F412787

General Info

Members Datasets Scaffolds Average Seq Length
336 173 640 135

Family's Representative Sequence

Representative Sequence 3300046491|Ga0495584_0315958|Ga0495584_0315958_217_693
Length 158
Sequence MNMKKLWATAAIAASVAGISATAAPQALAIGDDGGTTSVSGYGATQSFGNSATYGSMSPQMALIQGSLNKPCVGLPAKANVGSLVGVVPIAVQDVPVLSAPQNQQCVENSTQAKGDEPLSHILDDIPVLSGNGIGNKYHFSRRRAAEFSAARRPAFFT

Samples

Sample ID Description Type Environment
1 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
2 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
3 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
4 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
5 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
6 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
7 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
8 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
9 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
10 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
11 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
12 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
13 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
14 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
15 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
16 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
17 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
18 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
19 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
20 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
21 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
22 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
23 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
24 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
25 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
26 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
27 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
28 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
29 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
30 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
31 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
32 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
33 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
34 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
35 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
36 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
37 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
38 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
39 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
40 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
41 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
42 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
43 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
44 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
45 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
46 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
47 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
48 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
49 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
50 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
51 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
52 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
53 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
54 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
55 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
56 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
57 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
58 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
59 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
60 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
61 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
62 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
63 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
64 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
65 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
66 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
67 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
68 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
69 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
70 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
71 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
72 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
73 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
74 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
75 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
76 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
77 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
78 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
79 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
80 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
81 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
82 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
83 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
84 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
85 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
86 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
87 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
88 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
89 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
90 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
91 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
92 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
93 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
94 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
95 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
96 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
97 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
98 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
99 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
100 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
101 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
102 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
103 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
104 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
105 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
106 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
107 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
108 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
109 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
110 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
111 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
112 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
113 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
125 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
126 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
128 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
129 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
130 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
131 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
132 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
133 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
134 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
135 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
136 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
137 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
138 2643221578 Streptomyces sp. Root63 Isolate Unclassified
139 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
140 2643221647 Streptomyces sp. Root369 Isolate Unclassified
141 2643221670 Streptomyces sp. Root431 Isolate Unclassified
