
82 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
83 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
84 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
85 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
86 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
87 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
88 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
89 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
90 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
91 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
92 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
93 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
94 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
95 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
96 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
97 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
98 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
99 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
100 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
101 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
102 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
103 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
104 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
105 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
106 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
107 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
108 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
109 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
110 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
111 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
112 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
113 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
114 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
115 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
116 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
117 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
118 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
119 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
133 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
134 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
135 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
138 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
139 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
140 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
141 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
142 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
143 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
144 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
145 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
146 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
147 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
148 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
149 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
150 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
151 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
152 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
153 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
154 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
155 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
156 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
157 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
158 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
159 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
160 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
161 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
162 2643221647 Streptomyces sp. Root369 Isolate Unclassified
163 2643221670 Streptomyces sp. Root431 Isolate Unclassified
164 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
165 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
166 2643221714 Streptomyces sp. Root264 Isolate Unclassified
167 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
168 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
169 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
170 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
171 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
172 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
173 2808606448 Streptomyces sp. 193411 Isolate Unclassified
174 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
175 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
176 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
177 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
178 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
179 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
180 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
181 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
182 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
183 2862574272 Streptomyces sp. AcE210 Isolate Nodule
184 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
185 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
186 2867369537 Streptomyces sp. Z26 Isolate Unclassified
187 2867428634 Streptomyces sp. RP5T Isolate Unclassified
188 2867475112 Streptomyces sp. TM32 Isolate Unclassified
189 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
190 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
191 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
192 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
193 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
194 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
195 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
196 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
197 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
198 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
199 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
200 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
201 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
202 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
203 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
204 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
205 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
206 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
207 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
208 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
209 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
210 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
211 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
212 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
213 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
214 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
215 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
216 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
217 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
218 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
219 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
220 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
221 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
222 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
223 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
224 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 78.57
Metatranscriptomes 0.89
Isolates 20.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.25
Nodule 0.6
Rhizoplane 0.3
Rhizosphere 75.3
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495585_0057808 3300046492 Bacteria 2140
2 JGI24738J21930_10009128 3300002075 Bacteria 2242
3 rootH1_10018520 3300003316 Bacteria 3635
4 rootH2_10013096 3300003320 Bacteria 3941
5 rootH2_10109040 3300003320 Bacteria 12356
6 Ga0006562J51391_1057231 3300003578 Bacteria 1190
7 Ga0006562J51391_1064981 3300003578 Bacteria 3460
