F412552

General Info

Members Datasets Scaffolds Average Seq Length
336 234 336 97

Family's Representative Sequence

Representative Sequence 3300005365|Ga0070688_100878003|Ga0070688_1008780031
Length 102
Sequence MAVPAQRDTAVLGEDFVEAAERALSAGKPEQVSDAELERVLTAAVRLYAAKTESDKPPAQPVTPSNVTPTEIVVTVSDMIKAAGLNLWDVSMWFNRRKGQGS

Samples

Sample ID Description Type Environment
1 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
39 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
43 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
44 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
47 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
48 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
74 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
75 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
76 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
77 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
120 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
121 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
122 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
123 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
124 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
125 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
126 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
127 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
128 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
129 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
130 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
131 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
132 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
133 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
134 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
135 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
136 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
137 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
138 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
139 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
140 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
141 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
142 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
143 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
146 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
147 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
148 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
149 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
150 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
151 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
152 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
153 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
154 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
155 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
156 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
157 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
158 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
159 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
160 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
161 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
162 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
163 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
164 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
165 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
166 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
167 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
168 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
169 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
170 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
171 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
172 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
173 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
174 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
175 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
176 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
177 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
178 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
179 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
180 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
181 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
182 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
183 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
184 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
185 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
186 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
187 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
188 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
189 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
190 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
191 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
204 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
205 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
206 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
207 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
208 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
209 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
210 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
