F412644

General Info

Members Datasets Scaffolds Average Seq Length
336 173 672 281

Family's Representative Sequence

Representative Sequence 3300009176|Ga0105242_10359357|Ga0105242_103593571
Length 325
Sequence MNGYCNPQKLFPFSPENQLTVEAPCCLIQSRLGYNRFAMKVTIFGAAGLLGKSLMHEWRDDQVIPLGSEDADLRSQSQVQDAVERTRPDWIVLAAAYTDVDGCESDHELAFDINCRGAVNVARAGKQFESKLIFLSTDYVFDGNKPSPYETNDPRAPQSVYGASKAEAEVQVLKIMPETCIVRTSWVFGAGGRCFPETILKLAFNKSEIDVVTDQRGCPTYTVDLARAIIHLCRNNAQGIVHTTNQGDCTWFEFAREIVAVAGLPTRINPTTSDKFVRPAKRPKYSVLSRASLKQYQLTMPTWQDALERYLAERNFRLRTRHDPT

Samples

Sample ID Description Type Environment
1 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
70 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
147 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
148 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
149 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
150 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
151 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
152 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
153 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
154 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
155 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
156 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
157 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
158 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
159 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
160 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
161 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
162 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
163 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
164 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
165 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
166 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
167 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
168 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
169 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
170 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
171 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
172 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
173 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.65
Rhizosphere 93.75
Stem 0
Stem Tuber 0
Unclassified 7.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105242_10359357 3300009176 Bacteria 1347
2 rootL2_10176938 3300003322 Bacteria 2352
3 Ga0070658_10001415 3300005327 Bacteria 20524
4 Ga0070676_10014926 3300005328 Bacteria 4275
5 Ga0070683_100060734 3300005329 Bacteria 3513
6 Ga0070690_100025194 3300005330 Bacteria 3662
7 Ga0070670_100014244 3300005331 Bacteria 6822
8 Ga0068869_100001474 3300005334 Bacteria 13929
9 Ga0068869_100008247 3300005334 Bacteria 6709
10 Ga0070680_100045380 3300005336 Bacteria 3573
11 Ga0070680_100052493 3300005336 Bacteria 3327
12 Ga0070680_100053271 3300005336 Bacteria 3302
13 Ga0070682_100007594 3300005337 Bacteria 6110
14 Ga0070682_100043765 3300005337 Bacteria 2769
15 Ga0068868_100006836 3300005338 Bacteria 8100
16 Ga0068868_100013375 3300005338 Bacteria 6019
17 Ga0068868_100023474 3300005338 Bacteria 4668
18 Ga0070660_100089467 3300005339 Bacteria 2425
19 Ga0070660_100242231 3300005339 Bacteria 1469
20 Ga0070661_100005970 3300005344 Bacteria 8383
21 Ga0070692_10299792 3300005345 Unclassified 981
22 Ga0070668_100007786 3300005347 Bacteria 7953
23 Ga0070668_100435629 3300005347 Bacteria 1124
24 Ga0070669_100004335 3300005353 Bacteria 10249
25 Ga0070673_100025212 3300005364 Bacteria 4372
26 Ga0070673_100549244 3300005364 Bacteria 1049
27 Ga0070688_100090241 3300005365 Bacteria 2001
28 Ga0070659_100025800 3300005366 Bacteria 4519
29 Ga0070659_100113474 3300005366 Bacteria 2189
30 Ga0070667_100007564 3300005367 Bacteria 9012