8 Ga0006562J51391_1064983 3300003578 Bacteria 1520
9 Ga0068853_100142960 3300005539 Bacteria 2149
10 Ga0105239_10257957 3300010375 Bacteria 1959
11 Ga0105246_10007872 3300011119 Bacteria 6540
12 Ga0157372_10332582 3300013307 Bacteria 1769
13 Ga0182008_10004161 3300014497 Bacteria 8513
14 Ga0182006_1025186 3300015261 Bacteria 2446
15 Ga0182007_10000752 3300015262 Bacteria 18218
16 Ga0183367_1006 3300015688 Bacteria 648044
17 Ga0213875_10036432 3300021388 Bacteria 2320
18 Ga0209758_1003326 3300025297 Bacteria 14795
19 Ga0207426_1002953 3300025302 Bacteria 9974
20 Ga0207647_10009427 3300025904 Bacteria 6937
21 Ga0207639_10126375 3300026041 Bacteria 2110
22 Ga0307517_10006097 3300028786 Bacteria 17958
23 Ga0307517_10006681 3300028786 Bacteria 16989
24 Ga0307515_10002026 3300028794 Bacteria 44830
25 Ga0307511_10000836 3300030521 Bacteria 32726
26 Ga0307511_10064694 3300030521 Bacteria 2746
27 Ga0307512_10046222 3300030522 Bacteria 3552
28 Ga0307513_10035496 3300031456 Bacteria 5576
29 Ga0307513_10137686 3300031456 Bacteria 2374
30 Ga0307509_10017584 3300031507 Bacteria 8221
31 Ga0307509_10021925 3300031507 Bacteria 7214
32 Ga0307508_10026669 3300031616 Bacteria 5236
33 Ga0307508_10263605 3300031616 Bacteria 1317
34 Ga0307514_10002400 3300031649 Bacteria 19566
35 Ga0307514_10062496 3300031649 Bacteria 2832
36 Ga0307516_10002619 3300031730 Bacteria 23844
37 Ga0307516_10015562 3300031730 Bacteria 7998
38 Ga0307516_10026125 3300031730 Bacteria 5936
39 Ga0307518_10045794 3300031838 Bacteria 3180
40 Ga0307518_10175801 3300031838 Bacteria 1453
41 Ga0307510_10003848 3300033180 Bacteria 17596
42 Ga0307510_10047058 3300033180 Bacteria 4627
43 Ga0395898_0003192 3300037466 Bacteria 18461
44 Ga0395898_0097258 3300037466 Bacteria 2828
45 Ga0436364_0260305 3300037853 Bacteria 7779
46 Ga0439436_0000414 3300041404 Bacteria 10728
47 Ga0439436_0001155 3300041404 Bacteria 7500
48 Ga0439436_0021465 3300041404 Bacteria 1919
49 Ga0439439_0003736 3300041406 Bacteria 3379
50 Ga0451853_2890701 3300041512 Bacteria 1585
51 Ga0439448_0002332 3300042005 Bacteria 5142
52 Ga0439449_0001059 3300042007 Bacteria 10845
53 Ga0439449_0007557 3300042007 Bacteria 4130
54 Ga0439455_0010192 3300042012 Bacteria 2060
55 Ga0439457_000463 3300042014 Bacteria 11700
56 Ga0439457_003792 3300042014 Bacteria 4058
57 Ga0439462_0007072 3300042015 Bacteria 2805
58 Ga0450894_000405 3300042131 Bacteria 7404
59 Ga0450899_000713 3300042135 Bacteria 3794
60 Ga0450903_000527 3300042138 Bacteria 8009
61 Ga0450903_016817 3300042138 Bacteria 1146
62 Ga0450906_001351 3300042145 Bacteria 5376
63 Ga0439458_0000156 3300042157 Bacteria 15003
64 Ga0466969_0045851 3300044656 Bacteria 2169
65 Ga0466972_0000475 3300044658 Bacteria 20367
66 Ga0466972_0051640 3300044658 Bacteria 1983
67 Ga0466972_0054685 3300044658 Bacteria 1920
68 Ga0466965_0014372 3300044683 Bacteria 3745
69 Ga0466965_0039516 3300044683 Bacteria 2319
70 Ga0466966_0010871 3300044684 Bacteria 6045
71 Ga0466961_0020216 3300044693 Bacteria 4284
72 Ga0466961_0026880 3300044693 Bacteria 3700
73 Ga0466961_0089355 3300044693 Bacteria 1946
74 Ga0466963_0001000 3300044694 Bacteria 14582
75 Ga0466963_0005720 3300044694 Bacteria 7308
76 Ga0466964_0013577 3300044706 Bacteria 3090
77 Ga0466964_0034726 3300044706 Bacteria 2013
78 Ga0466971_0008548 3300044719 Bacteria 4465
79 Ga0466968_0049713 3300044735 Bacteria 1787
80 Ga0466970_0002579 3300044765 Bacteria 8736
81 Ga0466970_0007775 3300044765 Bacteria 5376
82 Ga0466957_0088772 3300044842 Bacteria 1934
83 Ga0466960_0002156 3300044901 Bacteria 7342
84 Ga0466959_0135061 3300045049 Bacteria 1746
85 Ga0466958_0106965 3300045836 Bacteria 1744
86 Ga0466967_0002444 3300045976 Bacteria 11561
87 Ga0466967_0009362 3300045976 Bacteria 7263
88 Ga0466967_0028011 3300045976 Bacteria 4696
89 Ga0495592_0065868 3300046454 Bacteria 2651
90 Ga0495603_0007624 3300046455 Bacteria 6515
91 Ga0495603_0019578 3300046455 Bacteria 4097
92 Ga0495603_0055673 3300046455 Bacteria 2343
93 Ga0495603_0074138 3300046455 Bacteria 1998