211 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
212 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
213 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
215 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
216 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
217 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
218 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
219 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
220 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
221 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
222 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
223 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
224 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
225 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
226 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
227 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
228 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
229 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
230 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
231 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
232 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
233 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
234 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.33
Nodule 0
Rhizoplane 5.95
Rhizosphere 84.23
Stem 0
Stem Tuber 0
Unclassified 1.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10001652 3300003215 Bacteria 13208
2 JGI25404J52841_10009743 3300003659 Bacteria 2059
3 Ga0070676_10350351 3300005328 Bacteria 1015
4 Ga0070683_100954905 3300005329 Unclassified 823
5 Ga0070683_101858811 3300005329 Unclassified 579
6 Ga0070680_100916951 3300005336 Unclassified 756
7 Ga0070682_101939147 3300005337 Bacteria 517
8 Ga0068868_100222577 3300005338 Bacteria 1580
9 Ga0070687_100838070 3300005343 Bacteria 654
10 Ga0070675_100349642 3300005354 Bacteria 1311
11 Ga0070674_100008901 3300005356 Bacteria 5993
12 Ga0070674_100076281 3300005356 Bacteria 2383
13 Ga0070688_100193370 3300005365 Bacteria 1419
14 Ga0070688_100554981 3300005365 Bacteria 874
15 Ga0070688_100878003 3300005365 Bacteria 706
16 Ga0070709_10129701 3300005434 Bacteria 1720
17 Ga0070714_100824751 3300005435 Bacteria 899
18 Ga0070713_100869902 3300005436 Bacteria 866
19 Ga0070711_100908138 3300005439 Unclassified 752
20 Ga0070700_100501197 3300005441 Bacteria 934
21 Ga0070663_100370667 3300005455 Bacteria 1164
22 Ga0070662_100537755 3300005457 Bacteria 978
23 Ga0070681_10544307 3300005458 Bacteria 1074
24 Ga0068867_100211232 3300005459 Bacteria 1559
25 Ga0070679_100006790 3300005530 Bacteria 10675
26 Ga0070684_101550052 3300005535 Bacteria 625
27 Ga0068853_102229857 3300005539 Bacteria 531
28 Ga0070672_100079776 3300005543 Bacteria 2621
29 Ga0070686_100586472 3300005544 Bacteria 877
30 Ga0070695_100920981 3300005545 Bacteria 707
31 Ga0070696_101427612 3300005546 Bacteria 591
32 Ga0070693_100107841 3300005547 Bacteria 1708
33 Ga0070665_100474443 3300005548 Bacteria 1262
34 Ga0070665_100729745 3300005548 Bacteria 1004
35 Ga0068855_100117854 3300005563 Bacteria 3041
36 Ga0068855_100841195 3300005563 Bacteria 973
37 Ga0070664_100737485 3300005564 Bacteria 919
38 Ga0068856_102228046 3300005614 Bacteria 557
39 Ga0068852_100687436 3300005616 Unclassified 1033
40 Ga0068852_102334084 3300005616 Bacteria 556
41 Ga0068866_10206866 3300005718 Bacteria 1176
42 Ga0068858_101107403 3300005842 Bacteria 777
43 Ga0068858_101670892 3300005842 Bacteria 629
44 Ga0068860_100965356 3300005843 Bacteria 870
45 Ga0081455_10060109 3300005937 Bacteria 3205
46 Ga0081538_10024567 3300005981 Bacteria 4289
47 Ga0081540_1000241 3300005983 Bacteria 57441
48 Ga0081539_10117858 3300005985 Bacteria 1324
49 Ga0070717_10744925 3300006028 Bacteria 891
50 Ga0075365_10014433 3300006038 Bacteria 4753
51 Ga0075365_10120536 3300006038 Bacteria 1809
52 Ga0075368_10207057 3300006042 Bacteria 831
53 Ga0075363_100221649 3300006048 Bacteria 1084
54 Ga0075363_100406730 3300006048 Unclassified 800
55 Ga0070712_100615694 3300006175 Unclassified 920
56 Ga0075367_10113548 3300006178 Bacteria 1665
57 Ga0075367_10333322 3300006178 Bacteria 957
58 Ga0075367_10582690 3300006178 Bacteria 711
59 Ga0075369_10217970 3300006186 Bacteria 883
60 Ga0075366_10029106 3300006195 Bacteria 3244
61 Ga0068871_100309708 3300006358 Bacteria 1388
62 Ga0068871_100491929 3300006358 Bacteria 1105
63 Ga0075433_11167025 3300006852 Bacteria 669
64 Ga0075435_100114232 3300007076 Bacteria 2248
65 Ga0105240_10927386 3300009093 Bacteria 935
66 Ga0105240_11368726 3300009093 Bacteria 745
67 Ga0105240_11795114 3300009093 Bacteria 639
68 Ga0105240_12291675 3300009093 Bacteria 559
69 Ga0111539_11756618 3300009094 Bacteria 719
70 Ga0105245_10868021 3300009098 Bacteria 943
71 Ga0114129_10691177 3300009147 Unclassified 1312
72 Ga0105243_11492637 3300009148 Bacteria 699
73 Ga0105243_11495885 3300009148 Bacteria 699
74 Ga0105242_10399791 3300009176 Bacteria 1282
75 Ga0105248_10109951 3300009177 Bacteria 3108
76 Ga0105248_11025015 3300009177 Bacteria 932
77 Ga0105237_10094208 3300009545 Bacteria 2984
78 Ga0105237_11510335 3300009545 Bacteria 678
79 Ga0105238_10011652 3300009551 Bacteria 8860
80 Ga0105238_10028399 3300009551 Bacteria 5700
81 Ga0105249_10468473 3300009553 Bacteria 1301
82 Ga0105249_11353637 3300009553 Bacteria 784
83 Ga0099796_10183709 3300010159 Bacteria 840