31 Ga0070667_100205152 3300005367 Bacteria 1750
32 Ga0070709_10013542 3300005434 Bacteria 4589
33 Ga0070714_100102770 3300005435 Bacteria 2520
34 Ga0070714_100265277 3300005435 Unclassified 1591
35 Ga0070713_100046687 3300005436 Bacteria 3555
36 Ga0070710_10041778 3300005437 Bacteria 2533
37 Ga0070711_100014639 3300005439 Bacteria 4944
38 Ga0070711_100019612 3300005439 Bacteria 4341
39 Ga0070708_100000677 3300005445 Bacteria 25860
40 Ga0070708_100020705 3300005445 Bacteria 5553
41 Ga0070708_100023877 3300005445 Bacteria 5205
42 Ga0070663_100003957 3300005455 Bacteria 8635
43 Ga0070662_100001047 3300005457 Bacteria 16903
44 Ga0070662_100174515 3300005457 Bacteria 1690
45 Ga0070681_10006971 3300005458 Bacteria 10995
46 Ga0070681_10127198 3300005458 Unclassified 2481
47 Ga0070681_10173555 3300005458 Bacteria 2077
48 Ga0070681_10196927 3300005458 Bacteria 1933
49 Ga0068867_100105852 3300005459 Bacteria 2154
50 Ga0070706_100000734 3300005467 Bacteria 37002
51 Ga0070706_100005733 3300005467 Bacteria 11807
52 Ga0070706_100048110 3300005467 Bacteria 3936
53 Ga0070706_100182470 3300005467 Unclassified 1960
54 Ga0070707_100000413 3300005468 Bacteria 42232
55 Ga0070707_100031214 3300005468 Bacteria 5074
56 Ga0070707_100040780 3300005468 Bacteria 4442
57 Ga0070698_100000248 3300005471 Bacteria 54156
58 Ga0070679_100012882 3300005530 Bacteria 8005
59 Ga0070679_100042373 3300005530 Bacteria 4533
60 Ga0070679_100095474 3300005530 Bacteria 2961
61 Ga0070679_100163668 3300005530 Bacteria 2198
62 Ga0070679_100186751 3300005530 Bacteria 2043
63 Ga0070684_100035963 3300005535 Bacteria 4242
64 Ga0070697_100000532 3300005536 Bacteria 28683
65 Ga0070697_100002520 3300005536 Bacteria 14096
66 Ga0070697_100003024 3300005536 Bacteria 12918
67 Ga0070697_100017803 3300005536 Bacteria 5595
68 Ga0070697_100277757 3300005536 Bacteria 1437
69 Ga0070697_100280023 3300005536 Bacteria 1431
70 Ga0068853_100067985 3300005539 Bacteria 3097
71 Ga0068853_100097530 3300005539 Bacteria 2595
72 Ga0070672_100261746 3300005543 Bacteria 1459
73 Ga0070686_100128168 3300005544 Bacteria 1752
74 Ga0070695_100016575 3300005545 Bacteria 4462
75 Ga0070696_100069146 3300005546 Bacteria 2480
76 Ga0070693_100085775 3300005547 Bacteria 1888
77 Ga0070693_100300860 3300005547 Bacteria 1081
78 Ga0070665_100341736 3300005548 Bacteria 1502
79 Ga0068855_100007081 3300005563 Bacteria 13603
80 Ga0068855_100010326 3300005563 Bacteria 11261
81 Ga0068855_100019214 3300005563 Bacteria 8213
82 Ga0068855_100149514 3300005563 Bacteria 2656
83 Ga0070664_100002275 3300005564 Bacteria 15449
84 Ga0068857_100000675 3300005577 Bacteria 25314
85 Ga0068857_100071761 3300005577 Bacteria 3085
86 Ga0068854_100005512 3300005578 Bacteria 7995
87 Ga0068854_100012002 3300005578 Bacteria 5662
88 Ga0068854_100018361 3300005578 Bacteria 4694
89 Ga0068854_100108457 3300005578 Bacteria 2091
90 Ga0068856_100131456 3300005614 Bacteria 2508
91 Ga0068856_100151623 3300005614 Bacteria 2327
92 Ga0068852_100213256 3300005616 Bacteria 1833
93 Ga0068852_100422988 3300005616 Bacteria 1314
94 Ga0068859_100005434 3300005617 Bacteria 12957
95 Ga0068859_100020069 3300005617 Bacteria 6710
96 Ga0068859_100049434 3300005617 Bacteria 4223
97 Ga0068864_100044058 3300005618 Bacteria 3823
98 Ga0068861_100052395 3300005719 Bacteria 3101
99 Ga0068851_10004878 3300005834 Bacteria 6074
100 Ga0068858_100005918 3300005842 Bacteria 11936
101 Ga0068858_100015514 3300005842 Bacteria 7164
102 Ga0068858_100091965 3300005842 Bacteria 2823
103 Ga0068860_100015576 3300005843 Bacteria 7425
104 Ga0068860_100091991 3300005843 Bacteria 2890
105 Ga0068860_100295864 3300005843 Bacteria 1585
106 Ga0068862_100038368 3300005844 Bacteria 4063
107 Ga0081540_1081155 3300005983 Bacteria 1459
108 Ga0070717_10011033 3300006028 Bacteria 6844