94 Ga0495629_0011431 3300046459 Bacteria 6448
95 Ga0495629_0012407 3300046459 Bacteria 6171
96 Ga0495629_0017838 3300046459 Bacteria 5087
97 Ga0495629_0073952 3300046459 Bacteria 2379
98 Ga0495629_0139501 3300046459 Bacteria 1687
99 Ga0495629_0262690 3300046459 Bacteria 1186
100 Ga0495638_0006237 3300046460 Bacteria 8704
101 Ga0495651_0020277 3300046462 Bacteria 5160
102 Ga0495651_0096462 3300046462 Bacteria 2209
103 Ga0495605_0004974 3300046474 Bacteria 7765
104 Ga0495639_0035000 3300046475 Bacteria 2247
105 Ga0495662_0003140 3300046476 Bacteria 8332
106 Ga0495662_0091749 3300046476 Bacteria 1481
107 Ga0495664_0054601 3300046477 Bacteria 2375
108 Ga0495594_0032744 3300046499 Bacteria 2823
109 Ga0495594_0043262 3300046499 Bacteria 2468
110 Ga0495594_0068109 3300046499 Bacteria 1976
111 Ga0495607_0037821 3300046501 Bacteria 2895
112 Ga0495583_0013532 3300046506 Bacteria 4546
113 Ga0495583_0045356 3300046506 Bacteria 2034
114 Ga0495616_0024230 3300046513 Bacteria 3257
115 Ga0495618_0030476 3300046514 Bacteria 3369
116 Ga0495620_0009413 3300046515 Bacteria 5198
117 Ga0495628_0022075 3300046516 Bacteria 5232
118 Ga0495628_0022724 3300046516 Bacteria 5151
119 Ga0495628_0076402 3300046516 Bacteria 2606
120 Ga0495630_0040574 3300046517 Bacteria 3479
121 Ga0495631_0002860 3300046518 Bacteria 9582
122 Ga0495631_0086945 3300046518 Bacteria 1346
123 Ga0495632_0011025 3300046519 Bacteria 5297
124 Ga0495643_0003454 3300046522 Bacteria 11548
125 Ga0495648_0155793 3300046524 Bacteria 1186
126 Ga0495652_0140485 3300046529 Bacteria 1899
127 Ga0495654_0057682 3300046530 Bacteria 1875
128 Ga0495640_0006261 3300046533 Bacteria 9424
129 Ga0495640_0030476 3300046533 Bacteria 3862
130 Ga0495597_0025314 3300046542 Bacteria 2732
131 Ga0495645_0019517 3300046543 Bacteria 4880
132 Ga0495645_0134011 3300046543 Bacteria 1734
133 Ga0495622_0006488 3300046557 Bacteria 5426
134 Ga0495622_0027013 3300046557 Bacteria 2679
135 Ga0495668_0017528 3300046616 Bacteria 4151
136 Ga0495634_0000458 3300046642 Bacteria 40403
137 Ga0495634_0197185 3300046642 Bacteria 1252
138 Ga0495611_0054699 3300046648 Bacteria 1805
139 Ga0495625_0083783 3300046660 Bacteria 2215
140 Ga0495635_0033040 3300046663 Bacteria 3589
141 Ga0495635_0181061 3300046663 Bacteria 1432
142 Ga0495661_0041839 3300046665 Bacteria 2831
143 Ga0495588_0001743 3300046674 Bacteria 9261
144 Ga0495588_0008576 3300046674 Bacteria 4696
145 Ga0495588_0067262 3300046674 Bacteria 1859
146 Ga0495657_0001238 3300046675 Bacteria 22342
147 Ga0495657_0004276 3300046675 Bacteria 11408
148 Ga0495657_0022262 3300046675 Bacteria 4543
149 Ga0495657_0066857 3300046675 Bacteria 2360
150 Ga0495599_0100670 3300046678 Bacteria 1801
151 Ga0495646_0019384 3300046680 Bacteria 4307
152 Ga0495658_0012942 3300046683 Bacteria 4238
153 Ga0495613_0001161 3300046689 Bacteria 20120
154 Ga0495613_0015777 3300046689 Bacteria 5624
155 Ga0495613_0176200 3300046689 Bacteria 1515
156 Ga0495613_0211856 3300046689 Bacteria 1362
157 Ga0495670_0003216 3300046691 Bacteria 8041
158 Ga0495671_0005076 3300046692 Bacteria 7748
159 Ga0495649_0008700 3300046694 Bacteria 6091
160 Ga0495649_0059326 3300046694 Bacteria 2060
161 Ga0495649_0071362 3300046694 Bacteria 1861
162 Ga0495589_0016774 3300046794 Bacteria 3761
163 Ga0495589_0052103 3300046794 Bacteria 2022
164 Ga0495589_0111696 3300046794 Bacteria 1319
165 Ga0495600_0001809 3300046809 Bacteria 11969
166 Ga0495581_0057992 3300047315 Bacteria 2235
167 Ga0495581_0076992 3300047315 Bacteria 1930
168 Ga0495604_0001455 3300047317 Bacteria 19440
169 Ga0495604_0032849 3300047317 Bacteria 4110
170 Ga0495636_0000529 3300047318 Bacteria 14090
171 Ga0495636_0001309 3300047318 Bacteria 9437
172 Ga0495636_0036680 3300047318 Bacteria 2023
173 Ga0495674_0114618 3300047319 Bacteria 2282
174 Ga0495674_0216529 3300047319 Bacteria 1584
175 Ga0495676_0008568 3300047321 Bacteria 9368
176 Ga0495676_0019659 3300047321 Bacteria 5937
177 Ga0495676_0028563 3300047321 Bacteria 4760
