F412675

General Info

Members Datasets Scaffolds Average Seq Length
336 150 672 222

Family's Representative Sequence

Representative Sequence 3300014325|Ga0163163_10177942|Ga0163163_101779421
Length 237
Sequence MTQPLIVFDMDGVLVDVTESYRETIVQTVKHFTGIDVTREQIQDYKNQGGWNDDWKLSHHIITTAGTEVPFETVKDYFQSIFLGSNPSRDDAEGAVSSPALILRERWIARPGALEELNRQFQFAIFTGRPKADAELTLNRHANGVVFDPLIGMDDVEHHKPHPEGLLRILEDNPGRKVYYIGDTVDDARCARAAKVPFIGIAAPSNPRYIDLVFLFQEEGAYAIVDDINFLQEVFAA

Samples

Sample ID Description Type Environment
1 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
40 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
64 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
99 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
100 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
101 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
102 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
103 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
104 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
105 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
106 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
107 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
108 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
109 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
110 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
111 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
112 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
113 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
114 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
115 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
116 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
117 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
118 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
119 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
120 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
121 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
122 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
123 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
124 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
125 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
126 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
127 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
128 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
129 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
130 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
131 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
132 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
133 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
134 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
135 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
136 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
137 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
138 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
139 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
140 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
141 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
142 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
143 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
144 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
145 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
146 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
149 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
150 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.3
Rhizosphere 98.51
Stem 0
Stem Tuber 0
Unclassified 8.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163163_10177942 3300014325 Bacteria 2174
2 Ga0070658_10009861 3300005327 Bacteria 7674
3 Ga0070683_100000019 3300005329 Bacteria 192076
4 Ga0070683_100020370 3300005329 Bacteria 5903
5 Ga0070683_100084842 3300005329 Bacteria 2968
6 Ga0068869_100326754 3300005334 Bacteria 1245