142 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
143 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
144 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
145 2643221714 Streptomyces sp. Root264 Isolate Unclassified
146 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
147 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
148 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
149 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
150 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
151 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
152 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
153 2862574272 Streptomyces sp. AcE210 Isolate Nodule
154 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
155 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
156 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
157 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
158 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
159 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
160 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
161 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
162 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
163 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
164 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
165 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
166 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
167 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
168 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
169 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
170 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
171 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
172 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
173 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 83.33
Metatranscriptomes 0.6
Isolates 16.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.68
Nodule 1.19
Rhizoplane 0
Rhizosphere 81.55
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495584_0315958 3300046491 Bacteria 793
2 Ga0006562J51391_1127928 3300003578 Bacteria 2820
3 Ga0105244_10391171 3300009036 Bacteria 640
4 Ga0105250_10096046 3300009092 Bacteria 1208
5 Ga0105239_11741841 3300010375 Bacteria 721
6 Ga0105239_11801872 3300010375 Bacteria 709
7 Ga0157375_11557017 3300013308 Bacteria 781
8 Ga0207707_11280314 3300025912 Bacteria 590
9 Ga0307517_10007273 3300028786 Bacteria 16188
10 Ga0307515_10099029 3300028794 Bacteria 3543
11 Ga0307515_10124521 3300028794 Bacteria 2891
12 Ga0307515_10145789 3300028794 Bacteria 2508
13 Ga0307515_10292853 3300028794 Bacteria 1321
14 Ga0307511_10001030 3300030521 Bacteria 29611
15 Ga0307511_10083245 3300030521 Bacteria 2230
16 Ga0307512_10037317 3300030522 Bacteria 4106
17 Ga0307512_10126134 3300030522 Bacteria 1624
18 Ga0307513_10021069 3300031456 Bacteria 7704
19 Ga0307513_10200135 3300031456 Bacteria 1839
20 Ga0307513_10239145 3300031456 Bacteria 1622
21 Ga0307509_10160573 3300031507 Bacteria 2146
22 Ga0307509_10189588 3300031507 Bacteria 1909
23 Ga0307514_10041211 3300031649 Bacteria 3636
24 Ga0307514_10051583 3300031649 Bacteria 3186
25 Ga0307514_10548257 3300031649 Bacteria 534
26 Ga0307516_10670579 3300031730 Bacteria 693
27 Ga0307507_10018227 3300033179 Bacteria 7996
28 Ga0307510_10085041 3300033180 Bacteria 3042
29 Ga0307510_10119671 3300033180 Bacteria 2342
30 Ga0395898_0004140 3300037466 Bacteria 15900
31 Ga0439436_0045882 3300041404 Bacteria 1242
32 Ga0451841_0353970 3300041498 Bacteria 589
33 Ga0451853_0871024 3300041512 Bacteria 713
34 Ga0450894_008332 3300042131 Bacteria 1340
35 Ga0450896_004387 3300042133 Bacteria 1912
36 Ga0450898_012926 3300042134 Bacteria 1385
37 Ga0450898_065056 3300042134 Bacteria 722
38 Ga0450899_004910 3300042135 Bacteria 1433
39 Ga0450904_012023 3300042139 Bacteria 857
40 Ga0450906_004533 3300042145 Bacteria 2902