178 Ga0495676_0054477 3300047321 Bacteria 3179
179 Ga0495683_0071535 3300047323 Bacteria 1702
180 Ga0495687_007507 3300047443 Bacteria 6409
181 Ga0495687_007974 3300047443 Bacteria 6144
182 Ga0495687_010361 3300047443 Bacteria 5117
183 Ga0495687_043608 3300047443 Bacteria 1953
184 Ga0495687_080628 3300047443 Bacteria 1276
185 Ga0495675_0028319 3300047444 Bacteria 3571
186 Ga0495675_0164197 3300047444 Bacteria 1366
187 Ga0495685_000792 3300047447 Bacteria 9700
188 Ga0495685_005232 3300047447 Bacteria 4224
189 Ga0495685_008984 3300047447 Bacteria 3332
190 Ga0495685_043574 3300047447 Bacteria 1531
191 Ga0495681_0001201 3300047470 Bacteria 19717
192 Ga0495681_0002456 3300047470 Bacteria 13224
193 Ga0495686_0022705 3300047472 Bacteria 4149
194 Ga0495593_0012072 3300047673 Bacteria 4950
195 Ga0495593_0023413 3300047673 Bacteria 3433
196 Ga0495602_0026146 3300048088 Bacteria 5635
197 Ga0495614_0009530 3300048089 Bacteria 4292
198 Ga0495614_0023717 3300048089 Bacteria 2648
199 Ga0496109_0084794 3300048912 Bacteria 2923
200 Ga0501031_0012569 3300049568 Bacteria 5530
201 Ga0501031_0088884 3300049568 Bacteria 2014
202 Ga0501032_0042034 3300049569 Bacteria 3102
203 Ga0501032_0094495 3300049569 Bacteria 1982
204 Ga0501032_0138372 3300049569 Bacteria 1604
205 Ga0501033_0020522 3300049570 Bacteria 4992
206 Ga0501033_0021585 3300049570 Bacteria 4858
207 Ga0501033_0099809 3300049570 Bacteria 2119
208 Ga0501033_0129409 3300049570 Bacteria 1829
209 Ga0501034_0003189 3300049571 Bacteria 18861
210 Ga0501034_0055034 3300049571 Bacteria 4004
211 Ga0501034_0073520 3300049571 Bacteria 3427
212 Ga0501034_0075557 3300049571 Bacteria 3376
213 Ga0501036_0052240 3300049572 Bacteria 3461
214 Ga0501036_0378390 3300049572 Bacteria 1182
215 Ga0501037_0005110 3300049573 Bacteria 9543
216 Ga0501038_0000997 3300049574 Bacteria 25475
217 Ga0501038_0055131 3300049574 Bacteria 3416
218 Ga0501038_0173762 3300049574 Bacteria 1742
219 Ga0501038_0234716 3300049574 Bacteria 1458
220 Ga0501038_0237678 3300049574 Bacteria 1447
221 Ga0501039_0006139 3300049575 Bacteria 9120
222 Ga0501039_0147620 3300049575 Bacteria 1848
223 Ga0501039_0180305 3300049575 Bacteria 1661
224 Ga0501042_0015665 3300049578 Bacteria 5192
225 Ga0501043_0018289 3300049579 Bacteria 5495
226 Ga0501043_0022931 3300049579 Bacteria 4894
227 Ga0501046_0009223 3300049580 Bacteria 8543
228 Ga0501046_0016050 3300049580 Bacteria 6279
229 Ga0501046_0036849 3300049580 Bacteria 3934
230 Ga0501047_0014084 3300049581 Bacteria 7599
231 Ga0501047_0032332 3300049581 Bacteria 5050
232 Ga0501047_0063874 3300049581 Bacteria 3551
233 Ga0501047_0066612 3300049581 Bacteria 3471
234 Ga0501047_0150292 3300049581 Bacteria 2205
235 Ga0501048_0274343 3300049582 Bacteria 1199
236 Ga0501070_0011591 3300049586 Bacteria 7444
237 Ga0501074_0006513 3300049590 Bacteria 8430
238 Ga0501080_0009372 3300049742 Bacteria 8929
239 Ga0501035_0019012 3300049822 Bacteria 6323
240 Ga0501035_0234521 3300049822 Bacteria 1563
241 Ga0501035_0247129 3300049822 Bacteria 1516
242 Ga0501044_0007487 3300049823 Bacteria 12007
243 Ga0501044_0017610 3300049823 Bacteria 7663
244 Ga0501044_0021560 3300049823 Bacteria 6870
245 Ga0501044_0156421 3300049823 Bacteria 2259
246 Ga0501044_0396854 3300049823 Bacteria 1292
247 Ga0501045_0144120 3300049824 Bacteria 1772
248 nmdc:mga0yw44_282777_c1 3300050492 Bacteria 1109
249 nmdc:mga06z11_39915_c1 3300050494 Bacteria 2339
250 Ga0495619_0113554 3300053085 Bacteria 1852
251 Ga0500578_0176654 3300053086 Bacteria 1317
252 Ga0500647_0146834 3300053091 Bacteria 1103
253 Ga0500566_0054197 3300053094 Bacteria 2287
254 Ga0500640_106709 3300053095 Bacteria 1147
255 Ga0500553_025344 3300053101 Bacteria 2991
256 Ga0500553_025593 3300053101 Bacteria 2977
257 Ga0500560_009373 3300053107 Bacteria 2404
258 Ga0500569_008952 3300053109 Bacteria 2309
259 Ga0500652_003347 3300053131 Bacteria 4857
260 Ga0500561_0006975 3300053137 Bacteria 2179
261 Ga0500573_0022380 3300053140 Bacteria 3628
262 Ga0500573_0075691 3300053140 Bacteria 1916