7 Ga0070666_10016581 3300005335 Bacteria 4714
8 Ga0070682_100304548 3300005337 Bacteria 1171
9 Ga0068868_100011009 3300005338 Bacteria 6572
10 Ga0068868_100168497 3300005338 Bacteria 1812
11 Ga0068868_100169117 3300005338 Bacteria 1809
12 Ga0068868_100362413 3300005338 Bacteria 1244
13 Ga0070660_100007244 3300005339 Bacteria 7720
14 Ga0070660_100321016 3300005339 Unclassified 1272
15 Ga0070689_100103768 3300005340 Bacteria 2254
16 Ga0070671_100036440 3300005355 Bacteria 4080
17 Ga0070673_100412767 3300005364 Bacteria 1209
18 Ga0070673_100451962 3300005364 Bacteria 1156
19 Ga0070667_100013784 3300005367 Bacteria 6683
20 Ga0070667_100150934 3300005367 Bacteria 2041
21 Ga0070709_10089005 3300005434 Bacteria 2032
22 Ga0070714_100035658 3300005435 Bacteria 4169
23 Ga0070713_100011179 3300005436 Bacteria 6527
24 Ga0070713_100015164 3300005436 Bacteria 5747
25 Ga0070711_100078403 3300005439 Unclassified 2347
26 Ga0070678_100449759 3300005456 Bacteria 1128
27 Ga0070681_10242180 3300005458 Bacteria 1717
28 Ga0068867_100009631 3300005459 Bacteria 6813
29 Ga0070707_100501100 3300005468 Unclassified 1176
30 Ga0070679_100109888 3300005530 Bacteria 2743
31 Ga0070679_100381764 3300005530 Bacteria 1356
32 Ga0070679_100464670 3300005530 Bacteria 1210
33 Ga0070684_100000003 3300005535 Bacteria 248527
34 Ga0070684_100019954 3300005535 Bacteria 5556
35 Ga0070684_100072416 3300005535 Bacteria 3034
36 Ga0068853_100608720 3300005539 Bacteria 1038
37 Ga0070672_100791730 3300005543 Unclassified 834
38 Ga0070686_100438830 3300005544 Bacteria 1001
39 Ga0070665_100098208 3300005548 Bacteria 2933
40 Ga0070665_100322912 3300005548 Bacteria 1548
41 Ga0068855_100003676 3300005563 Bacteria 18764
42 Ga0068855_100017587 3300005563 Bacteria 8598
43 Ga0068855_100159886 3300005563 Bacteria 2557
44 Ga0068855_100167864 3300005563 Bacteria 2487
45 Ga0068855_100963561 3300005563 Unclassified 898
46 Ga0068857_100009431 3300005577 Bacteria 8471
47 Ga0068857_100027469 3300005577 Bacteria 5021
48 Ga0068857_100835408 3300005577 Bacteria 881
49 Ga0068856_100027118 3300005614 Bacteria 5588
50 Ga0068856_101249099 3300005614 Unclassified 759
51 Ga0068852_100603881 3300005616 Bacteria 1102
52 Ga0068852_101072804 3300005616 Bacteria 825
53 Ga0068859_100057516 3300005617 Bacteria 3917
54 Ga0068859_100273637 3300005617 Bacteria 1781
55 Ga0068859_100341431 3300005617 Bacteria 1592
56 Ga0068864_100172999 3300005618 Bacteria 1970
57 Ga0068864_100570359 3300005618 Bacteria 1096
58 Ga0068863_100040835 3300005841 Bacteria 4411
59 Ga0068863_100241139 3300005841 Bacteria 1745
60 Ga0068863_100402678 3300005841 Bacteria 1339
61 Ga0068863_100445890 3300005841 Bacteria 1270
62 Ga0068863_100762389 3300005841 Bacteria 964
63 Ga0068858_100060055 3300005842 Bacteria 3514
64 Ga0068858_100073787 3300005842 Bacteria 3167
65 Ga0068858_100085909 3300005842 Bacteria 2927
66 Ga0068858_100518830 3300005842 Bacteria 1152
67 Ga0068860_100008416 3300005843 Bacteria 10275
68 Ga0068860_100660028 3300005843 Bacteria 1054
69 Ga0070717_10002297 3300006028 Bacteria 13414
70 Ga0070717_10059120 3300006028 Bacteria 3171
71 Ga0070717_10196043 3300006028 Bacteria 1767
72 Ga0097621_100077141 3300006237 Bacteria 2766
73 Ga0097621_100087349 3300006237 Bacteria 2603
74 Ga0097621_100119889 3300006237 Bacteria 2230
75 Ga0097621_100269114 3300006237 Bacteria 1497
76 Ga0097621_100592453 3300006237 Bacteria 1013
77 Ga0068871_100086558 3300006358 Bacteria 2604
78 Ga0068871_100169618 3300006358 Bacteria 1870
79 Ga0068871_100252561 3300006358 Bacteria 1536
80 Ga0068871_100291030 3300006358 Bacteria 1431
81 Ga0068871_100362770 3300006358 Unclassified 1283
82 Ga0068871_100637664 3300006358 Bacteria 972
83 Ga0068871_100870072 3300006358 Unclassified 834
84 Ga0068865_100036885 3300006881 Bacteria 3298
85 Ga0075436_100237649 3300006914 Bacteria 1295
86 Ga0097620_100057515 3300006931 Bacteria 3917
87 Ga0097620_100273616 3300006931 Bacteria 1781