109 Ga0070717_10091109 3300006028 Bacteria 2574
110 Ga0070715_10091907 3300006163 Bacteria 1398
111 Ga0070716_100000066 3300006173 Bacteria 40601
112 Ga0070712_100000540 3300006175 Bacteria 21839
113 Ga0070712_100001357 3300006175 Bacteria 14853
114 Ga0097621_100007130 3300006237 Bacteria 7969
115 Ga0097621_100012989 3300006237 Bacteria 6189
116 Ga0097621_100245760 3300006237 Bacteria 1566
117 Ga0068871_100003050 3300006358 Bacteria 11495
118 Ga0068871_100036941 3300006358 Bacteria 3892
119 Ga0068871_100103592 3300006358 Bacteria 2386
120 Ga0075428_100011666 3300006844 Bacteria 9779
121 Ga0075434_100074694 3300006871 Unclassified 3383
122 Ga0075434_100222526 3300006871 Bacteria 1907
123 Ga0075434_100450683 3300006871 Bacteria 1308
124 Ga0068865_100048074 3300006881 Bacteria 2935
125 Ga0068865_100055019 3300006881 Bacteria 2768
126 Ga0068865_100208433 3300006881 Bacteria 1521
127 Ga0097620_100005434 3300006931 Bacteria 12957
128 Ga0097620_100020066 3300006931 Bacteria 6710
129 Ga0097620_100049434 3300006931 Bacteria 4223
130 Ga0075435_100002647 3300007076 Bacteria 11935
131 Ga0099794_10005805 3300007265 Bacteria 4975
132 Ga0099794_10057530 3300007265 Unclassified 1884
133 Ga0105250_10172152 3300009092 Bacteria 907
134 Ga0105240_10004069 3300009093 Bacteria 22501
135 Ga0105240_10022762 3300009093 Bacteria 8301
136 Ga0105240_10068731 3300009093 Bacteria 4387
137 Ga0105240_10167785 3300009093 Bacteria 2602
138 Ga0111539_10402676 3300009094 Bacteria 1594
139 Ga0105245_10036234 3300009098 Bacteria 4381
140 Ga0105245_10187834 3300009098 Bacteria 1978
141 Ga0105245_10215858 3300009098 Bacteria 1848
142 Ga0114129_10228923 3300009147 Bacteria 2504
143 Ga0105243_10080197 3300009148 Bacteria 2661
144 Ga0105243_10259310 3300009148 Unclassified 1556
145 Ga0105241_10004402 3300009174 Bacteria 10414
146 Ga0105241_10008395 3300009174 Bacteria 7599
147 Ga0105241_10033276 3300009174 Bacteria 3869
148 Ga0105241_10086078 3300009174 Bacteria 2471
149 Ga0105242_10376589 3300009176 Bacteria 1318
150 Ga0105242_10407329 3300009176 Bacteria 1271
151 Ga0105237_10000014 3300009545 Bacteria 293492
152 Ga0105237_10048174 3300009545 Bacteria 4283
153 Ga0105237_10093700 3300009545 Unclassified 2993
154 Ga0105237_10567477 3300009545 Unclassified 1142
155 Ga0105238_10004986 3300009551 Bacteria 13130
156 Ga0105238_10025604 3300009551 Bacteria 6015
157 Ga0105238_10107186 3300009551 Bacteria 2775
158 Ga0105249_10006193 3300009553 Bacteria 10385
159 Ga0105249_10013318 3300009553 Bacteria 7262
160 Ga0105239_10059092 3300010375 Bacteria 4208
161 Ga0105239_10098869 3300010375 Bacteria 3226
162 Ga0105239_10114563 3300010375 Bacteria 2990
163 Ga0105239_10429722 3300010375 Bacteria 1497
164 Ga0105239_10555504 3300010375 Bacteria 1308
165 Ga0105246_10096808 3300011119 Bacteria 2140
166 Ga0105246_10280419 3300011119 Bacteria 1336
167 Ga0157373_10007426 3300013100 Bacteria 8154
168 Ga0157373_10048206 3300013100 Bacteria 3037
169 Ga0157373_10163533 3300013100 Bacteria 1566
170 Ga0157373_10209129 3300013100 Bacteria 1376
171 Ga0157371_10072350 3300013102 Bacteria 2441
172 Ga0157371_10106384 3300013102 Bacteria 1991
173 Ga0157370_10018706 3300013104 Bacteria 6966
174 Ga0157369_10046299 3300013105 Bacteria 4727
175 Ga0157374_10001187 3300013296 Bacteria 22262
176 Ga0157374_10050008 3300013296 Bacteria 3884
177 Ga0157374_10122746 3300013296 Bacteria 2509
178 Ga0157374_10794032 3300013296 Unclassified 962
179 Ga0157378_10001124 3300013297 Bacteria 24387
180 Ga0157378_10059507 3300013297 Bacteria 3409
181 Ga0157378_10067279 3300013297 Bacteria 3210
182 Ga0157378_10348281 3300013297 Bacteria 1446
183 Ga0163162_10000288 3300013306 Bacteria 46072
184 Ga0163162_10007539 3300013306 Bacteria 10597
185 Ga0163162_10020787 3300013306 Bacteria 6452
186 Ga0163162_10479300 3300013306 Bacteria 1375