263 Ga0500600_0014107 3300053149 Bacteria 4859
264 Ga0500624_020747 3300053157 Bacteria 1055
265 Ga0500633_0001207 3300053160 Bacteria 4718
266 Ga0500634_0000815 3300053161 Bacteria 10937
267 Ga0500656_000639 3300053732 Bacteria 2701
268 2547406870 2547132111 Bacteria 8013147
269 2554258552 2554235005 Bacteria 6457341
270 2585304774 2582581313 Bacteria 10042643
271 2585319494 2582581314 Bacteria 11452267
272 2616700780 2616644814 Bacteria 11555299
273 2643944650 2643221587 Bacteria 7586415
274 2644263094 2643221647 Bacteria 10741251
275 2644385427 2643221670 Bacteria 6497041
276 2644431548 2643221677 Bacteria 7584031
277 2644436431 2643221678 Bacteria 9540101
278 2644625726 2643221714 Bacteria 9015452
279 2784587896 2784132148 Bacteria 8627943
280 2785344240 2784746763 Bacteria 9783172
281 2785368634 2784746768 Bacteria 10036182
282 2786669740 2786546132 Bacteria 10419719
283 2808841318 2808606359 Bacteria 9866990
284 2808919844 2808606375 Bacteria 9466072
285 2809231490 2808606448 Bacteria 8656184
286 2811848306 2808606982 Bacteria 7791042
287 2812358934 2811994879 Bacteria 9313447
288 2812481201 2811994917 Bacteria 7761064
289 2819693634 2818991463 Bacteria 7948711
290 2852642174 2852635781 Bacteria 8251373
291 2862184859 2862178590 Bacteria 8583590
292 2862288098 2862281513 Bacteria 9621493
293 2862291924 2862290372 Bacteria 7471434
294 2862509527 2862507626 Bacteria 9425308
295 2862579963 2862574272 Bacteria 10567477
296 2863405491 2863404153 Bacteria 9672205
297 2867348172 2867346516 Bacteria 7608576
298 2867371122 2867369537 Bacteria 6501581
299 2867434738 2867428634 Bacteria 9590268
300 2867479701 2867475112 Bacteria 6909112
301 2873156521 2873151551 Bacteria 8625867
302 2877681878 2877676314 Bacteria 9512378
303 2912720863 2912715099 Bacteria 9460473
304 2912724973 2912723979 Bacteria 8557534
305 2918503854 2918501144 Bacteria 8668083
306 2919468713 2919468124 Bacteria 9133025
307 2935392316 2935390628 Bacteria 7043367
308 2946066948 2946064051 Bacteria 8957905
309 2946075257 2946072368 Bacteria 8999607
310 2947230289 2947224130 Bacteria 9938529
311 2954003618 2954002825 Bacteria 9173742
312 2954387018 2954380949 Bacteria 10050426
313 2954676166 2954673503 Bacteria 9685905
314 2954688002 2954682443 Bacteria 9862841
315 2954697853 2954691527 Bacteria 10720516
316 2954704363 2954701450 Bacteria 10834262
317 2954716966 2954711539 Bacteria 10867210
318 2954726917 2954721474 Bacteria 10456478
319 2954734881 2954731030 Bacteria 10243860
320 2954745838 2954740390 Bacteria 10229294
321 2954753752 2954749733 Bacteria 10366972
322 2954764811 2954759201 Bacteria 9358192
323 2990064808 2990059506 Bacteria 9321252
324 2990089495 2990088156 Bacteria 6657676
325 2997456580 2997451912 Bacteria 8492419
326 3006321802 3006321560 Bacteria 8247479
327 3006396725 3006393351 Bacteria 6615579
328 3006487326 3006486233 Bacteria 8157040
329 3006501806 3006493962 Bacteria 8825450
330 8008559579 8008558824 Bacteria 10610750
331 8008579576 8008574985 Bacteria 7815457
332 8023629301 8023623736 Bacteria 8593882
333 8025482851 8025478263 Bacteria 8209203
334 8048409246 8048406513 Bacteria 8936924
335 8054165035 8054160619 Bacteria 7783213
336 8056833943 8056829672 Bacteria 9045328
337 Ga0495585_0057808
338 JGI24738J21930_10009128
339 rootH1_10018520
340 rootH2_10013096
341 rootH2_10109040
342 Ga0006562J51391_1057231
343 Ga0006562J51391_1064981
344 Ga0006562J51391_1064983
345 Ga0068853_100142960
346 Ga0105239_10257957
347 Ga0105246_10007872
348 Ga0157372_10332582
349 Ga0182008_10004161
350 Ga0182006_1025186
351 Ga0182007_10000752
352 Ga0183367_1006
353 Ga0213875_10036432
354 Ga0209758_1003326
355 Ga0207426_1002953
356 Ga0207647_10009427
357 Ga0207639_10126375
358 Ga0307517_10006097
359 Ga0307517_10006681
360 Ga0307515_10002026
361 Ga0307511_10000836
362 Ga0307511_10064694
363 Ga0307512_10046222
364 Ga0307513_10035496
365 Ga0307513_10137686
366 Ga0307509_10017584
367 Ga0307509_10021925
368 Ga0307508_10026669