88 Ga0097620_100341445 3300006931 Bacteria 1592
89 Ga0099795_10134849 3300007788 Bacteria 999
90 Ga0105240_10006267 3300009093 Bacteria 17501
91 Ga0105240_10008603 3300009093 Bacteria 14585
92 Ga0105240_10040838 3300009093 Bacteria 5928
93 Ga0105240_10659215 3300009093 Unclassified 1146
94 Ga0105240_11125400 3300009093 Bacteria 834
95 Ga0111539_10941976 3300009094 Bacteria 1004
96 Ga0105245_10122005 3300009098 Bacteria 2436
97 Ga0105245_10192564 3300009098 Bacteria 1954
98 Ga0105245_10404827 3300009098 Bacteria 1364
99 Ga0105247_10036932 3300009101 Bacteria 2979
100 Ga0105247_10081730 3300009101 Bacteria 2038
101 Ga0105243_10581719 3300009148 Bacteria 1075
102 Ga0105241_10011127 3300009174 Bacteria 6598
103 Ga0105241_10024793 3300009174 Bacteria 4456
104 Ga0105241_10081489 3300009174 Bacteria 2535
105 Ga0105241_10098267 3300009174 Bacteria 2322
106 Ga0105241_10313364 3300009174 Bacteria 1350
107 Ga0105242_10055620 3300009176 Bacteria 3237
108 Ga0105242_10057510 3300009176 Bacteria 3185
109 Ga0105242_10151285 3300009176 Bacteria 2023
110 Ga0105242_10586317 3300009176 Bacteria 1075
111 Ga0105242_10828056 3300009176 Bacteria 919
112 Ga0105248_10058795 3300009177 Bacteria 4317
113 Ga0105248_10203511 3300009177 Bacteria 2231
114 Ga0105248_10286608 3300009177 Unclassified 1854
115 Ga0105248_10492837 3300009177 Bacteria 1381
116 Ga0105248_10538761 3300009177 Bacteria 1317
117 Ga0105248_11245955 3300009177 Unclassified 841
118 Ga0105237_10015643 3300009545 Bacteria 7886
119 Ga0105237_10076113 3300009545 Bacteria 3347
120 Ga0105237_10187993 3300009545 Bacteria 2065
121 Ga0105237_10454956 3300009545 Bacteria 1286
122 Ga0105238_10003531 3300009551 Bacteria 15586
123 Ga0105238_10038115 3300009551 Bacteria 4883
124 Ga0105238_10087883 3300009551 Bacteria 3095
125 Ga0105238_10243629 3300009551 Bacteria 1775
126 Ga0105238_10348781 3300009551 Bacteria 1469
127 Ga0105238_10703257 3300009551 Bacteria 1023
128 Ga0105239_10009505 3300010375 Bacteria 10949
129 Ga0105239_10019116 3300010375 Bacteria 7571
130 Ga0105239_10061846 3300010375 Bacteria 4110
131 Ga0105239_10207941 3300010375 Bacteria 2193
132 Ga0105239_10261509 3300010375 Bacteria 1945
133 Ga0105239_10882543 3300010375 Bacteria 1026
134 Ga0157370_10023653 3300013104 Bacteria 6097
135 Ga0157370_10056344 3300013104 Bacteria 3741
136 Ga0157370_10596265 3300013104 Bacteria 1012
137 Ga0157369_10070995 3300013105 Bacteria 3740
138 Ga0157369_10704894 3300013105 Bacteria 1039
139 Ga0157374_10019090 3300013296 Bacteria 6066
140 Ga0157374_10300801 3300013296 Bacteria 1587
141 Ga0157374_10352378 3300013296 Bacteria 1463
142 Ga0157374_10379973 3300013296 Bacteria 1407
143 Ga0157374_10651195 3300013296 Bacteria 1065
144 Ga0157374_10919924 3300013296 Bacteria 892
145 Ga0157378_10119552 3300013297 Bacteria 2426
146 Ga0157378_10234682 3300013297 Bacteria 1750
147 Ga0163162_10009244 3300013306 Bacteria 9589
148 Ga0163162_10863922 3300013306 Bacteria 1019
149 Ga0157372_10050147 3300013307 Bacteria 4644
150 Ga0157372_10836239 3300013307 Bacteria 1069
151 Ga0157375_10117140 3300013308 Bacteria 2769
152 Ga0157375_10234102 3300013308 Unclassified 1996
153 Ga0157375_10544344 3300013308 Bacteria 1323
154 Ga0163163_10033602 3300014325 Bacteria 4963
155 Ga0163163_10149270 3300014325 Bacteria 2382
156 Ga0157379_10295103 3300014968 Bacteria 1477
157 Ga0157376_10010690 3300014969 Bacteria 6729
158 Ga0157376_10329497 3300014969 Bacteria 1454
159 Ga0157376_10335680 3300014969 Bacteria 1442
160 Ga0157376_10820175 3300014969 Bacteria 944
161 Ga0213875_10002769 3300021388 Bacteria 10348
162 Ga0207680_10025159 3300025903 Bacteria 3280
163 Ga0207705_10009074 3300025909 Bacteria 7247
164 Ga0207654_10006651 3300025911 Bacteria 5817
165 Ga0207654_10007778 3300025911 Bacteria 5409
166 Ga0207654_10040135 3300025911 Bacteria 2636
167 Ga0207654_10124212 3300025911 Bacteria 1625
168 Ga0207654_10367929 3300025911 Unclassified 993
169 Ga0207707_10023281 3300025912 Bacteria 5420