84 Ga0105239_10096454 3300010375 Bacteria 3267
85 Ga0157374_10029538 3300013296 Bacteria 4966
86 Ga0157378_12241286 3300013297 Bacteria 598
87 Ga0163162_10415861 3300013306 Bacteria 1477
88 Ga0163162_10417533 3300013306 Bacteria 1474
89 Ga0163162_10481370 3300013306 Bacteria 1373
90 Ga0163162_10876508 3300013306 Bacteria 1012
91 Ga0163162_12438296 3300013306 Bacteria 601
92 Ga0157375_10716039 3300013308 Bacteria 1154
93 Ga0157375_12058974 3300013308 Bacteria 679
94 Ga0157375_12869603 3300013308 Bacteria 576
95 Ga0163163_11243184 3300014325 Bacteria 807
96 Ga0163163_12273926 3300014325 Bacteria 601
97 Ga0157380_10128760 3300014326 Bacteria 2156
98 Ga0157380_12025775 3300014326 Bacteria 638
99 Ga0157380_12704429 3300014326 Bacteria 563
100 Ga0157379_11684013 3300014968 Bacteria 621
101 Ga0157376_11663792 3300014969 Bacteria 673
102 Ga0157376_11853894 3300014969 Bacteria 640
103 Ga0157376_12580494 3300014969 Bacteria 548
104 Ga0163161_10077932 3300017792 Bacteria 2435
105 Ga0213872_10111228 3300021361 Bacteria 1217
106 Ga0213872_10240180 3300021361 Unclassified 766
107 Ga0213871_10057160 3300021441 Bacteria 1080
108 Ga0209758_1000469 3300025297 Bacteria 66568
109 Ga0209758_1119615 3300025297 Bacteria 713
110 Ga0207426_1063807 3300025302 Bacteria 1050
111 Ga0207642_10041443 3300025899 Bacteria 2016
112 Ga0207680_10144595 3300025903 Bacteria 1579
113 Ga0207699_10169041 3300025906 Bacteria 1461
114 Ga0207645_11126368 3300025907 Bacteria 528
115 Ga0207705_10821402 3300025909 Unclassified 721
116 Ga0207707_10406911 3300025912 Bacteria 1168
117 Ga0207695_10774628 3300025913 Bacteria 839
118 Ga0207671_10093352 3300025914 Bacteria 2270
119 Ga0207693_10880356 3300025915 Bacteria 688
120 Ga0207663_10572170 3300025916 Unclassified 885
121 Ga0207662_10555485 3300025918 Bacteria 795
122 Ga0207652_11841952 3300025921 Unclassified 510
123 Ga0207694_10144128 3300025924 Bacteria 1916
124 Ga0207694_10913773 3300025924 Bacteria 742
125 Ga0207659_10295510 3300025926 Bacteria 1329
126 Ga0207664_10293999 3300025929 Bacteria 1428
127 Ga0207644_11484082 3300025931 Bacteria 569
128 Ga0207706_10441152 3300025933 Bacteria 1127
129 Ga0207686_11683668 3300025934 Bacteria 524
130 Ga0207709_11363206 3300025935 Bacteria 587
131 Ga0207709_11433992 3300025935 Bacteria 572
132 Ga0207670_11646309 3300025936 Bacteria 546
133 Ga0207669_10082066 3300025937 Bacteria 2068
134 Ga0207669_10719619 3300025937 Bacteria 822
135 Ga0207669_10839317 3300025937 Bacteria 764
136 Ga0207691_10022424 3300025940 Bacteria 5954
137 Ga0207711_10020025 3300025941 Bacteria 5576
138 Ga0207689_10345763 3300025942 Bacteria 1236
139 Ga0207667_10276382 3300025949 Bacteria 1717
140 Ga0207667_10829619 3300025949 Bacteria 920
141 Ga0207651_11394193 3300025960 Bacteria 631
142 Ga0207712_11046972 3300025961 Bacteria 725
143 Ga0207668_11023783 3300025972 Unclassified 739
144 Ga0207668_12047501 3300025972 Bacteria 516
145 Ga0207677_10719932 3300026023 Bacteria 887
146 Ga0207703_10774048 3300026035 Bacteria 915
147 Ga0207703_10786721 3300026035 Bacteria 908
148 Ga0207639_11785550 3300026041 Bacteria 576
149 Ga0207678_10793057 3300026067 Bacteria 836
150 Ga0207678_11797361 3300026067 Bacteria 537
151 Ga0207708_10580462 3300026075 Bacteria 948
152 Ga0207708_11397633 3300026075 Bacteria 614
153 Ga0207641_10192136 3300026088 Bacteria 1877
154 Ga0207648_10892824 3300026089 Bacteria 830
155 Ga0207674_11028283 3300026116 Bacteria 793
156 Ga0207675_100699562 3300026118 Unclassified 1022
157 Ga0207675_101251625 3300026118 Bacteria 762
158 Ga0207683_10134419 3300026121 Bacteria 2226
159 Ga0207683_10907448 3300026121 Unclassified 818
160 Ga0207698_10512809 3300026142 Unclassified 1169
161 Ga0268266_10134719 3300028379 Bacteria 2212
162 Ga0268265_11788129 3300028380 Bacteria 621
163 Ga0268264_10217308 3300028381 Bacteria 1758
164 Ga0265325_10008050 3300031241 Bacteria 6249
165 Ga0265325_10138625 3300031241 Bacteria 1158
166 Ga0265325_10303989 3300031241 Unclassified 711
167 Ga0307408_101206355 3300031548 Bacteria 706
168 Ga0307409_101127618 3300031995 Bacteria 806
169 Ga0307416_100688231 3300032002 Bacteria 1111
170 Ga0307411_11005022 3300032005 Bacteria 747
171 Ga0307411_11612255 3300032005 Bacteria 599
172 Ga0373959_0083317 3300034820 Bacteria 740
173 Ga0373938_0178951 3300034957 Bacteria 578
174 Ga0373926_0157186 3300035083 Bacteria 867
175 Ga0373949_0081139 3300035090 Bacteria 865
176 Ga0373949_0307069 3300035090 Bacteria 505
177 Ga0373951_0049056 3300035091 Bacteria 1035
178 Ga0373952_0004343 3300035092 Bacteria 2570
179 Ga0373932_0039586 3300035112 Bacteria 1353
180 Ga0373936_0289130 3300035113 Bacteria 738
181 Ga0373939_0011689 3300035114 Bacteria 2222
182 Ga0373939_0370778 3300035114 Unclassified 587
183 Ga0373941_0064052 3300035115 Bacteria 1204
184 Ga0373945_0180908 3300035116 Bacteria 868
185 Ga0373943_0125496 3300035170 Bacteria 1368
186 Ga0373943_0181109 3300035170 Bacteria 1158
187 Ga0373943_0900731 3300035170 Bacteria 528
188 Ga0373946_0186386 3300035171 Bacteria 987
189 Ga0373946_0304618 3300035171 Bacteria 789
190 Ga0373961_0007255 3300035241 Bacteria 2680
191 Ga0373961_0122341 3300035241 Bacteria 864
192 Ga0373962_0106959 3300035242 Bacteria 878
193 Ga0373931_0014618 3300035691 Bacteria 3840
194 Ga0373931_0139155 3300035691 Bacteria 1404
195 Ga0373931_0343021 3300035691 Bacteria 933
196 Ga0373935_0029893 3300035692 Bacteria 3374
197 Ga0373935_0627075 3300035692 Bacteria 787