369 Ga0307508_10263605
370 Ga0307514_10002400
371 Ga0307514_10062496
372 Ga0307516_10002619
373 Ga0307516_10015562
374 Ga0307516_10026125
375 Ga0307518_10045794
376 Ga0307518_10175801
377 Ga0307510_10003848
378 Ga0307510_10047058
379 Ga0395898_0003192
380 Ga0395898_0097258
381 Ga0436364_0260305
382 Ga0439436_0000414
383 Ga0439436_0001155
384 Ga0439436_0021465
385 Ga0439439_0003736
386 Ga0451853_2890701
387 Ga0439448_0002332
388 Ga0439449_0001059
389 Ga0439449_0007557
390 Ga0439455_0010192
391 Ga0439457_000463
392 Ga0439457_003792
393 Ga0439462_0007072
394 Ga0450894_000405
395 Ga0450899_000713
396 Ga0450903_000527
397 Ga0450903_016817
398 Ga0450906_001351
399 Ga0439458_0000156
400 Ga0466969_0045851
401 Ga0466972_0000475
402 Ga0466972_0051640
403 Ga0466972_0054685
404 Ga0466965_0014372
405 Ga0466965_0039516
406 Ga0466966_0010871
407 Ga0466961_0020216
408 Ga0466961_0026880
409 Ga0466961_0089355
410 Ga0466963_0001000
411 Ga0466963_0005720
412 Ga0466964_0013577
413 Ga0466964_0034726
414 Ga0466971_0008548
415 Ga0466968_0049713
416 Ga0466970_0002579
417 Ga0466970_0007775
418 Ga0466957_0088772
419 Ga0466960_0002156
420 Ga0466959_0135061
421 Ga0466958_0106965
422 Ga0466967_0002444
423 Ga0466967_0009362
424 Ga0466967_0028011
425 Ga0495592_0065868
426 Ga0495603_0007624
427 Ga0495603_0019578
428 Ga0495603_0055673
429 Ga0495603_0074138
430 Ga0495629_0011431
431 Ga0495629_0012407
432 Ga0495629_0017838
433 Ga0495629_0073952
434 Ga0495629_0139501
435 Ga0495629_0262690
436 Ga0495638_0006237
437 Ga0495651_0020277
438 Ga0495651_0096462
439 Ga0495605_0004974
440 Ga0495639_0035000
441 Ga0495662_0003140
442 Ga0495662_0091749
443 Ga0495664_0054601
444 Ga0495594_0032744
445 Ga0495594_0043262
446 Ga0495594_0068109
447 Ga0495607_0037821
448 Ga0495583_0013532
449 Ga0495583_0045356
450 Ga0495616_0024230
451 Ga0495618_0030476
452 Ga0495620_0009413
453 Ga0495628_0022075
454 Ga0495628_0022724
455 Ga0495628_0076402
456 Ga0495630_0040574
457 Ga0495631_0002860
458 Ga0495631_0086945
459 Ga0495632_0011025
460 Ga0495643_0003454
461 Ga0495648_0155793
462 Ga0495652_0140485
463 Ga0495654_0057682
464 Ga0495640_0006261
465 Ga0495640_0030476
466 Ga0495597_0025314
467 Ga0495645_0019517
468 Ga0495645_0134011
469 Ga0495622_0006488
470 Ga0495622_0027013
471 Ga0495668_0017528
472 Ga0495634_0000458
473 Ga0495634_0197185
474 Ga0495611_0054699
475 Ga0495625_0083783
476 Ga0495635_0033040
477 Ga0495635_0181061
478 Ga0495661_0041839
479 Ga0495588_0001743
480 Ga0495588_0008576
481 Ga0495588_0067262
482 Ga0495657_0001238
483 Ga0495657_0004276
484 Ga0495657_0022262
485 Ga0495657_0066857
486 Ga0495599_0100670
487 Ga0495646_0019384
488 Ga0495658_0012942
489 Ga0495613_0001161
490 Ga0495613_0015777
491 Ga0495613_0176200
492 Ga0495613_0211856
493 Ga0495670_0003216
494 Ga0495671_0005076
495 Ga0495649_0008700
496 Ga0495649_0059326
497 Ga0495649_0071362
498 Ga0495589_0016774
499 Ga0495589_0052103
500 Ga0495589_0111696
501 Ga0495600_0001809
502 Ga0495581_0057992
503 Ga0495581_0076992
504 Ga0495604_0001455
505 Ga0495604_0032849
506 Ga0495636_0000529
507 Ga0495636_0001309
508 Ga0495636_0036680
509 Ga0495674_0114618
510 Ga0495674_0216529
511 Ga0495676_0008568
512 Ga0495676_0019659
513 Ga0495676_0028563
514 Ga0495676_0054477
515 Ga0495683_0071535
516 Ga0495687_007507
517 Ga0495687_007974
518 Ga0495687_010361
519 Ga0495687_043608
520 Ga0495687_080628
521 Ga0495675_0028319
522 Ga0495675_0164197
523 Ga0495685_000792
524 Ga0495685_005232
525 Ga0495685_008984
526 Ga0495685_043574
527 Ga0495681_0001201
528 Ga0495681_0002456
529 Ga0495686_0022705
530 Ga0495593_0012072
531 Ga0495593_0023413
532 Ga0495602_0026146
533 Ga0495614_0009530
534 Ga0495614_0023717
535 Ga0496109_0084794
536 Ga0501031_0012569
537 Ga0501031_0088884
538 Ga0501032_0042034
539 Ga0501032_0094495
540 Ga0501032_0138372
541 Ga0501033_0020522
542 Ga0501033_0021585
543 Ga0501033_0099809
544 Ga0501033_0129409
545 Ga0501034_0003189
546 Ga0501034_0055034
547 Ga0501034_0073520
548 Ga0501034_0075557
549 Ga0501036_0052240