170 Ga0207707_10329259 3300025912 Bacteria 1318
171 Ga0207695_10009314 3300025913 Bacteria 12156
172 Ga0207695_10012024 3300025913 Bacteria 10411
173 Ga0207695_10022417 3300025913 Bacteria 7168
174 Ga0207695_10231354 3300025913 Unclassified 1753
175 Ga0207695_10257919 3300025913 Bacteria 1642
176 Ga0207695_10446056 3300025913 Bacteria 1177
177 Ga0207671_10050419 3300025914 Bacteria 3082
178 Ga0207671_10092867 3300025914 Bacteria 2276
179 Ga0207663_10119570 3300025916 Bacteria 1801
180 Ga0207660_10187192 3300025917 Bacteria 1610
181 Ga0207657_10007163 3300025919 Bacteria 11456
182 Ga0207657_10251649 3300025919 Bacteria 1408
183 Ga0207652_10080761 3300025921 Bacteria 2843
184 Ga0207652_10152073 3300025921 Bacteria 2073
185 Ga0207694_10007880 3300025924 Bacteria 8064
186 Ga0207694_10137183 3300025924 Bacteria 1965
187 Ga0207694_10202221 3300025924 Bacteria 1616
188 Ga0207694_10443154 3300025924 Bacteria 1084
189 Ga0207687_10123152 3300025927 Bacteria 1942
190 Ga0207687_10285094 3300025927 Bacteria 1325
191 Ga0207700_10041486 3300025928 Bacteria 3367
192 Ga0207664_10027284 3300025929 Bacteria 4327
193 Ga0207644_10186239 3300025931 Bacteria 1630
194 Ga0207686_10002620 3300025934 Bacteria 9761
195 Ga0207686_10005323 3300025934 Bacteria 6900
196 Ga0207686_10150612 3300025934 Bacteria 1619
197 Ga0207670_10197890 3300025936 Unclassified 1525
198 Ga0207704_10004043 3300025938 Bacteria 6681
199 Ga0207711_10058775 3300025941 Bacteria 3310
200 Ga0207711_10062940 3300025941 Bacteria 3202
201 Ga0207711_10221658 3300025941 Bacteria 1730
202 Ga0207711_10279665 3300025941 Bacteria 1537
203 Ga0207711_10595504 3300025941 Unclassified 1031
204 Ga0207661_10000019 3300025944 Bacteria 235900
205 Ga0207661_10016246 3300025944 Bacteria 5490
206 Ga0207661_10116924 3300025944 Bacteria 2264
207 Ga0207667_10008741 3300025949 Bacteria 12005
208 Ga0207667_10042580 3300025949 Bacteria 4825
209 Ga0207651_10362484 3300025960 Bacteria 1224
210 Ga0207651_10451614 3300025960 Bacteria 1103
211 Ga0207658_10023883 3300025986 Bacteria 4272
212 Ga0207658_10124428 3300025986 Bacteria 2061
213 Ga0207677_10071862 3300026023 Bacteria 2444
214 Ga0207677_10095049 3300026023 Bacteria 2177
215 Ga0207677_10136941 3300026023 Bacteria 1868
216 Ga0207703_10009334 3300026035 Bacteria 7710
217 Ga0207703_10049412 3300026035 Bacteria 3400
218 Ga0207703_10588511 3300026035 Unclassified 1052
219 Ga0207702_10055899 3300026078 Bacteria 3349
220 Ga0207641_10011885 3300026088 Bacteria 7142
221 Ga0207641_10104285 3300026088 Bacteria 2503
222 Ga0207641_10942816 3300026088 Bacteria 858
223 Ga0207648_10010408 3300026089 Bacteria 8817
224 Ga0207648_10607793 3300026089 Unclassified 1008
225 Ga0207676_10066179 3300026095 Bacteria 2881
226 Ga0207674_10035376 3300026116 Bacteria 5212
227 Ga0207674_10049847 3300026116 Bacteria 4280
228 Ga0207674_10065120 3300026116 Bacteria 3674
229 Ga0207683_10295213 3300026121 Bacteria 1482
230 Ga0207698_10501183 3300026142 Unclassified 1182
231 Ga0268266_10137433 3300028379 Bacteria 2190
232 Ga0268266_10390811 3300028379 Bacteria 1314
233 Ga0268266_10462230 3300028379 Bacteria 1207
234 Ga0268264_10648659 3300028381 Bacteria 1045
235 Ga0265323_10001994 3300028653 Bacteria 9627
236 Ga0265338_10137740 3300028800 Bacteria 1916
237 Ga0265338_10288633 3300028800 Bacteria 1196
238 Ga0265316_10001368 3300031344 Bacteria 26263
239 Ga0265316_10001444 3300031344 Bacteria 25507
240 Ga0265316_10015592 3300031344 Bacteria 6636
241 Ga0265316_10096343 3300031344 Bacteria 2253
242 Ga0265316_10098003 3300031344 Bacteria 2231
243 Ga0265316_10107762 3300031344 Bacteria 2112
244 Ga0265316_10121654 3300031344 Bacteria 1971
245 Ga0265314_10000961 3300031711 Bacteria 33842
246 Ga0265342_10081911 3300031712 Bacteria 1863
247 Ga0373945_0085100 3300035116 Bacteria 1217
248 Ga0373953_0330169 3300035117 Unclassified 667
249 Ga0373954_0040567 3300035118 Bacteria 2168
250 Ga0373943_0283820 3300035170 Bacteria 937