198 Ga0373927_0093763 3300035695 Bacteria 1951
199 Ga0373927_0218735 3300035695 Bacteria 1251
200 Ga0373927_0247316 3300035695 Bacteria 1172
201 Ga0373947_0100896 3300035725 Bacteria 1814
202 Ga0373937_0283100 3300036401 Bacteria 1566
203 Ga0373937_0528496 3300036401 Bacteria 1121
204 Ga0373937_1528860 3300036401 Bacteria 615
205 Ga0373925_0090103 3300037068 Bacteria 2344
206 Ga0373925_0098042 3300037068 Bacteria 2249
207 Ga0373925_0235261 3300037068 Bacteria 1466
208 Ga0373925_0831199 3300037068 Bacteria 761
209 Ga0436364_0559613 3300037853 Bacteria 555
210 Ga0436365_0321040 3300039437 Bacteria 699
211 Ga0436360_0171171 3300039438 Bacteria 1164
212 Ga0436360_0347445 3300039438 Bacteria 2131
213 Ga0436360_0645302 3300039438 Bacteria 913
214 Ga0436360_1098614 3300039438 Bacteria 1317
215 Ga0436361_0020616 3300039447 Bacteria 2325
216 Ga0436361_0246165 3300039447 Bacteria 1599
217 Ga0436361_0611997 3300039447 Bacteria 882
218 Ga0436361_0996782 3300039447 Bacteria 1134
219 Ga0436363_0821371 3300039450 Bacteria 1211
220 Ga0436363_0887612 3300039450 Bacteria 1809
221 Ga0436363_1311968 3300039450 Bacteria 966
222 Ga0436362_0910674 3300039453 Bacteria 843
223 Ga0439453_0002946 3300041408 Bacteria 2403
224 Ga0439453_0069525 3300041408 Bacteria 743
225 Ga0451793_1349049 3300041452 Bacteria 707
226 Ga0439446_0102307 3300042156 Bacteria 907
227 Ga0439459_0080923 3300042438 Bacteria 767
228 Ga0466966_0161949 3300044684 Bacteria 1362
229 Ga0466963_0744601 3300044694 Bacteria 691
230 Ga0466970_0149822 3300044765 Bacteria 1288
231 Ga0495603_0387532 3300046455 Bacteria 801
232 Ga0495641_0299616 3300046461 Bacteria 725
233 Ga0495580_0670241 3300046472 Bacteria 681
234 Ga0495596_0288023 3300046500 Unclassified 638
235 Ga0495630_0278162 3300046517 Bacteria 1279
236 Ga0495631_0314053 3300046518 Bacteria 667
237 Ga0495631_0437237 3300046518 Unclassified 557
238 Ga0495663_0110802 3300046525 Bacteria 912
239 Ga0495665_0335736 3300046531 Bacteria 771
240 Ga0495586_0835777 3300046535 Bacteria 531
241 Ga0495656_0641578 3300046615 Bacteria 570
242 Ga0495656_0798274 3300046615 Unclassified 510
243 Ga0495635_0929490 3300046663 Bacteria 556
244 Ga0495588_0179158 3300046674 Bacteria 1120
245 Ga0495647_0494071 3300046681 Bacteria 569
246 Ga0495658_0342227 3300046683 Bacteria 950
247 Ga0495600_0325544 3300046809 Bacteria 966
248 Ga0495676_0354148 3300047321 Bacteria 981
249 Ga0495675_0682368 3300047444 Bacteria 576
250 Ga0495602_0204501 3300048088 Bacteria 1504
251 Ga0495602_1165508 3300048088 Archaea 503
252 Ga0496100_0084592 3300048903 Bacteria 2150
253 Ga0496101_0032877 3300048904 Bacteria 3654
254 Ga0496102_0029995 3300048905 Bacteria 4867
255 Ga0496104_0006788 3300048907 Bacteria 10081
256 Ga0496105_0080327 3300048908 Bacteria 2693
257 Ga0496106_0166480 3300048909 Bacteria 1745
258 Ga0496106_0962129 3300048909 Bacteria 673
259 Ga0496107_0526914 3300048910 Bacteria 876
260 Ga0496108_0087099 3300048911 Bacteria 2652
261 Ga0496109_0064990 3300048912 Bacteria 3340
262 Ga0496110_0016791 3300048913 Bacteria 6116
263 Ga0496111_0234168 3300048914 Bacteria 1364
264 Ga0496111_0279821 3300048914 Bacteria 1237
265 Ga0496112_0516526 3300048915 Bacteria 1129
266 Ga0496112_1045953 3300048915 Bacteria 735
267 Ga0496113_0141634 3300048916 Bacteria 1892
268 Ga0496114_0421076 3300048917 Unclassified 1183
269 Ga0496114_0474812 3300048917 Bacteria 1106
270 Ga0496115_0231251 3300048918 Bacteria 1524
271 Ga0501033_0106834 3300049570 Bacteria 2039
272 Ga0501033_1126889 3300049570 Bacteria 521
273 Ga0501034_0636637 3300049571 Bacteria 969
274 Ga0501034_0657986 3300049571 Bacteria 949
275 Ga0501034_1215825 3300049571 Bacteria 632
276 Ga0501036_0133780 3300049572 Bacteria 2093
277 Ga0501036_0985576 3300049572 Bacteria 690
278 Ga0501037_0235097 3300049573 Bacteria 1286
279 Ga0501038_0140104 3300049574 Bacteria 1979
280 Ga0501039_0162008 3300049575 Bacteria 1758
281 Ga0501040_0697523 3300049576 Bacteria 734
282 Ga0501042_0051665 3300049578 Bacteria 2932
283 Ga0501043_0706022 3300049579 Bacteria 736
284 Ga0501046_0269789 3300049580 Bacteria 1248
285 Ga0501047_0004391 3300049581 Bacteria 13273
286 Ga0501047_0796705 3300049581 Bacteria 760
287 Ga0501048_0202326 3300049582 Bacteria 1408
288 Ga0501048_0291952 3300049582 Unclassified 1160
289 Ga0501067_0440674 3300049583 Unclassified 727
290 Ga0501070_0019110 3300049586 Bacteria 5747
291 Ga0501070_0606452 3300049586 Bacteria 872
292 Ga0501071_0152367 3300049587 Bacteria 1725
293 Ga0501074_0238448 3300049590 Bacteria 1294
294 Ga0501075_0204680 3300049591 Bacteria 1505
295 Ga0501076_0012518 3300049592 Bacteria 6345
296 Ga0501077_0131345 3300049593 Bacteria 1588
297 Ga0501080_0362361 3300049742 Bacteria 1308
298 Ga0501080_0380818 3300049742 Bacteria 1271
299 Ga0501080_0789591 3300049742 Bacteria 833
300 Ga0501081_0768217 3300049743 Bacteria 724
301 Ga0501083_1111166 3300049744 Bacteria 514
302 Ga0501044_0054052 3300049823 Bacteria 4129
303 Ga0501044_0347521 3300049823 Bacteria 1403
304 Ga0501044_0590003 3300049823 Bacteria 1005
305 Ga0501045_0301725 3300049824 Bacteria 1192
306 nmdc:mga03683_260538_c1 3300050489 Bacteria 807
307 nmdc:mga03n38_319531_c1 3300050490 Bacteria 838
308 nmdc:mga03n38_581919_c1 3300050490 Unclassified 636
309 nmdc:mga00v17_803823_c1 3300050491 Bacteria 599
310 nmdc:mga0yw44_182230_c1 3300050492 Bacteria 1383
311 nmdc:mga0yw44_20495_c1 3300050492 Bacteria 3670
312 nmdc:mga0k408_9179_c1 3300050493 Bacteria 5330