187 Ga0157372_10000268 3300013307 Bacteria 57568
188 Ga0157372_10020142 3300013307 Bacteria 7192
189 Ga0157375_10093768 3300013308 Bacteria 3069
190 Ga0157375_10136170 3300013308 Bacteria 2580
191 Ga0163163_10295576 3300014325 Bacteria 1672
192 Ga0157379_10000825 3300014968 Bacteria 25116
193 Ga0157379_10114993 3300014968 Bacteria 2419
194 Ga0157379_10280579 3300014968 Unclassified 1516
195 Ga0157376_10020743 3300014969 Bacteria 5093
196 Ga0157376_10071528 3300014969 Bacteria 2948
197 Ga0207656_10010927 3300025321 Bacteria 3416
198 Ga0207692_10004835 3300025898 Bacteria 5359
199 Ga0207642_10031040 3300025899 Bacteria 2234
200 Ga0207647_10154967 3300025904 Bacteria 1338
201 Ga0207685_10008695 3300025905 Bacteria 2908
202 Ga0207699_10010787 3300025906 Bacteria 4597
203 Ga0207699_10023465 3300025906 Bacteria 3358
204 Ga0207645_10014876 3300025907 Bacteria 5191
205 Ga0207643_10000198 3300025908 Bacteria 41569
206 Ga0207705_10058455 3300025909 Bacteria 2782
207 Ga0207684_10000389 3300025910 Bacteria 59084
208 Ga0207684_10001356 3300025910 Bacteria 26825
209 Ga0207654_10002789 3300025911 Bacteria 8879
210 Ga0207654_10031609 3300025911 Bacteria 2918
211 Ga0207654_10035933 3300025911 Bacteria 2764
212 Ga0207654_10070015 3300025911 Bacteria 2081
213 Ga0207707_10006137 3300025912 Bacteria 10500
214 Ga0207707_10116321 3300025912 Unclassified 2336
215 Ga0207707_10525689 3300025912 Unclassified 1007
216 Ga0207695_10003409 3300025913 Bacteria 22452
217 Ga0207695_10008987 3300025913 Bacteria 12433
218 Ga0207671_10000219 3300025914 Bacteria 85909
219 Ga0207671_10131364 3300025914 Bacteria 1922
220 Ga0207671_10177319 3300025914 Bacteria 1657
221 Ga0207671_10291296 3300025914 Bacteria 1289
222 Ga0207693_10000629 3300025915 Bacteria 31546
223 Ga0207693_10003366 3300025915 Bacteria 13655
224 Ga0207693_10067801 3300025915 Viruses 2794
225 Ga0207663_10036643 3300025916 Bacteria 2952
226 Ga0207660_10202964 3300025917 Bacteria 1549
227 Ga0207660_10288035 3300025917 Bacteria 1305
228 Ga0207657_10009952 3300025919 Bacteria 9516
229 Ga0207652_10009625 3300025921 Bacteria 7774
230 Ga0207652_10022640 3300025921 Bacteria 5201
231 Ga0207652_10074538 3300025921 Bacteria 2955
232 Ga0207646_10001021 3300025922 Bacteria 35814
233 Ga0207646_10035164 3300025922 Unclassified 4526
234 Ga0207646_10160358 3300025922 Bacteria 2029
235 Ga0207681_10081555 3300025923 Unclassified 2284
236 Ga0207694_10037028 3300025924 Bacteria 3745
237 Ga0207694_10469233 3300025924 Bacteria 1052
238 Ga0207650_10006694 3300025925 Bacteria 7858
239 Ga0207687_10015204 3300025927 Bacteria 5044
240 Ga0207687_10121915 3300025927 Bacteria 1951
241 Ga0207687_10124868 3300025927 Bacteria 1930
242 Ga0207700_10055480 3300025928 Bacteria 2978
243 Ga0207700_10153845 3300025928 Bacteria 1903
244 Ga0207700_10206953 3300025928 Bacteria 1656
245 Ga0207664_10141520 3300025929 Bacteria 2035
246 Ga0207664_10390378 3300025929 Unclassified 1237
247 Ga0207690_10041902 3300025932 Bacteria 3003
248 Ga0207690_10147007 3300025932 Bacteria 1743
249 Ga0207706_10038580 3300025933 Bacteria 4237
250 Ga0207704_10006452 3300025938 Bacteria 5476
251 Ga0207665_10000036 3300025939 Bacteria 87649
252 Ga0207665_10042466 3300025939 Bacteria 3039
253 Ga0207665_10049893 3300025939 Bacteria 2814
254 Ga0207665_10055277 3300025939 Bacteria 2678
255 Ga0207665_10186337 3300025939 Bacteria 1506
256 Ga0207711_10010686 3300025941 Bacteria 7633
257 Ga0207711_10304461 3300025941 Unclassified 1470
258 Ga0207689_10000231 3300025942 Bacteria 49731
259 Ga0207689_10008910 3300025942 Bacteria 8701
260 Ga0207661_10326124 3300025944 Bacteria 1381
261 Ga0207679_10251598 3300025945 Bacteria 1502
262 Ga0207667_10017744 3300025949 Bacteria 8004
263 Ga0207667_10039337 3300025949 Bacteria 5041
264 Ga0207667_10065200 3300025949 Bacteria 3799