251 Ga0373946_0126233 3300035171 Bacteria 1173
252 Ga0373924_0253038 3300035410 Unclassified 780
253 Ga0373935_0024229 3300035692 Bacteria 3734
254 Ga0373935_0072866 3300035692 Bacteria 2218
255 Ga0373927_0003057 3300035695 Bacteria 12130
256 Ga0373927_0042674 3300035695 Bacteria 2939
257 Ga0373927_0142094 3300035695 Unclassified 1570
258 Ga0373927_0199419 3300035695 Bacteria 1314
259 Ga0373927_0213174 3300035695 Bacteria 1269
260 Ga0373933_0183833 3300035724 Bacteria 1334
261 Ga0373947_0094174 3300035725 Bacteria 1873
262 Ga0373937_0002483 3300036401 Bacteria 15327
263 Ga0373937_0017647 3300036401 Bacteria 6366
264 Ga0373937_0305457 3300036401 Bacteria 1504
265 Ga0373937_0387906 3300036401 Bacteria 1325
266 Ga0373937_0747664 3300036401 Bacteria 925
267 Ga0373925_0160195 3300037068 Bacteria 1772
268 Ga0373925_0252685 3300037068 Unclassified 1414
269 Ga0373925_0720078 3300037068 Unclassified 823
270 Ga0373925_0783406 3300037068 Bacteria 786
271 Ga0436364_0298586 3300037853 Bacteria 4338
272 Ga0436364_0601301 3300037853 Bacteria 2825
273 Ga0436364_0674901 3300037853 Bacteria 3046
274 Ga0451576_0315981 3300045051 Bacteria 1634
275 Ga0466958_0399900 3300045836 Bacteria 887
276 Ga0495592_0007448 3300046454 Bacteria 8201
277 Ga0495651_0002965 3300046462 Bacteria 13114
278 Ga0495651_0088324 3300046462 Bacteria 2329
279 Ga0495651_0138111 3300046462 Bacteria 1771
280 Ga0495580_0008890 3300046472 Bacteria 7945
281 Ga0495580_0014096 3300046472 Bacteria 6077
282 Ga0495580_0022101 3300046472 Bacteria 4687
283 Ga0495580_0471922 3300046472 Bacteria 840
284 Ga0495664_0009577 3300046477 Bacteria 5421
285 Ga0495664_0087302 3300046477 Bacteria 1874
286 Ga0495664_0288709 3300046477 Bacteria 991
287 Ga0495608_0101924 3300046511 Bacteria 1850
288 Ga0495618_0073542 3300046514 Bacteria 2176
289 Ga0495628_0003543 3300046516 Bacteria 13988
290 Ga0495628_0037795 3300046516 Bacteria 3869
291 Ga0495630_0158788 3300046517 Bacteria 1721
292 Ga0495652_0035490 3300046529 Bacteria 4340
293 Ga0495640_0055783 3300046533 Bacteria 2702
294 Ga0495640_0336482 3300046533 Unclassified 933
295 Ga0495587_0049255 3300046536 Bacteria 2494
296 Ga0495587_0050535 3300046536 Bacteria 2460
297 Ga0495645_0026454 3300046543 Bacteria 4211
298 Ga0495645_0194484 3300046543 Bacteria 1380
299 Ga0495645_0416089 3300046543 Unclassified 854
300 Ga0495667_0024961 3300046559 Bacteria 4027
301 Ga0495667_0028374 3300046559 Bacteria 3769
302 Ga0495667_0081241 3300046559 Bacteria 2107
303 Ga0495634_0144394 3300046642 Bacteria 1508
304 Ga0495635_0033154 3300046663 Bacteria 3582
305 Ga0495657_0221840 3300046675 Bacteria 1146
306 Ga0495599_0004028 3300046678 Bacteria 8650
307 Ga0495599_0063543 3300046678 Bacteria 2307
308 Ga0495599_0139866 3300046678 Bacteria 1502
309 Ga0495623_0117696 3300046679 Bacteria 1604
310 Ga0495623_0191783 3300046679 Bacteria 1180
311 Ga0495646_0049670 3300046680 Bacteria 2545
312 Ga0495613_0161235 3300046689 Bacteria 1595
313 Ga0495613_0310402 3300046689 Bacteria 1090
314 Ga0495613_0388730 3300046689 Bacteria 953
315 Ga0495600_0111257 3300046809 Bacteria 1783
316 Ga0495604_0060748 3300047317 Bacteria 2893
317 Ga0495674_0118201 3300047319 Bacteria 2242
318 Ga0495674_0159847 3300047319 Bacteria 1885
319 Ga0495674_0331648 3300047319 Bacteria 1238
320 Ga0495680_0077929 3300047322 Bacteria 2509
321 Ga0495675_0110228 3300047444 Bacteria 1718
322 Ga0495675_0168925 3300047444 Unclassified 1344
323 Ga0495684_0005866 3300047471 Bacteria 9545
324 Ga0495684_0021869 3300047471 Bacteria 4924
325 Ga0495684_0246229 3300047471 Bacteria 1302
326 Ga0495684_0251796 3300047471 Unclassified 1285
327 Ga0495684_0261838 3300047471 Bacteria 1254
328 Ga0495602_0043456 3300048088 Bacteria 4085
329 Ga0495602_0073508 3300048088 Bacteria 2910
330 Ga0495602_0237082 3300048088 Bacteria 1367
331 Ga0496115_0190661 3300048918 Bacteria 1694
332 Ga0501040_0181138 3300049576 Bacteria 1494
333 Ga0501041_0282815 3300049577 Bacteria 1044