313 nmdc:mga06z11_126574_c1 3300050494 Bacteria 1430
314 nmdc:mga06z11_267468_c1 3300050494 Bacteria 1010
315 nmdc:mga06z11_657777_c1 3300050494 Bacteria 638
316 nmdc:mga05p37_1377588_c1 3300050507 Bacteria 712
317 nmdc:mga08y16_1000020_c1 3300050511 Bacteria 816
318 nmdc:mga0rr50_1333629_c1 3300050513 Bacteria 608
319 nmdc:mga0rr50_232491_c1 3300050513 Bacteria 1526
320 nmdc:mga0sz30_474255_c1 3300050516 Bacteria 562
321 nmdc:mga0sz30_555590_c1 3300050516 Bacteria 518
322 Ga0495601_0445115 3300053077 Bacteria 838
323 Ga0495655_0099326 3300053083 Bacteria 860
324 Ga0495595_0026812 3300053084 Bacteria 2563
325 Ga0495619_0058285 3300053085 Bacteria 2563
326 Ga0495619_0885672 3300053085 Bacteria 601
327 Ga0500642_0154648 3300053130 Bacteria 1076
328 Ga0500568_0265075 3300053139 Bacteria 625
329 Ga0501084_0229122 3300054114 Bacteria 1568
330 Ga0501084_1842219 3300054114 Unclassified 505
331 Ga0590075_019997 3300059424 Bacteria 1666
332 Ga0501082_0138986 3300060353 Bacteria 2108
333 Ga0501082_0167917 3300060353 Bacteria 1907
334 Ga0501082_0760102 3300060353 Bacteria 848
335 Ga0501082_0805360 3300060353 Bacteria 822
336 Ga0530510_0834866 3300061734 Bacteria 703

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041452 Ga0451793_1349049 Ga0451793_1349049_77_376 76
2 3300005338 Ga0068868_100222577 Ga0068868_1002225772 80
3 3300005354 Ga0070675_100349642 Ga0070675_1003496422 80
4 3300005356 Ga0070674_100008901 Ga0070674_1000089012 80
5 3300005365 Ga0070688_100193370 Ga0070688_1001933702 80
6 3300005457 Ga0070662_100537755 Ga0070662_1005377552 80
7 3300005459 Ga0068867_100211232 Ga0068867_1002112322 80
8 3300005564 Ga0070664_100737485 Ga0070664_1007374852 80
9 3300009094 Ga0111539_11756618 Ga0111539_117566182 80
10 3300009176 Ga0105242_10399791 Ga0105242_103997913 80
11 3300013306 Ga0163162_10481370 Ga0163162_104813702 80
12 3300013308 Ga0157375_10716039 Ga0157375_107160393 80
13 3300014325 Ga0163163_11243184 Ga0163163_112431842 80
14 3300014326 Ga0157380_10128760 Ga0157380_101287603 80
15 3300017792 Ga0163161_10077932 Ga0163161_100779322 80
16 3300025899 Ga0207642_10041443 Ga0207642_100414432 80
17 3300025926 Ga0207659_10295510 Ga0207659_102955102 80
18 3300025933 Ga0207706_10441152 Ga0207706_104411522 80
19 3300025934 Ga0207686_11683668 Ga0207686_116836682 80
20 3300025937 Ga0207669_10082066 Ga0207669_100820662 80
21 3300026023 Ga0207677_10719932 Ga0207677_107199322 80
22 3300026089 Ga0207648_10892824 Ga0207648_108928242 80
23 3300026121 Ga0207683_10134419 Ga0207683_101344194 80
24 3300005718 Ga0068866_10206866 Ga0068866_102068662 81
25 3300005539 Ga0068853_102229857 Ga0068853_1022298571 83
26 3300005563 Ga0068855_100841195 Ga0068855_1008411952 83
27 3300005616 Ga0068852_102334084 Ga0068852_1023340842 83
28 3300009093 Ga0105240_11795114 Ga0105240_117951142 83
29 3300025913 Ga0207695_10774628 Ga0207695_107746282 83
30 3300009093 Ga0105240_10927386 Ga0105240_109273861 84
31 3300031241 Ga0265325_10008050 Ga0265325_100080509 86
32 3300006852 Ga0075433_11167025 Ga0075433_111670252 87
33 3300007076 Ga0075435_100114232 Ga0075435_1001142323 87
34 3300050513 nmdc:mga0rr50_232491_c1 nmdc:mga0rr50_232491_c1_212_511 87
35 3300039450 Ga0436363_0887612 Ga0436363_0887612_600_899 88
36 3300048909 Ga0496106_0962129 Ga0496106_0962129_234_533 88
37 3300050513 nmdc:mga0rr50_1333629_c1 nmdc:mga0rr50_1333629_c1_280_579 88
38 3300005544 Ga0070686_100586472 Ga0070686_1005864722 89
39 3300005981 Ga0081538_10024567 Ga0081538_100245672 89
40 3300005545 Ga0070695_100920981 Ga0070695_1009209812 90
41 3300006028 Ga0070717_10744925 Ga0070717_107449252 90
42 3300025915 Ga0207693_10880356 Ga0207693_108803562 90
43 3300048914 Ga0496111_0234168 Ga0496111_0234168_709_1005 90
44 3300048915 Ga0496112_0516526 Ga0496112_0516526_191_487 90
45 3300025949 Ga0207667_10829619 Ga0207667_108296192 93
46 3300026075 Ga0207708_11397633 Ga0207708_113976332 93
47 3300005329 Ga0070683_101858811 Ga0070683_1018588111 94
48 3300005616 Ga0068852_100687436 Ga0068852_1006874362 94
49 3300014969 Ga0157376_11663792 Ga0157376_116637922 94
50 3300026121 Ga0207683_10907448 Ga0207683_109074482 94
51 3300026142 Ga0207698_10512809 Ga0207698_105128092 94
52 3300048917 Ga0496114_0421076 Ga0496114_0421076_467_766 94
53 3300036401 Ga0373937_1528860 Ga0373937_1528860_128_418 95
54 3300044684 Ga0466966_0161949 Ga0466966_0161949_640_930 96
55 3300044765 Ga0466970_0149822 Ga0466970_0149822_121_411 96
56 3300046535 Ga0495586_0835777 Ga0495586_0835777_12_308 96
57 3300060353 Ga0501082_0760102 Ga0501082_0760102_58_348 96
58 3300003659 JGI25404J52841_10009743 JGI25404J52841_100097432 97
59 3300005434 Ga0070709_10129701 Ga0070709_101297012 97
60 3300005435 Ga0070714_100824751 Ga0070714_1008247511 97
61 3300005436 Ga0070713_100869902 Ga0070713_1008699021 97
62 3300005983 Ga0081540_1000241 Ga0081540_100024118 97
63 3300009093 Ga0105240_11368726 Ga0105240_113687261 97
64 3300009093 Ga0105240_12291675 Ga0105240_122916752 97
65 3300009545 Ga0105237_10094208 Ga0105237_100942082 97
66 3300009551 Ga0105238_10028399 Ga0105238_100283993 97
67 3300021361 Ga0213872_10111228 Ga0213872_101112282 97
68 3300021441 Ga0213871_10057160 Ga0213871_100571602 97
69 3300025906 Ga0207699_10169041 Ga0207699_101690413 97
70 3300025924 Ga0207694_10144128 Ga0207694_101441282 97
71 3300025929 Ga0207664_10293999 Ga0207664_102939992 97
72 3300026041 Ga0207639_11785550 Ga0207639_117855502 97