265 Ga0207651_10019053 3300025960 Bacteria 4102
266 Ga0207668_10004237 3300025972 Bacteria 8411
267 Ga0207640_10004123 3300025981 Bacteria 7853
268 Ga0207640_10030202 3300025981 Bacteria 3336
269 Ga0207640_10054783 3300025981 Bacteria 2609
270 Ga0207677_10007639 3300026023 Bacteria 6000
271 Ga0207677_10052119 3300026023 Bacteria 2778
272 Ga0207677_10176460 3300026023 Bacteria 1676
273 Ga0207703_10004142 3300026035 Bacteria 11961
274 Ga0207703_10006788 3300026035 Bacteria 9123
275 Ga0207678_10046530 3300026067 Bacteria 3752
276 Ga0207708_10473841 3300026075 Bacteria 1046
277 Ga0207702_10058012 3300026078 Bacteria 3293
278 Ga0207702_10078908 3300026078 Bacteria 2851
279 Ga0207641_10057309 3300026088 Bacteria 3313
280 Ga0207648_10001265 3300026089 Bacteria 28207
281 Ga0207648_10033708 3300026089 Bacteria 4516
282 Ga0207648_10128201 3300026089 Bacteria 2232
283 Ga0207674_10002020 3300026116 Bacteria 25740
284 Ga0207674_10043389 3300026116 Bacteria 4637
285 Ga0207683_10000247 3300026121 Bacteria 48174
286 Ga0207683_10057362 3300026121 Bacteria 3418
287 Ga0207698_10236584 3300026142 Bacteria 1662
288 Ga0207428_10030523 3300027907 Bacteria 4456
289 Ga0268266_10226569 3300028379 Bacteria 1720
290 Ga0268265_10021388 3300028380 Bacteria 4531
291 Ga0268264_10060413 3300028381 Unclassified 3177
292 Ga0268264_10264778 3300028381 Bacteria 1603
293 Ga0265342_10098295 3300031712 Unclassified 1671
294 Ga0373961_0005737 3300035241 Unclassified 2980
295 Ga0373931_0179633 3300035691 Bacteria 1252
296 Ga0373947_0054667 3300035725 Bacteria 2410
297 Ga0373925_0063227 3300037068 Bacteria 2785
298 Ga0436363_0365440 3300039450 Unclassified 1119
299 Ga0451577_0027063 3300042876 Bacteria 5192
300 Ga0453683_0000046 3300044673 Bacteria 208120
301 Ga0453684_0644999 3300044712 Bacteria 1156
302 Ga0451576_0000827 3300045051 Bacteria 60356
303 Ga0451576_0002959 3300045051 Bacteria 24064
304 Ga0451576_0076525 3300045051 Bacteria 3482
305 Ga0451576_0130855 3300045051 Bacteria 2615
306 Ga0451576_0239363 3300045051 Bacteria 1896
307 Ga0466967_0020434 3300045976 Bacteria 5353
308 Ga0495603_0333757 3300046455 Unclassified 870
309 Ga0495580_0001413 3300046472 Bacteria 21086
310 Ga0495580_0021810 3300046472 Bacteria 4723
311 Ga0495580_0031774 3300046472 Bacteria 3813
312 Ga0495580_0187504 3300046472 Bacteria 1427
313 Ga0495584_0179523 3300046491 Unclassified 1076
314 Ga0496100_0274188 3300048903 Bacteria 1255
315 Ga0496102_0040759 3300048905 Bacteria 4202
316 Ga0496102_0048127 3300048905 Bacteria 3876
317 Ga0496102_0205396 3300048905 Bacteria 1857
318 Ga0496103_0059965 3300048906 Bacteria 2365
319 Ga0496103_0152320 3300048906 Bacteria 1481
320 Ga0496104_0008193 3300048907 Bacteria 9279
321 Ga0496104_0446625 3300048907 Bacteria 1205
322 Ga0496105_0245717 3300048908 Bacteria 1451
323 Ga0496106_0089471 3300048909 Bacteria 2374
324 Ga0496106_0111667 3300048909 Bacteria 2129
325 Ga0496106_0507425 3300048909 Unclassified 969
326 Ga0496110_0287624 3300048913 Bacteria 1497
327 Ga0496111_0236281 3300048914 Bacteria 1357
328 Ga0496112_0015973 3300048915 Bacteria 7018
329 Ga0496112_0027589 3300048915 Bacteria 5476
330 Ga0496112_0142172 3300048915 Bacteria 2369
331 Ga0496112_0450349 3300048915 Bacteria 1225
332 Ga0496114_0093538 3300048917 Bacteria 2556
333 nmdc:mga05p37_19702_c1 3300050507 Bacteria 8161
334 nmdc:mga0n895_201417_c1 3300050512 Bacteria 2021
335 nmdc:mga0rr50_131198_c1 3300050513 Bacteria 2006
336 nmdc:mga0a205_362367_c1 3300050515 Unclassified 1316
337 Ga0105242_10359357
338 rootL2_10176938
339 Ga0070658_10001415
340 Ga0070676_10014926
341 Ga0070683_100060734
342 Ga0070690_100025194
343 Ga0070670_100014244
344 Ga0068869_100001474
345 Ga0068869_100008247
346 Ga0070680_100045380
347 Ga0070680_100052493
348 Ga0070680_100053271
349 Ga0070682_100007594