334 Ga0501044_0720085 3300049823 Bacteria 882
335 nmdc:mga08x19_92391_c1 3300050514 Bacteria 1999
336 Ga0501082_0000199 3300060353 Bacteria 52195
337 Ga0163163_10177942
338 Ga0070658_10009861
339 Ga0070683_100000019
340 Ga0070683_100020370
341 Ga0070683_100084842
342 Ga0068869_100326754
343 Ga0070666_10016581
344 Ga0070682_100304548
345 Ga0068868_100011009
346 Ga0068868_100168497
347 Ga0068868_100169117
348 Ga0068868_100362413
349 Ga0070660_100007244
350 Ga0070660_100321016
351 Ga0070689_100103768
352 Ga0070671_100036440
353 Ga0070673_100412767
354 Ga0070673_100451962
355 Ga0070667_100013784
356 Ga0070667_100150934
357 Ga0070709_10089005
358 Ga0070714_100035658
359 Ga0070713_100011179
360 Ga0070713_100015164
361 Ga0070711_100078403
362 Ga0070678_100449759
363 Ga0070681_10242180
364 Ga0068867_100009631
365 Ga0070707_100501100
366 Ga0070679_100109888
367 Ga0070679_100381764
368 Ga0070679_100464670
369 Ga0070684_100000003
370 Ga0070684_100019954
371 Ga0070684_100072416
372 Ga0068853_100608720
373 Ga0070672_100791730
374 Ga0070686_100438830
375 Ga0070665_100098208
376 Ga0070665_100322912
377 Ga0068855_100003676
378 Ga0068855_100017587
379 Ga0068855_100159886
380 Ga0068855_100167864
381 Ga0068855_100963561
382 Ga0068857_100009431
383 Ga0068857_100027469
384 Ga0068857_100835408
385 Ga0068856_100027118
386 Ga0068856_101249099
387 Ga0068852_100603881
388 Ga0068852_101072804
389 Ga0068859_100057516
390 Ga0068859_100273637
391 Ga0068859_100341431
392 Ga0068864_100172999
393 Ga0068864_100570359
394 Ga0068863_100040835
395 Ga0068863_100241139
396 Ga0068863_100402678
397 Ga0068863_100445890
398 Ga0068863_100762389
399 Ga0068858_100060055
400 Ga0068858_100073787
401 Ga0068858_100085909
402 Ga0068858_100518830
403 Ga0068860_100008416
404 Ga0068860_100660028
405 Ga0070717_10002297
406 Ga0070717_10059120
407 Ga0070717_10196043
408 Ga0097621_100077141
409 Ga0097621_100087349
410 Ga0097621_100119889
411 Ga0097621_100269114
412 Ga0097621_100592453
413 Ga0068871_100086558
414 Ga0068871_100169618
415 Ga0068871_100252561
416 Ga0068871_100291030
417 Ga0068871_100362770
418 Ga0068871_100637664
419 Ga0068871_100870072
420 Ga0068865_100036885
421 Ga0075436_100237649
422 Ga0097620_100057515
423 Ga0097620_100273616
424 Ga0097620_100341445
425 Ga0099795_10134849
426 Ga0105240_10006267
427 Ga0105240_10008603
428 Ga0105240_10040838
429 Ga0105240_10659215
430 Ga0105240_11125400
431 Ga0111539_10941976
432 Ga0105245_10122005
433 Ga0105245_10192564
434 Ga0105245_10404827
435 Ga0105247_10036932
436 Ga0105247_10081730
437 Ga0105243_10581719
438 Ga0105241_10011127
439 Ga0105241_10024793
440 Ga0105241_10081489
441 Ga0105241_10098267
442 Ga0105241_10313364
443 Ga0105242_10055620
444 Ga0105242_10057510
445 Ga0105242_10151285
446 Ga0105242_10586317
447 Ga0105242_10828056
448 Ga0105248_10058795
449 Ga0105248_10203511
450 Ga0105248_10286608
451 Ga0105248_10492837
452 Ga0105248_10538761
453 Ga0105248_11245955
454 Ga0105237_10015643
455 Ga0105237_10076113
456 Ga0105237_10187993
457 Ga0105237_10454956
458 Ga0105238_10003531
459 Ga0105238_10038115
460 Ga0105238_10087883
461 Ga0105238_10243629
462 Ga0105238_10348781
463 Ga0105238_10703257
464 Ga0105239_10009505
465 Ga0105239_10019116
466 Ga0105239_10061846
467 Ga0105239_10207941
468 Ga0105239_10261509
469 Ga0105239_10882543
470 Ga0157370_10023653
471 Ga0157370_10056344
472 Ga0157370_10596265
473 Ga0157369_10070995
474 Ga0157369_10704894
475 Ga0157374_10019090
476 Ga0157374_10300801
477 Ga0157374_10352378
478 Ga0157374_10379973
479 Ga0157374_10651195
480 Ga0157374_10919924
481 Ga0157378_10119552
482 Ga0157378_10234682
483 Ga0163162_10009244
484 Ga0163162_10863922
485 Ga0157372_10050147
486 Ga0157372_10836239
487 Ga0157375_10117140
488 Ga0157375_10234102
489 Ga0157375_10544344
490 Ga0163163_10033602
491 Ga0163163_10149270
492 Ga0157379_10295103
493 Ga0157376_10010690
494 Ga0157376_10329497
495 Ga0157376_10335680
496 Ga0157376_10820175
497 Ga0213875_10002769