73 3300036401 Ga0373937_0528496 Ga0373937_0528496_470_763 97
74 3300039438 Ga0436360_0171171 Ga0436360_0171171_748_1044 97
75 3300039438 Ga0436360_0645302 Ga0436360_0645302_81_377 97
76 3300039438 Ga0436360_1098614 Ga0436360_1098614_43_339 97
77 3300039447 Ga0436361_0246165 Ga0436361_0246165_152_448 97
78 3300039447 Ga0436361_0996782 Ga0436361_0996782_24_320 97
79 3300039450 Ga0436363_1311968 Ga0436363_1311968_198_491 97
80 3300039453 Ga0436362_0910674 Ga0436362_0910674_15_311 97
81 3300048088 Ga0495602_1165508 Ga0495602_1165508_154_447 97
82 3300005336 Ga0070680_100916951 Ga0070680_1009169512 98
83 3300005530 Ga0070679_100006790 Ga0070679_1000067904 98
84 3300005548 Ga0070665_100474443 Ga0070665_1004744432 98
85 3300005563 Ga0068855_100117854 Ga0068855_1001178542 98
86 3300005842 Ga0068858_101670892 Ga0068858_1016708922 98
87 3300005843 Ga0068860_100965356 Ga0068860_1009653562 98
88 3300006178 Ga0075367_10582690 Ga0075367_105826902 98
89 3300006186 Ga0075369_10217970 Ga0075369_102179702 98
90 3300009098 Ga0105245_10868021 Ga0105245_108680212 98
91 3300009148 Ga0105243_11492637 Ga0105243_114926371 98
92 3300009545 Ga0105237_11510335 Ga0105237_115103352 98
93 3300009551 Ga0105238_10011652 Ga0105238_100116528 98
94 3300009553 Ga0105249_11353637 Ga0105249_113536372 98
95 3300010375 Ga0105239_10096454 Ga0105239_100964544 98
96 3300013296 Ga0157374_10029538 Ga0157374_100295384 98
97 3300013297 Ga0157378_12241286 Ga0157378_122412861 98
98 3300014325 Ga0163163_12273926 Ga0163163_122739262 98
99 3300025914 Ga0207671_10093352 Ga0207671_100933522 98
100 3300025921 Ga0207652_11841952 Ga0207652_118419521 98
101 3300025924 Ga0207694_10913773 Ga0207694_109137732 98
102 3300025935 Ga0207709_11363206 Ga0207709_113632062 98
103 3300025949 Ga0207667_10276382 Ga0207667_102763822 98
104 3300025961 Ga0207712_11046972 Ga0207712_110469722 98
105 3300026035 Ga0207703_10786721 Ga0207703_107867211 98
106 3300026088 Ga0207641_10192136 Ga0207641_101921362 98
107 3300026118 Ga0207675_100699562 Ga0207675_1006995622 98
108 3300028379 Ga0268266_10134719 Ga0268266_101347192 98
109 3300028381 Ga0268264_10217308 Ga0268264_102173082 98
110 3300037853 Ga0436364_0559613 Ga0436364_0559613_211_507 98
111 3300039437 Ga0436365_0321040 Ga0436365_0321040_199_495 98
112 3300039447 Ga0436361_0020616 Ga0436361_0020616_1182_1478 98
113 3300044694 Ga0466963_0744601 Ga0466963_0744601_248_544 98
114 3300049583 Ga0501067_0440674 Ga0501067_0440674_52_348 98
115 3300049823 Ga0501044_0590003 Ga0501044_0590003_396_695 98
116 3300050516 nmdc:mga0sz30_555590_c1 nmdc:mga0sz30_555590_c1_65_361 98
117 3300005328 Ga0070676_10350351 Ga0070676_103503511 99
118 3300005329 Ga0070683_100954905 Ga0070683_1009549051 99
119 3300005337 Ga0070682_101939147 Ga0070682_1019391471 99
120 3300005343 Ga0070687_100838070 Ga0070687_1008380701 99
121 3300005356 Ga0070674_100076281 Ga0070674_1000762812 99
122 3300005365 Ga0070688_100554981 Ga0070688_1005549812 99
123 3300005439 Ga0070711_100908138 Ga0070711_1009081382 99
124 3300005455 Ga0070663_100370667 Ga0070663_1003706673 99
125 3300005458 Ga0070681_10544307 Ga0070681_105443072 99
126 3300005535 Ga0070684_101550052 Ga0070684_1015500522 99
127 3300005543 Ga0070672_100079776 Ga0070672_1000797764 99
128 3300005546 Ga0070696_101427612 Ga0070696_1014276122 99
129 3300005547 Ga0070693_100107841 Ga0070693_1001078411 99
130 3300005548 Ga0070665_100729745 Ga0070665_1007297452 99
131 3300005614 Ga0068856_102228046 Ga0068856_1022280461 99
132 3300005842 Ga0068858_101107403 Ga0068858_1011074032 99
133 3300005937 Ga0081455_10060109 Ga0081455_100601093 99
134 3300006038 Ga0075365_10120536 Ga0075365_101205362 99
135 3300006042 Ga0075368_10207057 Ga0075368_102070572 99
136 3300006048 Ga0075363_100406730 Ga0075363_1004067302 99
137 3300006175 Ga0070712_100615694 Ga0070712_1006156942 99
138 3300006178 Ga0075367_10113548 Ga0075367_101135482 99
139 3300006178 Ga0075367_10333322 Ga0075367_103333222 99
140 3300006195 Ga0075366_10029106 Ga0075366_100291062 99
141 3300006358 Ga0068871_100309708 Ga0068871_1003097082 99
142 3300006358 Ga0068871_100491929 Ga0068871_1004919292 99
143 3300009147 Ga0114129_10691177 Ga0114129_106911772 99
144 3300009148 Ga0105243_11495885 Ga0105243_114958851 99
145 3300009177 Ga0105248_10109951 Ga0105248_101099514 99
146 3300009177 Ga0105248_11025015 Ga0105248_110250152 99
147 3300009553 Ga0105249_10468473 Ga0105249_104684732 99
148 3300010159 Ga0099796_10183709 Ga0099796_101837092 99
149 3300013306 Ga0163162_10415861 Ga0163162_104158613 99
150 3300013306 Ga0163162_10417533 Ga0163162_104175332 99
151 3300013306 Ga0163162_10876508 Ga0163162_108765082 99
152 3300013306 Ga0163162_12438296 Ga0163162_124382961 99
153 3300013308 Ga0157375_12058974 Ga0157375_120589742 99
154 3300013308 Ga0157375_12869603 Ga0157375_128696032 99
155 3300014326 Ga0157380_12025775 Ga0157380_120257752 99
156 3300014326 Ga0157380_12704429 Ga0157380_127044292 99
157 3300014968 Ga0157379_11684013 Ga0157379_116840132 99
158 3300014969 Ga0157376_11853894 Ga0157376_118538942 99
159 3300014969 Ga0157376_12580494 Ga0157376_125804942 99
160 3300021361 Ga0213872_10240180 Ga0213872_102401802 99
161 3300025903 Ga0207680_10144595 Ga0207680_101445952 99
162 3300025907 Ga0207645_11126368 Ga0207645_111263682 99
163 3300025909 Ga0207705_10821402 Ga0207705_108214021 99
164 3300025912 Ga0207707_10406911 Ga0207707_104069112 99
165 3300025916 Ga0207663_10572170 Ga0207663_105721702 99