550 Ga0501036_0378390
551 Ga0501037_0005110
552 Ga0501038_0000997
553 Ga0501038_0055131
554 Ga0501038_0173762
555 Ga0501038_0234716
556 Ga0501038_0237678
557 Ga0501039_0006139
558 Ga0501039_0147620
559 Ga0501039_0180305
560 Ga0501042_0015665
561 Ga0501043_0018289
562 Ga0501043_0022931
563 Ga0501046_0009223
564 Ga0501046_0016050
565 Ga0501046_0036849
566 Ga0501047_0014084
567 Ga0501047_0032332
568 Ga0501047_0063874
569 Ga0501047_0066612
570 Ga0501047_0150292
571 Ga0501048_0274343
572 Ga0501070_0011591
573 Ga0501074_0006513
574 Ga0501080_0009372
575 Ga0501035_0019012
576 Ga0501035_0234521
577 Ga0501035_0247129
578 Ga0501044_0007487
579 Ga0501044_0017610
580 Ga0501044_0021560
581 Ga0501044_0156421
582 Ga0501044_0396854
583 Ga0501045_0144120
584 nmdc:mga0yw44_282777_c1
585 nmdc:mga06z11_39915_c1
586 Ga0495619_0113554
587 Ga0500578_0176654
588 Ga0500647_0146834
589 Ga0500566_0054197
590 Ga0500640_106709
591 Ga0500553_025344
592 Ga0500553_025593
593 Ga0500560_009373
594 Ga0500569_008952
595 Ga0500652_003347
596 Ga0500561_0006975
597 Ga0500573_0022380
598 Ga0500573_0075691
599 Ga0500600_0014107
600 Ga0500624_020747
601 Ga0500633_0001207
602 Ga0500634_0000815
603 Ga0500656_000639
604 2547406870
605 2554258552
606 2585304774
607 2585319494
608 2616700780
609 2643944650
610 2644263094
611 2644385427
612 2644431548
613 2644436431
614 2644625726
615 2784587896
616 2785344240
617 2785368634
618 2786669740
619 2808841318
620 2808919844
621 2809231490
622 2811848306
623 2812358934
624 2812481201
625 2819693634
626 2852642174
627 2862184859
628 2862288098
629 2862291924
630 2862509527
631 2862579963
632 2863405491
633 2867348172
634 2867371122
635 2867434738
636 2867479701
637 2873156521
638 2877681878
639 2912720863
640 2912724973
641 2918503854
642 2919468713
643 2935392316
644 2946066948
645 2946075257
646 2947230289
647 2954003618
648 2954387018
649 2954676166
650 2954688002
651 2954697853
652 2954704363
653 2954716966
654 2954726917
655 2954734881
656 2954745838
657 2954753752
658 2954764811
659 2990064808
660 2990089495
661 2997456580
662 3006321802
663 3006396725
664 3006487326
665 3006501806
666 8008559579
667 8008579576
668 8023629301
669 8025482851
670 8048409246
671 8054165035
672 8056833943

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3r3p-assembly1.cif.gz_B homing endonuclease i-bth0305i catalytic domain 0.7787 232 334
3r3p-assembly1.cif.gz_B homing endonuclease i-bth0305i catalytic domain 0.7381 232 334
6n7p-assembly1.cif.gz_X s. cerevisiae spliceosomal e complex (ubc4) 0.7231 168 244
3d7i-assembly1.cif.gz_B crystal structure of carboxymuconolactone decarboxylase family protein possibly involved in oxygen detoxification (1591455) from methanococcus jannaschii at 1.75 a resolution 0.6739 167 224
3hrl-assembly1.cif.gz_A crystal structure of a putative endonuclease-like protein (ngo0050) from neisseria gonorrhoeae 0.618 232 336
ID Description Score Start End Superfamily
af_O69681_193_292_3.40.960.10 Alpha Beta;3-Layer(aba) Sandwich;Endonuclease; Chain A;VSR Endonuclease 0.8718 233 333 3.40.960.10
af_O69681_193_292_3.40.960.10 Alpha Beta;3-Layer(aba) Sandwich;Endonuclease; Chain A;VSR Endonuclease 0.8318 233 333 3.40.960.10
af_P96837_192_278_3.40.960.10 Alpha Beta;3-Layer(aba) Sandwich;Endonuclease; Chain A;VSR Endonuclease 0.8104 241 326 3.40.960.10
af_P96837_192_278_3.40.960.10 Alpha Beta;3-Layer(aba) Sandwich;Endonuclease; Chain A;VSR Endonuclease 0.7787 241 326 3.40.960.10
af_P45736_13_113_3.40.960.10 Alpha Beta;3-Layer(aba) Sandwich;Endonuclease; Chain A;VSR Endonuclease 0.7752 232 333 3.40.960.10
ID Description Score Start End GO Terms
AF-A0A6I5GS20-F1-model_v4 DUF559 domain-containing protein 0.983 170 348
AF-A0A6G3SEK3-F1-model_v4 DUF559 domain-containing protein 0.9773 189 348
AF-A0A6I5GS20-F1-model_v4 DUF559 domain-containing protein 0.9722 170 348
AF-A0A6G3PU78-F1-model_v4 Uncharacterized protein 0.9627 100 187 GO:0016020
AF-H0BJ54-F1-model_v4 DUF559 domain-containing protein 0.9614 220 348

Map