350 Ga0070682_100043765
351 Ga0068868_100006836
352 Ga0068868_100013375
353 Ga0068868_100023474
354 Ga0070660_100089467
355 Ga0070660_100242231
356 Ga0070661_100005970
357 Ga0070692_10299792
358 Ga0070668_100007786
359 Ga0070668_100435629
360 Ga0070669_100004335
361 Ga0070673_100025212
362 Ga0070673_100549244
363 Ga0070688_100090241
364 Ga0070659_100025800
365 Ga0070659_100113474
366 Ga0070667_100007564
367 Ga0070667_100205152
368 Ga0070709_10013542
369 Ga0070714_100102770
370 Ga0070714_100265277
371 Ga0070713_100046687
372 Ga0070710_10041778
373 Ga0070711_100014639
374 Ga0070711_100019612
375 Ga0070708_100000677
376 Ga0070708_100020705
377 Ga0070708_100023877
378 Ga0070663_100003957
379 Ga0070662_100001047
380 Ga0070662_100174515
381 Ga0070681_10006971
382 Ga0070681_10127198
383 Ga0070681_10173555
384 Ga0070681_10196927
385 Ga0068867_100105852
386 Ga0070706_100000734
387 Ga0070706_100005733
388 Ga0070706_100048110
389 Ga0070706_100182470
390 Ga0070707_100000413
391 Ga0070707_100031214
392 Ga0070707_100040780
393 Ga0070698_100000248
394 Ga0070679_100012882
395 Ga0070679_100042373
396 Ga0070679_100095474
397 Ga0070679_100163668
398 Ga0070679_100186751
399 Ga0070684_100035963
400 Ga0070697_100000532
401 Ga0070697_100002520
402 Ga0070697_100003024
403 Ga0070697_100017803
404 Ga0070697_100277757
405 Ga0070697_100280023
406 Ga0068853_100067985
407 Ga0068853_100097530
408 Ga0070672_100261746
409 Ga0070686_100128168
410 Ga0070695_100016575
411 Ga0070696_100069146
412 Ga0070693_100085775
413 Ga0070693_100300860
414 Ga0070665_100341736
415 Ga0068855_100007081
416 Ga0068855_100010326
417 Ga0068855_100019214
418 Ga0068855_100149514
419 Ga0070664_100002275
420 Ga0068857_100000675
421 Ga0068857_100071761
422 Ga0068854_100005512
423 Ga0068854_100012002
424 Ga0068854_100018361
425 Ga0068854_100108457
426 Ga0068856_100131456
427 Ga0068856_100151623
428 Ga0068852_100213256
429 Ga0068852_100422988
430 Ga0068859_100005434
431 Ga0068859_100020069
432 Ga0068859_100049434
433 Ga0068864_100044058
434 Ga0068861_100052395
435 Ga0068851_10004878
436 Ga0068858_100005918
437 Ga0068858_100015514
438 Ga0068858_100091965
439 Ga0068860_100015576
440 Ga0068860_100091991
441 Ga0068860_100295864
442 Ga0068862_100038368
443 Ga0081540_1081155
444 Ga0070717_10011033
445 Ga0070717_10091109
446 Ga0070715_10091907
447 Ga0070716_100000066
448 Ga0070712_100000540
449 Ga0070712_100001357
450 Ga0097621_100007130
451 Ga0097621_100012989
452 Ga0097621_100245760
453 Ga0068871_100003050
454 Ga0068871_100036941
455 Ga0068871_100103592
456 Ga0075428_100011666
457 Ga0075434_100074694
458 Ga0075434_100222526
459 Ga0075434_100450683
460 Ga0068865_100048074
461 Ga0068865_100055019
462 Ga0068865_100208433
463 Ga0097620_100005434
464 Ga0097620_100020066
465 Ga0097620_100049434
466 Ga0075435_100002647
467 Ga0099794_10005805
468 Ga0099794_10057530
469 Ga0105250_10172152
470 Ga0105240_10004069
471 Ga0105240_10022762
472 Ga0105240_10068731
473 Ga0105240_10167785
474 Ga0111539_10402676
475 Ga0105245_10036234
476 Ga0105245_10187834
477 Ga0105245_10215858
478 Ga0114129_10228923
479 Ga0105243_10080197
480 Ga0105243_10259310
481 Ga0105241_10004402
482 Ga0105241_10008395
483 Ga0105241_10033276
484 Ga0105241_10086078
485 Ga0105242_10376589
486 Ga0105242_10407329
487 Ga0105237_10000014
488 Ga0105237_10048174
489 Ga0105237_10093700
490 Ga0105237_10567477
491 Ga0105238_10004986
492 Ga0105238_10025604
493 Ga0105238_10107186
494 Ga0105249_10006193
495 Ga0105249_10013318
496 Ga0105239_10059092
497 Ga0105239_10098869
498 Ga0105239_10114563
499 Ga0105239_10429722
500 Ga0105239_10555504
501 Ga0105246_10096808
502 Ga0105246_10280419
503 Ga0157373_10007426
504 Ga0157373_10048206
505 Ga0157373_10163533
506 Ga0157373_10209129
507 Ga0157371_10072350
508 Ga0157371_10106384
509 Ga0157370_10018706