166 3300025918 Ga0207662_10555485 Ga0207662_105554852 99
167 3300025931 Ga0207644_11484082 Ga0207644_114840822 99
168 3300025935 Ga0207709_11433992 Ga0207709_114339921 99
169 3300025936 Ga0207670_11646309 Ga0207670_116463091 99
170 3300025937 Ga0207669_10719619 Ga0207669_107196192 99
171 3300025937 Ga0207669_10839317 Ga0207669_108393172 99
172 3300025940 Ga0207691_10022424 Ga0207691_100224244 99
173 3300025941 Ga0207711_10020025 Ga0207711_100200252 99
174 3300025942 Ga0207689_10345763 Ga0207689_103457632 99
175 3300025960 Ga0207651_11394193 Ga0207651_113941932 99
176 3300025972 Ga0207668_12047501 Ga0207668_120475011 99
177 3300026035 Ga0207703_10774048 Ga0207703_107740482 99
178 3300026067 Ga0207678_10793057 Ga0207678_107930572 99
179 3300026067 Ga0207678_11797361 Ga0207678_117973612 99
180 3300026116 Ga0207674_11028283 Ga0207674_110282832 99
181 3300028380 Ga0268265_11788129 Ga0268265_117881292 99
182 3300031241 Ga0265325_10138625 Ga0265325_101386252 99
183 3300031241 Ga0265325_10303989 Ga0265325_103039892 99
184 3300032005 Ga0307411_11005022 Ga0307411_110050222 99
185 3300034820 Ga0373959_0083317 Ga0373959_0083317_116_415 99
186 3300034957 Ga0373938_0178951 Ga0373938_0178951_74_373 99
187 3300035083 Ga0373926_0157186 Ga0373926_0157186_537_836 99
188 3300035090 Ga0373949_0081139 Ga0373949_0081139_12_311 99
189 3300035090 Ga0373949_0307069 Ga0373949_0307069_151_450 99
190 3300035091 Ga0373951_0049056 Ga0373951_0049056_146_445 99
191 3300035092 Ga0373952_0004343 Ga0373952_0004343_2067_2366 99
192 3300035112 Ga0373932_0039586 Ga0373932_0039586_347_646 99
193 3300035113 Ga0373936_0289130 Ga0373936_0289130_234_533 99
194 3300035114 Ga0373939_0011689 Ga0373939_0011689_1290_1589 99
195 3300035114 Ga0373939_0370778 Ga0373939_0370778_13_312 99
196 3300035115 Ga0373941_0064052 Ga0373941_0064052_829_1128 99
197 3300035116 Ga0373945_0180908 Ga0373945_0180908_270_569 99
198 3300035170 Ga0373943_0125496 Ga0373943_0125496_447_746 99
199 3300035170 Ga0373943_0181109 Ga0373943_0181109_368_667 99
200 3300035170 Ga0373943_0900731 Ga0373943_0900731_205_504 99
201 3300035171 Ga0373946_0186386 Ga0373946_0186386_69_368 99
202 3300035171 Ga0373946_0304618 Ga0373946_0304618_472_771 99
203 3300035241 Ga0373961_0007255 Ga0373961_0007255_496_795 99
204 3300035241 Ga0373961_0122341 Ga0373961_0122341_320_619 99
205 3300035242 Ga0373962_0106959 Ga0373962_0106959_206_505 99
206 3300035691 Ga0373931_0014618 Ga0373931_0014618_1661_1960 99
207 3300035691 Ga0373931_0139155 Ga0373931_0139155_460_759 99
208 3300035691 Ga0373931_0343021 Ga0373931_0343021_374_673 99
209 3300035692 Ga0373935_0029893 Ga0373935_0029893_2008_2307 99
210 3300035692 Ga0373935_0627075 Ga0373935_0627075_64_363 99
211 3300035695 Ga0373927_0093763 Ga0373927_0093763_1306_1605 99
212 3300035695 Ga0373927_0218735 Ga0373927_0218735_916_1215 99
213 3300035695 Ga0373927_0247316 Ga0373927_0247316_235_534 99
214 3300035725 Ga0373947_0100896 Ga0373947_0100896_1203_1502 99
215 3300036401 Ga0373937_0283100 Ga0373937_0283100_454_753 99
216 3300037068 Ga0373925_0090103 Ga0373925_0090103_16_315 99
217 3300037068 Ga0373925_0098042 Ga0373925_0098042_1794_2093 99
218 3300037068 Ga0373925_0235261 Ga0373925_0235261_1130_1429 99
219 3300037068 Ga0373925_0831199 Ga0373925_0831199_168_467 99
220 3300039438 Ga0436360_0347445 Ga0436360_0347445_95_394 99
221 3300039447 Ga0436361_0611997 Ga0436361_0611997_221_520 99
222 3300039450 Ga0436363_0821371 Ga0436363_0821371_395_694 99
223 3300041408 Ga0439453_0002946 Ga0439453_0002946_314_613 99
224 3300042156 Ga0439446_0102307 Ga0439446_0102307_310_609 99
225 3300042438 Ga0439459_0080923 Ga0439459_0080923_119_418 99
226 3300046455 Ga0495603_0387532 Ga0495603_0387532_329_628 99
227 3300046461 Ga0495641_0299616 Ga0495641_0299616_130_429 99
228 3300046472 Ga0495580_0670241 Ga0495580_0670241_20_319 99
229 3300046500 Ga0495596_0288023 Ga0495596_0288023_250_549 99
230 3300046517 Ga0495630_0278162 Ga0495630_0278162_882_1181 99
231 3300046518 Ga0495631_0314053 Ga0495631_0314053_242_541 99
232 3300046518 Ga0495631_0437237 Ga0495631_0437237_32_331 99
233 3300046525 Ga0495663_0110802 Ga0495663_0110802_492_791 99
234 3300046531 Ga0495665_0335736 Ga0495665_0335736_53_352 99
235 3300046615 Ga0495656_0641578 Ga0495656_0641578_39_338 99
236 3300046615 Ga0495656_0798274 Ga0495656_0798274_144_443 99
237 3300046663 Ga0495635_0929490 Ga0495635_0929490_176_475 99
238 3300046674 Ga0495588_0179158 Ga0495588_0179158_334_633 99
239 3300046681 Ga0495647_0494071 Ga0495647_0494071_180_479 99
240 3300046683 Ga0495658_0342227 Ga0495658_0342227_198_497 99
241 3300046809 Ga0495600_0325544 Ga0495600_0325544_186_485 99
242 3300047321 Ga0495676_0354148 Ga0495676_0354148_52_351 99
243 3300047444 Ga0495675_0682368 Ga0495675_0682368_146_445 99
244 3300048088 Ga0495602_0204501 Ga0495602_0204501_595_894 99
245 3300048903 Ga0496100_0084592 Ga0496100_0084592_1755_2054 99
246 3300048904 Ga0496101_0032877 Ga0496101_0032877_2655_2954 99
247 3300048905 Ga0496102_0029995 Ga0496102_0029995_2816_3115 99
248 3300048907 Ga0496104_0006788 Ga0496104_0006788_8016_8315 99
249 3300048908 Ga0496105_0080327 Ga0496105_0080327_1635_1934 99
250 3300048909 Ga0496106_0166480 Ga0496106_0166480_755_1054 99
251 3300048910 Ga0496107_0526914 Ga0496107_0526914_430_729 99
252 3300048911 Ga0496108_0087099 Ga0496108_0087099_1936_2235 99
253 3300048912 Ga0496109_0064990 Ga0496109_0064990_1413_1712 99