498 Ga0207680_10025159
499 Ga0207705_10009074
500 Ga0207654_10006651
501 Ga0207654_10007778
502 Ga0207654_10040135
503 Ga0207654_10124212
504 Ga0207654_10367929
505 Ga0207707_10023281
506 Ga0207707_10329259
507 Ga0207695_10009314
508 Ga0207695_10012024
509 Ga0207695_10022417
510 Ga0207695_10231354
511 Ga0207695_10257919
512 Ga0207695_10446056
513 Ga0207671_10050419
514 Ga0207671_10092867
515 Ga0207663_10119570
516 Ga0207660_10187192
517 Ga0207657_10007163
518 Ga0207657_10251649
519 Ga0207652_10080761
520 Ga0207652_10152073
521 Ga0207694_10007880
522 Ga0207694_10137183
523 Ga0207694_10202221
524 Ga0207694_10443154
525 Ga0207687_10123152
526 Ga0207687_10285094
527 Ga0207700_10041486
528 Ga0207664_10027284
529 Ga0207644_10186239
530 Ga0207686_10002620
531 Ga0207686_10005323
532 Ga0207686_10150612
533 Ga0207670_10197890
534 Ga0207704_10004043
535 Ga0207711_10058775
536 Ga0207711_10062940
537 Ga0207711_10221658
538 Ga0207711_10279665
539 Ga0207711_10595504
540 Ga0207661_10000019
541 Ga0207661_10016246
542 Ga0207661_10116924
543 Ga0207667_10008741
544 Ga0207667_10042580
545 Ga0207651_10362484
546 Ga0207651_10451614
547 Ga0207658_10023883
548 Ga0207658_10124428
549 Ga0207677_10071862
550 Ga0207677_10095049
551 Ga0207677_10136941
552 Ga0207703_10009334
553 Ga0207703_10049412
554 Ga0207703_10588511
555 Ga0207702_10055899
556 Ga0207641_10011885
557 Ga0207641_10104285
558 Ga0207641_10942816
559 Ga0207648_10010408
560 Ga0207648_10607793
561 Ga0207676_10066179
562 Ga0207674_10035376
563 Ga0207674_10049847
564 Ga0207674_10065120
565 Ga0207683_10295213
566 Ga0207698_10501183
567 Ga0268266_10137433
568 Ga0268266_10390811
569 Ga0268266_10462230
570 Ga0268264_10648659
571 Ga0265323_10001994
572 Ga0265338_10137740
573 Ga0265338_10288633
574 Ga0265316_10001368
575 Ga0265316_10001444
576 Ga0265316_10015592
577 Ga0265316_10096343
578 Ga0265316_10098003
579 Ga0265316_10107762
580 Ga0265316_10121654
581 Ga0265314_10000961
582 Ga0265342_10081911
583 Ga0373945_0085100
584 Ga0373953_0330169
585 Ga0373954_0040567
586 Ga0373943_0283820
587 Ga0373946_0126233
588 Ga0373924_0253038
589 Ga0373935_0024229
590 Ga0373935_0072866
591 Ga0373927_0003057
592 Ga0373927_0042674
593 Ga0373927_0142094
594 Ga0373927_0199419
595 Ga0373927_0213174
596 Ga0373933_0183833
597 Ga0373947_0094174
598 Ga0373937_0002483
599 Ga0373937_0017647
600 Ga0373937_0305457
601 Ga0373937_0387906
602 Ga0373937_0747664
603 Ga0373925_0160195
604 Ga0373925_0252685
605 Ga0373925_0720078
606 Ga0373925_0783406
607 Ga0436364_0298586
608 Ga0436364_0601301
609 Ga0436364_0674901
610 Ga0451576_0315981
611 Ga0466958_0399900
612 Ga0495592_0007448
613 Ga0495651_0002965
614 Ga0495651_0088324
615 Ga0495651_0138111
616 Ga0495580_0008890
617 Ga0495580_0014096
618 Ga0495580_0022101
619 Ga0495580_0471922
620 Ga0495664_0009577
621 Ga0495664_0087302
622 Ga0495664_0288709
623 Ga0495608_0101924
624 Ga0495618_0073542
625 Ga0495628_0003543
626 Ga0495628_0037795
627 Ga0495630_0158788
628 Ga0495652_0035490
629 Ga0495640_0055783
630 Ga0495640_0336482
631 Ga0495587_0049255
632 Ga0495587_0050535
633 Ga0495645_0026454
634 Ga0495645_0194484
635 Ga0495645_0416089
636 Ga0495667_0024961
637 Ga0495667_0028374
638 Ga0495667_0081241
639 Ga0495634_0144394
640 Ga0495635_0033154
641 Ga0495657_0221840
642 Ga0495599_0004028
643 Ga0495599_0063543
644 Ga0495599_0139866
645 Ga0495623_0117696
646 Ga0495623_0191783
647 Ga0495646_0049670
648 Ga0495613_0161235
649 Ga0495613_0310402
650 Ga0495613_0388730
651 Ga0495600_0111257
652 Ga0495604_0060748
653 Ga0495674_0118201
654 Ga0495674_0159847
655 Ga0495674_0331648
656 Ga0495680_0077929
657 Ga0495675_0110228
658 Ga0495675_0168925
659 Ga0495684_0005866
660 Ga0495684_0021869
661 Ga0495684_0246229
662 Ga0495684_0251796
663 Ga0495684_0261838
664 Ga0495602_0043456
665 Ga0495602_0073508
666 Ga0495602_0237082
667 Ga0496115_0190661
668 Ga0501040_0181138
669 Ga0501041_0282815
670 Ga0501044_0720085
671 nmdc:mga08x19_92391_c1
672 Ga0501082_0000199