41 Ga0450908_010258 3300042184 Bacteria 1731
42 Ga0495617_237909 3300046452 Bacteria 563
43 Ga0495592_0013746 3300046454 Bacteria 6156
44 Ga0495592_0039591 3300046454 Bacteria 3540
45 Ga0495592_0043231 3300046454 Bacteria 3371
46 Ga0495603_0000181 3300046455 Bacteria 32499
47 Ga0495603_0023823 3300046455 Bacteria 3703
48 Ga0495603_0148796 3300046455 Bacteria 1360
49 Ga0495590_0018466 3300046457 Bacteria 2497
50 Ga0495590_0223120 3300046457 Bacteria 696
51 Ga0495629_0001163 3300046459 Bacteria 20753
52 Ga0495629_0001494 3300046459 Bacteria 18381
53 Ga0495629_0030497 3300046459 Bacteria 3822
54 Ga0495629_0044835 3300046459 Bacteria 3103
55 Ga0495629_0110409 3300046459 Bacteria 1917
56 Ga0495638_0043704 3300046460 Bacteria 2825
57 Ga0495638_0127171 3300046460 Bacteria 1501
58 Ga0495638_0258312 3300046460 Bacteria 957
59 Ga0495641_0307368 3300046461 Bacteria 715
60 Ga0495651_0007316 3300046462 Bacteria 8441
61 Ga0495651_0041054 3300046462 Bacteria 3595
62 Ga0495653_0584910 3300046463 Bacteria 688
63 Ga0495582_0053384 3300046473 Bacteria 2229
64 Ga0495605_0008870 3300046474 Bacteria 5669
65 Ga0495605_0339526 3300046474 Bacteria 631
66 Ga0495662_0003344 3300046476 Bacteria 8130
67 Ga0495662_0005024 3300046476 Bacteria 6627
68 Ga0495662_0077476 3300046476 Bacteria 1615
69 Ga0495662_0368355 3300046476 Bacteria 706
70 Ga0495662_0379346 3300046476 Bacteria 694
71 Ga0495664_0001858 3300046477 Bacteria 11221
72 Ga0495664_0032455 3300046477 Bacteria 3064
73 Ga0495664_0235955 3300046477 Bacteria 1106
74 Ga0495585_0018841 3300046492 Bacteria 3982
75 Ga0495585_0087103 3300046492 Bacteria 1686
76 Ga0495594_0029506 3300046499 Bacteria 2965
77 Ga0495594_0230715 3300046499 Bacteria 1055
78 Ga0495594_0287696 3300046499 Bacteria 936
79 Ga0495594_0621778 3300046499 Bacteria 612
80 Ga0495596_0154765 3300046500 Bacteria 890
81 Ga0495607_0195269 3300046501 Bacteria 1005
82 Ga0495583_0051027 3300046506 Bacteria 1887
83 Ga0495583_0074746 3300046506 Bacteria 1482
84 Ga0495606_0024397 3300046507 Bacteria 4358
85 Ga0495606_0148388 3300046507 Bacteria 1378
86 Ga0495608_0237192 3300046511 Bacteria 1140
87 Ga0495610_0005526 3300046512 Bacteria 8955
88 Ga0495618_0174405 3300046514 Bacteria 1367
89 Ga0495618_0227148 3300046514 Bacteria 1176
90 Ga0495620_0029171 3300046515 Bacteria 2556
91 Ga0495620_0037091 3300046515 Bacteria 2174
92 Ga0495620_0216892 3300046515 Bacteria 733
93 Ga0495628_0024231 3300046516 Bacteria 4969
94 Ga0495628_0072815 3300046516 Bacteria 2677
95 Ga0495628_0916859 3300046516 Bacteria 607
96 Ga0495630_0148678 3300046517 Bacteria 1782
97 Ga0495630_0517564 3300046517 Bacteria 915
98 Ga0495631_0059763 3300046518 Bacteria 1655
99 Ga0495632_0322546 3300046519 Bacteria 682
100 Ga0495637_0235012 3300046520 Bacteria 663
101 Ga0495643_0084530 3300046522 Bacteria 1646
102 Ga0495643_0174999 3300046522 Bacteria 1046
103 Ga0495644_0192951 3300046523 Bacteria 784
104 Ga0495648_0059216 3300046524 Bacteria 2286
105 Ga0495666_0078248 3300046526 Bacteria 1566
106 Ga0495666_0227867 3300046526 Bacteria 852
107 Ga0495642_0350569 3300046528 Bacteria 649
108 Ga0495652_0009093 3300046529 Bacteria 9041
109 Ga0495652_0067139 3300046529 Bacteria 3007
110 Ga0495652_0117899 3300046529 Bacteria 2122
111 Ga0495640_0001089 3300046533 Bacteria 21151
112 Ga0495640_0017990 3300046533 Bacteria 5255
113 Ga0495640_0028380 3300046533 Bacteria 4031
114 Ga0495586_0011099 3300046535 Bacteria 4787
115 Ga0495587_0017736 3300046536 Bacteria 4419
116 Ga0495587_0459335 3300046536 Bacteria 705
117 Ga0495609_0351599 3300046538 Bacteria 594
118 Ga0495597_0025519 3300046542 Bacteria 2720
119 Ga0495597_0183847 3300046542 Bacteria 843
120 Ga0495645_0062362 3300046543 Bacteria 2700
121 Ga0495645_0765499 3300046543 Bacteria 582
122 Ga0495622_0006318 3300046557 Bacteria 5500
123 Ga0495622_0026684 3300046557 Bacteria 2696
124 Ga0495633_0222676 3300046558 Bacteria 863
125 Ga0495667_0023724 3300046559 Bacteria 4133