510 Ga0157369_10046299
511 Ga0157374_10001187
512 Ga0157374_10050008
513 Ga0157374_10122746
514 Ga0157374_10794032
515 Ga0157378_10001124
516 Ga0157378_10059507
517 Ga0157378_10067279
518 Ga0157378_10348281
519 Ga0163162_10000288
520 Ga0163162_10007539
521 Ga0163162_10020787
522 Ga0163162_10479300
523 Ga0157372_10000268
524 Ga0157372_10020142
525 Ga0157375_10093768
526 Ga0157375_10136170
527 Ga0163163_10295576
528 Ga0157379_10000825
529 Ga0157379_10114993
530 Ga0157379_10280579
531 Ga0157376_10020743
532 Ga0157376_10071528
533 Ga0207656_10010927
534 Ga0207692_10004835
535 Ga0207642_10031040
536 Ga0207647_10154967
537 Ga0207685_10008695
538 Ga0207699_10010787
539 Ga0207699_10023465
540 Ga0207645_10014876
541 Ga0207643_10000198
542 Ga0207705_10058455
543 Ga0207684_10000389
544 Ga0207684_10001356
545 Ga0207654_10002789
546 Ga0207654_10031609
547 Ga0207654_10035933
548 Ga0207654_10070015
549 Ga0207707_10006137
550 Ga0207707_10116321
551 Ga0207707_10525689
552 Ga0207695_10003409
553 Ga0207695_10008987
554 Ga0207671_10000219
555 Ga0207671_10131364
556 Ga0207671_10177319
557 Ga0207671_10291296
558 Ga0207693_10000629
559 Ga0207693_10003366
560 Ga0207693_10067801
561 Ga0207663_10036643
562 Ga0207660_10202964
563 Ga0207660_10288035
564 Ga0207657_10009952
565 Ga0207652_10009625
566 Ga0207652_10022640
567 Ga0207652_10074538
568 Ga0207646_10001021
569 Ga0207646_10035164
570 Ga0207646_10160358
571 Ga0207681_10081555
572 Ga0207694_10037028
573 Ga0207694_10469233
574 Ga0207650_10006694
575 Ga0207687_10015204
576 Ga0207687_10121915
577 Ga0207687_10124868
578 Ga0207700_10055480
579 Ga0207700_10153845
580 Ga0207700_10206953
581 Ga0207664_10141520
582 Ga0207664_10390378
583 Ga0207690_10041902
584 Ga0207690_10147007
585 Ga0207706_10038580
586 Ga0207704_10006452
587 Ga0207665_10000036
588 Ga0207665_10042466
589 Ga0207665_10049893
590 Ga0207665_10055277
591 Ga0207665_10186337
592 Ga0207711_10010686
593 Ga0207711_10304461
594 Ga0207689_10000231
595 Ga0207689_10008910
596 Ga0207661_10326124
597 Ga0207679_10251598
598 Ga0207667_10017744
599 Ga0207667_10039337
600 Ga0207667_10065200
601 Ga0207651_10019053
602 Ga0207668_10004237
603 Ga0207640_10004123
604 Ga0207640_10030202
605 Ga0207640_10054783
606 Ga0207677_10007639
607 Ga0207677_10052119
608 Ga0207677_10176460
609 Ga0207703_10004142
610 Ga0207703_10006788
611 Ga0207678_10046530
612 Ga0207708_10473841
613 Ga0207702_10058012
614 Ga0207702_10078908
615 Ga0207641_10057309
616 Ga0207648_10001265
617 Ga0207648_10033708
618 Ga0207648_10128201
619 Ga0207674_10002020
620 Ga0207674_10043389
621 Ga0207683_10000247
622 Ga0207683_10057362
623 Ga0207698_10236584
624 Ga0207428_10030523
625 Ga0268266_10226569
626 Ga0268265_10021388
627 Ga0268264_10060413
628 Ga0268264_10264778
629 Ga0265342_10098295
630 Ga0373961_0005737
631 Ga0373931_0179633
632 Ga0373947_0054667
633 Ga0373925_0063227
634 Ga0436363_0365440
635 Ga0451577_0027063
636 Ga0453683_0000046
637 Ga0453684_0644999
638 Ga0451576_0000827
639 Ga0451576_0002959
640 Ga0451576_0076525
641 Ga0451576_0130855
642 Ga0451576_0239363
643 Ga0466967_0020434
644 Ga0495603_0333757
645 Ga0495580_0001413
646 Ga0495580_0021810
647 Ga0495580_0031774
648 Ga0495580_0187504
649 Ga0495584_0179523
650 Ga0496100_0274188
651 Ga0496102_0040759
652 Ga0496102_0048127
653 Ga0496102_0205396
654 Ga0496103_0059965
655 Ga0496103_0152320
656 Ga0496104_0008193
657 Ga0496104_0446625
658 Ga0496105_0245717
659 Ga0496106_0089471
660 Ga0496106_0111667
661 Ga0496106_0507425
662 Ga0496110_0287624
663 Ga0496111_0236281
664 Ga0496112_0015973
665 Ga0496112_0027589
666 Ga0496112_0142172
667 Ga0496112_0450349
668 Ga0496114_0093538
669 nmdc:mga05p37_19702_c1
670 nmdc:mga0n895_201417_c1
671 nmdc:mga0rr50_131198_c1
672 nmdc:mga0a205_362367_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04321