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13419

HAD_2

Haloacid dehalogenase-like hydrolase

111

201

0.95

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

4

195

0.69

Structural Annotation

Top 5 Hits

ID Description Score Start End
3sd7-assembly1.cif.gz_A 1.7 angstrom resolution crystal structure of putative phosphatase from clostridium difficile 0.8101 3 221
3kbb-assembly1.cif.gz_A crystal structure of putative beta-phosphoglucomutase from thermotoga maritima 0.8031 3 221
6h90-assembly1.cif.gz_A k145a variant of beta-phosphoglucomutase from lactococcus lactis inhibited by beryllium trifluoride to 1.3 a. 0.7948 1 218
1lvh-assembly1.cif.gz_A the structure of phosphorylated beta-phosphoglucomutase from lactoccocus lactis to 2.3 angstrom resolution 0.7945 1 219
6hdh-assembly1.cif.gz_A r49k variant of beta-phosphoglucomutase from lactococcus lactis in an open conformer to 1.6 a. 0.7924 1 219
ID Description Score Start End Superfamily
af_Q652P6_229_339_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8508 105 218 3.40.50.1000
af_Q652P6_229_339_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8229 105 218 3.40.50.1000
2hoqA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8139 98 221 3.40.50.1000
3kbbA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8133 98 221 3.40.50.1000
2no5A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8108 99 223 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A7C5M7N0-F1-model_v4 HAD family hydrolase 0.9682 7 83 GO:0016787
AF-A0A7J4IVW0-F1-model_v4 Histidinol-phosphate aminotransferase (EC 2.6.1.9) (Imidazole acetol-phosphate transaminase) 0.943 2 221 GO:0000105
GO:0003879
GO:0004400
GO:0005737
GO:0030170
AF-A0A3M1NGN6-F1-model_v4 histidinol-phosphate transaminase (EC 2.6.1.9) 0.9425 3 153 GO:0000105
GO:0004400
GO:0030170
AF-A0A7J4QHE6-F1-model_v4 HAD-IA family hydrolase 0.9394 2 221 GO:0006281
GO:0008967
AF-A0A0B3B168-F1-model_v4 HAD superfamily phosphatase 0.9335 2 143 GO:0006281
GO:0008967

Map