126 Ga0495667_0103307 3300046559 Bacteria 1843
127 Ga0495668_0003405 3300046616 Bacteria 11943
128 Ga0495668_0082765 3300046616 Bacteria 1760
129 Ga0495668_0365693 3300046616 Bacteria 792
130 Ga0495634_0028131 3300046642 Bacteria 3904
131 Ga0495634_0168271 3300046642 Bacteria 1378
132 Ga0495634_0415360 3300046642 Bacteria 797
133 Ga0495611_0029450 3300046648 Bacteria 2408
134 Ga0495611_0053664 3300046648 Bacteria 1820
135 Ga0495611_0088115 3300046648 Bacteria 1432
136 Ga0495611_0108455 3300046648 Bacteria 1291
137 Ga0495625_0030331 3300046660 Bacteria 4037
138 Ga0495625_0036888 3300046660 Bacteria 3589
139 Ga0495625_0070628 3300046660 Bacteria 2452
140 Ga0495625_0209586 3300046660 Bacteria 1281
141 Ga0495625_0223535 3300046660 Bacteria 1232
142 Ga0495635_0005170 3300046663 Bacteria 9085
143 Ga0495661_0281515 3300046665 Bacteria 838
144 Ga0495588_0159996 3300046674 Bacteria 1191
145 Ga0495588_0423906 3300046674 Bacteria 698
146 Ga0495657_0021689 3300046675 Bacteria 4607
147 Ga0495657_0062355 3300046675 Bacteria 2463
148 Ga0495657_0155810 3300046675 Bacteria 1416
149 Ga0495657_0272051 3300046675 Bacteria 1015
150 Ga0495599_0820061 3300046678 Bacteria 531
151 Ga0495623_0285810 3300046679 Bacteria 916
152 Ga0495623_0439238 3300046679 Bacteria 696
153 Ga0495646_0000193 3300046680 Bacteria 30232
154 Ga0495658_0100602 3300046683 Bacteria 1725
155 Ga0495613_0001151 3300046689 Bacteria 20195
156 Ga0495613_0001764 3300046689 Bacteria 16472
157 Ga0495613_0018845 3300046689 Bacteria 5143
158 Ga0495613_0025226 3300046689 Bacteria 4430
159 Ga0495613_0054379 3300046689 Bacteria 2943
160 Ga0495613_0183770 3300046689 Bacteria 1480
161 Ga0495613_0363147 3300046689 Bacteria 992
162 Ga0495613_0396695 3300046689 Bacteria 941
163 Ga0495613_0945105 3300046689 Bacteria 556
164 Ga0495624_0028509 3300046690 Bacteria 3648
165 Ga0495624_0108642 3300046690 Bacteria 1706
166 Ga0495624_0339115 3300046690 Bacteria 904
167 Ga0495670_0037016 3300046691 Bacteria 2432
168 Ga0495671_0073324 3300046692 Bacteria 1680
169 Ga0495671_0108716 3300046692 Bacteria 1354
170 Ga0495649_0057922 3300046694 Bacteria 2088
171 Ga0495649_0247866 3300046694 Bacteria 915
172 Ga0495649_0579140 3300046694 Bacteria 554
173 Ga0495589_0003838 3300046794 Bacteria 8077
174 Ga0495589_0022153 3300046794 Bacteria 3244
175 Ga0495589_0049883 3300046794 Bacteria 2071
176 Ga0495600_0017469 3300046809 Bacteria 4564
177 Ga0495600_0021748 3300046809 Bacteria 4112
178 Ga0495600_0300267 3300046809 Bacteria 1013
179 Ga0495660_0091829 3300046810 Bacteria 1576
180 Ga0495660_0176562 3300046810 Bacteria 1036
181 Ga0495581_0003104 3300047315 Bacteria 9511
182 Ga0495581_0018103 3300047315 Bacteria 4091
183 Ga0495581_0105223 3300047315 Bacteria 1640
184 Ga0495604_0002665 3300047317 Bacteria 14333
185 Ga0495604_0003315 3300047317 Bacteria 12841
186 Ga0495604_0015822 3300047317 Bacteria 6021
187 Ga0495636_0003984 3300047318 Bacteria 5769
188 Ga0495636_0007744 3300047318 Bacteria 4227
189 Ga0495636_0016990 3300047318 Bacteria 2910
190 Ga0495636_0039430 3300047318 Bacteria 1956
191 Ga0495674_0661401 3300047319 Bacteria 823
192 Ga0495672_0289926 3300047320 Bacteria 779
193 Ga0495676_0000441 3300047321 Bacteria 33865
194 Ga0495676_0002420 3300047321 Bacteria 16567
195 Ga0495676_0018733 3300047321 Bacteria 6102
196 Ga0495676_0026202 3300047321 Bacteria 5021
197 Ga0495676_0029918 3300047321 Bacteria 4629
198 Ga0495676_0392766 3300047321 Bacteria 922
199 Ga0495676_0557824 3300047321 Bacteria 748
200 Ga0495680_0021317 3300047322 Bacteria 5425
201 Ga0495683_0175557 3300047323 Bacteria 982
202 Ga0495683_0181619 3300047323 Bacteria 960
203 Ga0495687_001148 3300047443 Bacteria 25640
204 Ga0495687_032162 3300047443 Bacteria 2398
205 Ga0495687_161342 3300047443 Bacteria 753
206 Ga0495675_0004168 3300047444 Bacteria 8745
207 Ga0495675_0500472 3300047444 Bacteria 698
208 Ga0495679_112568 3300047446 Bacteria 748
209 Ga0495685_007508 3300047447 Bacteria 3602