RmlD_sub_bind

RmlD substrate binding domain

39

316

0.98

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

41

245

0.93

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

55

188

0.93

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

56

249

0.82

PF02719

Polysacc_synt_2

Polysaccharide biosynthesis protein

60

216

0.79

PF07993

NAD_binding_4

Male sterility protein

75

224

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vl0-assembly1.cif.gz_B crystal structure of a dtdp-4-dehydrorhamnose reductase, rfbd ortholog (ca_c2315) from clostridium acetobutylicum atcc 824 at 2.05 a resolution 0.9736 1 277
3sc6-assembly6.cif.gz_F 2.65 angstrom resolution crystal structure of dtdp-4-dehydrorhamnose reductase (rfbd) from bacillus anthracis str. ames in complex with nadp 0.9729 2 275
3sc6-assembly5.cif.gz_E 2.65 angstrom resolution crystal structure of dtdp-4-dehydrorhamnose reductase (rfbd) from bacillus anthracis str. ames in complex with nadp 0.9632 2 275
1vl0-assembly1.cif.gz_B crystal structure of a dtdp-4-dehydrorhamnose reductase, rfbd ortholog (ca_c2315) from clostridium acetobutylicum atcc 824 at 2.05 a resolution 0.96 1 277
8g22-assembly1.cif.gz_A crystal structure of the dtdp-4-dehydrorhamnose reductase from streptococcus pneumoniae. 0.9589 3 274
ID Description Score Start End Superfamily
1vl0C02 Alpha Beta;Alpha-Beta Complex;UDP-galactose 4-epimerase; domain 1;UDP-galactose 4-epimerase, domain 1 0.9618 158 274 3.90.25.10
3sc6D01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9597 2 208 3.40.50.720
1vl0B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9554 2 207 3.40.50.720
1kc0A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9516 1 275 3.40.50.720
4wpgA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9273 3 208 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A357D7T4-F1-model_v4 dTDP-4-dehydrorhamnose reductase (EC 1.1.1.133) 0.9951 40 131 GO:0005829
GO:0008831
GO:0019305
GO:0045226
AF-A0A2V9UV66-F1-model_v4 dTDP-4-dehydrorhamnose reductase (EC 1.1.1.133) 0.9921 1 278 GO:0005829
GO:0008831
GO:0019305
GO:0045226
AF-A0A845TX95-F1-model_v4 dTDP-4-dehydrorhamnose reductase (EC 1.1.1.133) 0.99 1 280 GO:0005829
GO:0008831
GO:0019305
GO:0045226
AF-A0A7J5W8R0-F1-model_v4 dTDP-4-dehydrorhamnose reductase (EC 1.1.1.133) 0.9887 52 275 GO:0005829
GO:0008831
GO:0019305
GO:0045226
AF-A0A1B9F4W3-F1-model_v4 dTDP-4-dehydrorhamnose reductase (EC 1.1.1.133) 0.9884 2 279 GO:0005829
GO:0008831
GO:0019305
GO:0045226

Map