254 3300048913 Ga0496110_0016791 Ga0496110_0016791_1066_1365 99
255 3300048914 Ga0496111_0279821 Ga0496111_0279821_247_546 99
256 3300048915 Ga0496112_1045953 Ga0496112_1045953_321_620 99
257 3300048916 Ga0496113_0141634 Ga0496113_0141634_230_529 99
258 3300048917 Ga0496114_0474812 Ga0496114_0474812_747_1046 99
259 3300048918 Ga0496115_0231251 Ga0496115_0231251_511_810 99
260 3300049571 Ga0501034_0636637 Ga0501034_0636637_251_550 99
261 3300049581 Ga0501047_0796705 Ga0501047_0796705_364_663 99
262 3300049742 Ga0501080_0789591 Ga0501080_0789591_409_708 99
263 3300049744 Ga0501083_1111166 Ga0501083_1111166_95_394 99
264 3300050490 nmdc:mga03n38_581919_c1 nmdc:mga03n38_581919_c1_217_516 99
265 3300050492 nmdc:mga0yw44_182230_c1 nmdc:mga0yw44_182230_c1_648_947 99
266 3300050493 nmdc:mga0k408_9179_c1 nmdc:mga0k408_9179_c1_212_511 99
267 3300050494 nmdc:mga06z11_126574_c1 nmdc:mga06z11_126574_c1_659_958 99
268 3300050494 nmdc:mga06z11_267468_c1 nmdc:mga06z11_267468_c1_606_905 99
269 3300050507 nmdc:mga05p37_1377588_c1 nmdc:mga05p37_1377588_c1_367_666 99
270 3300053077 Ga0495601_0445115 Ga0495601_0445115_439_738 99
271 3300053083 Ga0495655_0099326 Ga0495655_0099326_387_686 99
272 3300053084 Ga0495595_0026812 Ga0495595_0026812_679_978 99
273 3300053085 Ga0495619_0058285 Ga0495619_0058285_1088_1387 99
274 3300053085 Ga0495619_0885672 Ga0495619_0885672_173_472 99
275 3300054114 Ga0501084_1842219 Ga0501084_1842219_81_386 99
276 3300060353 Ga0501082_0138986 Ga0501082_0138986_1278_1577 99
277 3300060353 Ga0501082_0805360 Ga0501082_0805360_19_324 99
278 3300003215 JGI25153J46596_10001652 JGI25153J46596_100016522 100
279 3300005365 Ga0070688_100878003 Ga0070688_1008780031 100
280 3300005441 Ga0070700_100501197 Ga0070700_1005011971 100
281 3300005985 Ga0081539_10117858 Ga0081539_101178582 100
282 3300006038 Ga0075365_10014433 Ga0075365_100144333 100
283 3300006048 Ga0075363_100221649 Ga0075363_1002216492 100
284 3300025297 Ga0209758_1000469 Ga0209758_100046967 100
285 3300025297 Ga0209758_1119615 Ga0209758_11196152 100
286 3300025302 Ga0207426_1063807 Ga0207426_10638072 100
287 3300025972 Ga0207668_11023783 Ga0207668_110237832 100
288 3300026075 Ga0207708_10580462 Ga0207708_105804622 100
289 3300026118 Ga0207675_101251625 Ga0207675_1012516252 100
290 3300031548 Ga0307408_101206355 Ga0307408_1012063552 100
291 3300031995 Ga0307409_101127618 Ga0307409_1011276182 100
292 3300032002 Ga0307416_100688231 Ga0307416_1006882311 100
293 3300032005 Ga0307411_11612255 Ga0307411_116122552 100
294 3300041408 Ga0439453_0069525 Ga0439453_0069525_121_423 100
295 3300049570 Ga0501033_0106834 Ga0501033_0106834_232_534 100
296 3300049570 Ga0501033_1126889 Ga0501033_1126889_183_485 100
297 3300049571 Ga0501034_0657986 Ga0501034_0657986_423_725 100
298 3300049571 Ga0501034_1215825 Ga0501034_1215825_32_337 100
299 3300049572 Ga0501036_0133780 Ga0501036_0133780_152_454 100
300 3300049572 Ga0501036_0985576 Ga0501036_0985576_332_640 100
301 3300049573 Ga0501037_0235097 Ga0501037_0235097_28_336 100
302 3300049574 Ga0501038_0140104 Ga0501038_0140104_354_656 100
303 3300049575 Ga0501039_0162008 Ga0501039_0162008_454_762 100
304 3300049576 Ga0501040_0697523 Ga0501040_0697523_16_324 100
305 3300049578 Ga0501042_0051665 Ga0501042_0051665_439_747 100
306 3300049579 Ga0501043_0706022 Ga0501043_0706022_409_711 100
307 3300049580 Ga0501046_0269789 Ga0501046_0269789_287_589 100
308 3300049581 Ga0501047_0004391 Ga0501047_0004391_4046_4348 100
309 3300049582 Ga0501048_0202326 Ga0501048_0202326_891_1193 100
310 3300049582 Ga0501048_0291952 Ga0501048_0291952_736_1044 100
311 3300049586 Ga0501070_0019110 Ga0501070_0019110_3478_3780 100
312 3300049586 Ga0501070_0606452 Ga0501070_0606452_321_629 100
313 3300049587 Ga0501071_0152367 Ga0501071_0152367_1224_1532 100
314 3300049590 Ga0501074_0238448 Ga0501074_0238448_31_339 100
315 3300049591 Ga0501075_0204680 Ga0501075_0204680_1080_1388 100
316 3300049592 Ga0501076_0012518 Ga0501076_0012518_5933_6241 100
317 3300049593 Ga0501077_0131345 Ga0501077_0131345_964_1272 100
318 3300049742 Ga0501080_0362361 Ga0501080_0362361_375_683 100
319 3300049742 Ga0501080_0380818 Ga0501080_0380818_36_338 100
320 3300049743 Ga0501081_0768217 Ga0501081_0768217_132_440 100
321 3300049823 Ga0501044_0054052 Ga0501044_0054052_2782_3084 100
322 3300049823 Ga0501044_0347521 Ga0501044_0347521_390_692 100
323 3300049824 Ga0501045_0301725 Ga0501045_0301725_148_456 100
324 3300050489 nmdc:mga03683_260538_c1 nmdc:mga03683_260538_c1_365_667 100
325 3300050490 nmdc:mga03n38_319531_c1 nmdc:mga03n38_319531_c1_494_796 100
326 3300050491 nmdc:mga00v17_803823_c1 nmdc:mga00v17_803823_c1_24_326 100
327 3300050492 nmdc:mga0yw44_20495_c1 nmdc:mga0yw44_20495_c1_2436_2738 100
328 3300050494 nmdc:mga06z11_657777_c1 nmdc:mga06z11_657777_c1_326_628 100
329 3300050511 nmdc:mga08y16_1000020_c1 nmdc:mga08y16_1000020_c1_414_716 100
330 3300050516 nmdc:mga0sz30_474255_c1 nmdc:mga0sz30_474255_c1_193_495 100
331 3300053130 Ga0500642_0154648 Ga0500642_0154648_387_689 100
332 3300053139 Ga0500568_0265075 Ga0500568_0265075_249_551 100
333 3300054114 Ga0501084_0229122 Ga0501084_0229122_585_893 100
334 3300059424 Ga0590075_019997 Ga0590075_019997_197_499 100
335 3300060353 Ga0501082_0167917 Ga0501082_0167917_1377_1685 100
336 3300061734 Ga0530510_0834866 Ga0530510_0834866_128_436 100

Feature Viewer

pLDDT pTM Quality
67.07 0.39 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map