210 Ga0495685_008636 3300047447 Bacteria 3390
211 Ga0495685_027780 3300047447 Bacteria 1946
212 Ga0495685_034885 3300047447 Bacteria 1728
213 Ga0495673_0172741 3300047469 Bacteria 823
214 Ga0495681_0001712 3300047470 Bacteria 16221
215 Ga0495681_0209527 3300047470 Bacteria 786
216 Ga0495684_0048081 3300047471 Bacteria 3262
217 Ga0495593_0004095 3300047673 Bacteria 8669
218 Ga0495593_0087376 3300047673 Bacteria 1607
219 Ga0495593_0303370 3300047673 Bacteria 798
220 Ga0495602_0027041 3300048088 Bacteria 5524
221 Ga0495602_0158915 3300048088 Bacteria 1767
222 Ga0495614_0022466 3300048089 Bacteria 2722
223 Ga0495614_0031876 3300048089 Bacteria 2268
224 Ga0495614_0053730 3300048089 Bacteria 1727
225 Ga0495614_0079817 3300048089 Bacteria 1417
226 Ga0495614_0107650 3300048089 Bacteria 1222
227 Ga0495626_0022556 3300048091 Bacteria 3107
228 Ga0496122_0350547 3300048925 Bacteria 771
229 Ga0495678_091732 3300049459 Bacteria 1068
230 Ga0495678_131629 3300049459 Bacteria 828
231 Ga0501031_0071399 3300049568 Bacteria 2261
232 Ga0501031_0120869 3300049568 Bacteria 1711
233 Ga0501032_0013512 3300049569 Bacteria 5805
234 Ga0501032_0154198 3300049569 Bacteria 1509
235 Ga0501033_0449301 3300049570 Bacteria 895
236 Ga0501034_0020992 3300049571 Bacteria 6666
237 Ga0501034_0050969 3300049571 Bacteria 4174
238 Ga0501034_0124135 3300049571 Bacteria 2567
239 Ga0501037_0070986 3300049573 Bacteria 2533
240 Ga0501038_0371635 3300049574 Bacteria 1110
241 Ga0501038_0515163 3300049574 Bacteria 913
242 Ga0501042_0064694 3300049578 Bacteria 2614
243 Ga0501043_0027030 3300049579 Bacteria 4504
244 Ga0501043_1021607 3300049579 Bacteria 587
245 Ga0501046_0252226 3300049580 Bacteria 1298
246 Ga0501046_0327628 3300049580 Bacteria 1115
247 Ga0501047_0064508 3300049581 Bacteria 3532
248 Ga0501048_0005068 3300049582 Bacteria 10039
249 Ga0501070_0647766 3300049586 Bacteria 839
250 Ga0501073_0433973 3300049589 Bacteria 908
251 Ga0501035_0004463 3300049822 Bacteria 13278
252 Ga0501035_0012092 3300049822 Bacteria 7979
253 Ga0501044_0007026 3300049823 Bacteria 12391
254 Ga0501044_0201355 3300049823 Bacteria 1949
255 Ga0501044_0273665 3300049823 Bacteria 1623
256 Ga0501044_0792156 3300049823 Bacteria 828
257 Ga0500610_0142454 3300053079 Bacteria 1209
258 Ga0500640_014943 3300053095 Bacteria 3239
259 Ga0500650_0451040 3300053098 Bacteria 551
260 Ga0500553_263347 3300053101 Bacteria 511
261 Ga0500614_162078 3300053123 Bacteria 678
262 Ga0500618_092359 3300053125 Bacteria 680
263 Ga0500600_0058034 3300053149 Bacteria 2169
264 Ga0500600_0253266 3300053149 Bacteria 787
265 Ga0500565_022406 3300053734 Bacteria 771
266 Ga0587076_033071 3300059645 Bacteria 928
267 2616902713 2616644941 Bacteria 8510691
268 2643904042 2643221578 Bacteria 9213798
269 2643941723 2643221587 Bacteria 7586415
270 2643941726 2643221587 Bacteria 7586415
271 2644263197 2643221647 Bacteria 10741251
272 2644386501 2643221670 Bacteria 6497041
273 2644386504 2643221670 Bacteria 6497041
274 2644402396 2643221673 Bacteria 9196637
275 2644428806 2643221677 Bacteria 7584031
276 2644428809 2643221677 Bacteria 7584031
277 2644436508 2643221678 Bacteria 9540101
278 2644625647 2643221714 Bacteria 9015452
279 2644625648 2643221714 Bacteria 9015452
280 2785368725 2784746768 Bacteria 10036182
281 2785368726 2784746768 Bacteria 10036182
282 2804847144 2802429296 Bacteria 7227771
283 2808841397 2808606359 Bacteria 9866990
284 2819699863 2818991463 Bacteria 7948711
285 2819699868 2818991463 Bacteria 7948711
286 2862180172 2862178590 Bacteria 8583590
287 2862290627 2862290372 Bacteria 7471434
288 2862290628 2862290372 Bacteria 7471434
289 2862290629 2862290372 Bacteria 7471434
290 2862383468 2862382967 Bacteria 10317375
291 2862578552 2862574272 Bacteria 10567477
292 2862578553 2862574272 Bacteria 10567477
293 2875397471 2875391855 Bacteria 7600475
294 2912724900 2912723979 Bacteria 8557534
295 2912760560 2912757875 Bacteria 7940295
296 2912760561 2912757875 Bacteria 7940295
297 2912760562 2912757875 Bacteria 7940295
298 2918506101 2918501144 Bacteria 8668083
299 2918506104 2918501144 Bacteria 8668083
300 2919468791 2919468124 Bacteria 9133025
301 2935392505 2935390628 Bacteria 7043367
302 2946047037 2946045630 Bacteria 8527308
303 2946075332 2946072368 Bacteria 8999607
304 2954676262 2954673503 Bacteria 9685905
305 2954687907 2954682443 Bacteria 9862841
306 2966600051 2966598605 Bacteria 7676064
307 2966600056 2966598605 Bacteria 7676064
308 3006325573 3006321560 Bacteria 8247479
309 3006394191 3006393351 Bacteria 6615579
310 3006394192 3006393351 Bacteria 6615579
311 8008559654 8008558824 Bacteria 10610750
312 8025414386 8025413630 Bacteria 7014048
313 8025536567 8025530807 Bacteria 8495698
314 8025536569 8025530807 Bacteria 8495698
315 8048409322 8048406513 Bacteria 8936924
316 8048409323 8048406513 Bacteria 8936924
317 8054161345 8054160619 Bacteria 7783213
318 8056451835 8056447290 Bacteria 7680491
319 8056451836 8056447290 Bacteria 7680491
320 8056672660 8056667051 Bacteria 6953971
321 Ga0495584_0315958
322 Ga0006562J51391_1127928
323 Ga0105244_10391171
324 Ga0105250_10096046
325 Ga0105239_11741841
326 Ga0105239_11801872
327 Ga0157375_11557017
328 Ga0207707_11280314
329 Ga0307517_10007273
330 Ga0307515_10099029
331 Ga0307515_10124521
332 Ga0307515_10145789
333 Ga0307515_10292853
334 Ga0307511_10001030
335 Ga0307511_10083245
336 Ga0307512_10037317
337 Ga0307512_10126134
338 Ga0307513_10021069
339 Ga0307513_10200135
340 Ga0307513_10239145
341 Ga0307509_10160573
342 Ga0307509_10189588
343 Ga0307514_10041211
344 Ga0307514_10051583
345 Ga0307514_10548257
346 Ga0307516_10670579
347 Ga0307507_10018227
348 Ga0307510_10085041
349 Ga0307510_10119671
350 Ga0395898_0004140
351 Ga0439436_0045882
352 Ga0451841_0353970
353 Ga0451853_0871024
354 Ga0450894_008332
355 Ga0450896_004387
356 Ga0450898_012926
357 Ga0450898_065056
358 Ga0450899_004910
359 Ga0450904_012023
360 Ga0450906_004533
361 Ga0450908_010258
362 Ga0495617_237909
363 Ga0495592_0013746
364 Ga0495592_0039591
365 Ga0495592_0043231
366 Ga0495603_0000181
367 Ga0495603_0023823
368 Ga0495603_0148796
369 Ga0495590_0018466
370 Ga0495590_0223120
371 Ga0495629_0001163
372 Ga0495629_0001494
373 Ga0495629_0030497
374 Ga0495629_0044835
375 Ga0495629_0110409
376 Ga0495638_0043704
377 Ga0495638_0127171
378 Ga0495638_0258312
379 Ga0495641_0307368
380 Ga0495651_0007316
381 Ga0495651_0041054
382 Ga0495653_0584910
383 Ga0495582_0053384
384 Ga0495605_0008870
385 Ga0495605_0339526
386 Ga0495662_0003344
387 Ga0495662_0005024
388 Ga0495662_0077476
389 Ga0495662_0368355
390 Ga0495662_0379346
391 Ga0495664_0001858
392 Ga0495664_0032455
393 Ga0495664_0235955
394 Ga0495585_0018841
395 Ga0495585_0087103
396 Ga0495594_0029506
397 Ga0495594_0230715
398 Ga0495594_0287696
399 Ga0495594_0621778
400 Ga0495596_0154765
401 Ga0495607_0195269
402 Ga0495583_0051027
403 Ga0495583_0074746
404 Ga0495606_0024397
405 Ga0495606_0148388
406 Ga0495608_0237192
407 Ga0495610_0005526
408 Ga0495618_0174405
409 Ga0495618_0227148
410 Ga0495620_0029171
411 Ga0495620_0037091
412 Ga0495620_0216892
413 Ga0495628_0024231
414 Ga0495628_0072815
415 Ga0495628_0916859
416 Ga0495630_0148678
417 Ga0495630_0517564
418 Ga0495631_0059763
419 Ga0495632_0322546
420 Ga0495637_0235012
421 Ga0495643_0084530
422 Ga0495643_0174999
423 Ga0495644_0192951
424 Ga0495648_0059216
425 Ga0495666_0078248
426 Ga0495666_0227867
427 Ga0495642_0350569
428 Ga0495652_0009093
429 Ga0495652_0067139
430 Ga0495652_0117899
431 Ga0495640_0001089
432 Ga0495640_0017990
433 Ga0495640_0028380
434 Ga0495586_0011099
435 Ga0495587_0017736
436 Ga0495587_0459335
437 Ga0495609_0351599
438 Ga0495597_0025519
439 Ga0495597_0183847
440 Ga0495645_0062362
441 Ga0495645_0765499
442 Ga0495622_0006318
443 Ga0495622_0026684
444 Ga0495633_0222676
445 Ga0495667_0023724
446 Ga0495667_0103307
447 Ga0495668_0003405
448 Ga0495668_0082765
449 Ga0495668_0365693
450 Ga0495634_0028131
451 Ga0495634_0168271
452 Ga0495634_0415360
453 Ga0495611_0029450
454 Ga0495611_0053664
455 Ga0495611_0088115
456 Ga0495611_0108455
457 Ga0495625_0030331
458 Ga0495625_0036888
459 Ga0495625_0070628
460 Ga0495625_0209586
461 Ga0495625_0223535
462 Ga0495635_0005170
463 Ga0495661_0281515
464 Ga0495588_0159996
465 Ga0495588_0423906
466 Ga0495657_0021689
467 Ga0495657_0062355
468 Ga0495657_0155810
469 Ga0495657_0272051
470 Ga0495599_0820061
471 Ga0495623_0285810
472 Ga0495623_0439238
473 Ga0495646_0000193
474 Ga0495658_0100602
475 Ga0495613_0001151
476 Ga0495613_0001764
477 Ga0495613_0018845
478 Ga0495613_0025226
479 Ga0495613_0054379
480 Ga0495613_0183770
481 Ga0495613_0363147
482 Ga0495613_0396695
483 Ga0495613_0945105
484 Ga0495624_0028509
485 Ga0495624_0108642
486 Ga0495624_0339115
487 Ga0495670_0037016
488 Ga0495671_0073324
489 Ga0495671_0108716
490 Ga0495649_0057922
491 Ga0495649_0247866
492 Ga0495649_0579140
493 Ga0495589_0003838
494 Ga0495589_0022153
495 Ga0495589_0049883
496 Ga0495600_0017469
497 Ga0495600_0021748
498 Ga0495600_0300267
499 Ga0495660_0091829
500 Ga0495660_0176562
501 Ga0495581_0003104
502 Ga0495581_0018103
503 Ga0495581_0105223
504 Ga0495604_0002665
505 Ga0495604_0003315
506 Ga0495604_0015822
507 Ga0495636_0003984
508 Ga0495636_0007744
509 Ga0495636_0016990
510 Ga0495636_0039430
511 Ga0495674_0661401
512 Ga0495672_0289926
513 Ga0495676_0000441
514 Ga0495676_0002420
515 Ga0495676_0018733
516 Ga0495676_0026202
517 Ga0495676_0029918
518 Ga0495676_0392766
519 Ga0495676_0557824
520 Ga0495680_0021317
521 Ga0495683_0175557
522 Ga0495683_0181619
523 Ga0495687_001148
524 Ga0495687_032162
525 Ga0495687_161342
526 Ga0495675_0004168
527 Ga0495675_0500472
528 Ga0495679_112568
529 Ga0495685_007508
530 Ga0495685_008636
531 Ga0495685_027780
532 Ga0495685_034885
533 Ga0495673_0172741
534 Ga0495681_0001712
535 Ga0495681_0209527
536 Ga0495684_0048081
537 Ga0495593_0004095
538 Ga0495593_0087376
539 Ga0495593_0303370
540 Ga0495602_0027041
541 Ga0495602_0158915
542 Ga0495614_0022466
543 Ga0495614_0031876
544 Ga0495614_0053730
545 Ga0495614_0079817
546 Ga0495614_0107650
547 Ga0495626_0022556
548 Ga0496122_0350547
549 Ga0495678_091732
550 Ga0495678_131629
551 Ga0501031_0071399
552 Ga0501031_0120869
553 Ga0501032_0013512
554 Ga0501032_0154198
555 Ga0501033_0449301
556 Ga0501034_0020992
557 Ga0501034_0050969
558 Ga0501034_0124135
559 Ga0501037_0070986
560 Ga0501038_0371635
561 Ga0501038_0515163
562 Ga0501042_0064694
563 Ga0501043_0027030
564 Ga0501043_1021607
565 Ga0501046_0252226
566 Ga0501046_0327628
567 Ga0501047_0064508
568 Ga0501048_0005068
569 Ga0501070_0647766
570 Ga0501073_0433973
571 Ga0501035_0004463
572 Ga0501035_0012092
573 Ga0501044_0007026
574 Ga0501044_0201355
575 Ga0501044_0273665
576 Ga0501044_0792156
577 Ga0500610_0142454
578 Ga0500640_014943
579 Ga0500650_0451040
580 Ga0500553_263347
581 Ga0500614_162078
582 Ga0500618_092359
583 Ga0500600_0058034
584 Ga0500600_0253266
585 Ga0500565_022406
586 Ga0587076_033071
587 2616902713
588 2643904042
589 2643941723
590 2643941726
591 2644263197
592 2644386501
593 2644386504
594 2644402396
595 2644428806
596 2644428809
597 2644436508
598 2644625647
599 2644625648
600 2785368725
601 2785368726
602 2804847144
603 2808841397
604 2819699863
605 2819699868
606 2862180172
607 2862290627
608 2862290628
609 2862290629
610 2862383468
611 2862578552
612 2862578553
613 2875397471
614 2912724900
615 2912760560
616 2912760561
617 2912760562
618 2918506101
619 2918506104
620 2919468791
621 2935392505
622 2946047037
623 2946075332
624 2954676262
625 2954687907
626 2966600051
627 2966600056
628 3006325573
629 3006394191
630 3006394192
631 8008559654
632 8025414386
633 8025536567
634 8025536569
635 8048409322
636 8048409323
637 8054161345
638 8056451835
639 8056451836
640 8056672660

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map