F412221
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 335 | 235 | 335 | 281 |
Family's Representative Sequence
| Representative Sequence | 3300009147|Ga0114129_10167304|Ga0114129_101673042 |
| Length | 302 |
| Sequence | MTTSAPDLYRHTAARDAQSAAPTFPRSADVEAIVRLALAEDVGRGDLTTEATVDANATAIAELLQKAPGVLCGLPVVDEVFAQLDPRVRVIRLAHEGSSSDEPRRVVVRIEGPATAILTGERTALNFVQRLSGVATMSRRAAELVRGTQARVIDTRKTTPGMRVLEKYAVRIGGASNHRAGLDDGFLIKENHIRAAGGITRAVQAAELRAAPGQVVEVEVTNLDELEEALTAGARLILLDNFTEAGLRLAVVQTAGRARLEASGGITLDNLAAIAATGVDFISLGALTHSAGSLDFSLEVRP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 37 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 46 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 51 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 53 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 54 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 55 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 57 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 58 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 59 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 60 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 61 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 62 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 63 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 64 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 65 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 66 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 67 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 68 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 69 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 72 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 73 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 74 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 75 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 102 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 104 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 105 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 106 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 107 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 108 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 167 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 171 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 172 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 173 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 174 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 175 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 176 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 177 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 178 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 179 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 180 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 181 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 182 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 183 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 184 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 185 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 186 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 187 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 188 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 189 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 190 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 191 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 192 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 193 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 194 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 195 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 196 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 197 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 198 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 199 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 200 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 201 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 202 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 203 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 204 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 205 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 206 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 213 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 214 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 215 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 216 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 217 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 218 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 219 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 220 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 221 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 222 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 223 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 224 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 225 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 226 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 227 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 228 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 229 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 230 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 231 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 234 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 235 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.7 |
| Metatranscriptomes | 0.3 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.9 |
| Nodule | 0 |
| Rhizoplane | 5.07 |
| Rhizosphere | 86.27 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.76 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_9199985 | 2162886012 | Bacteria | 1118 |
| 2 | JGI24737J22298_10075327 | 3300001990 | Bacteria | 1006 |
| 3 | Ga0070658_10000364 | 3300005327 | Bacteria | 39430 |
| 4 | Ga0070676_10000047 | 3300005328 | Bacteria | 38146 |
| 5 | Ga0070683_100122542 | 3300005329 | Bacteria | 2456 |
| 6 | Ga0070690_100000098 | 3300005330 | Bacteria | 44551 |
| 7 | Ga0070690_100041832 | 3300005330 | Bacteria | 2902 |
| 8 | Ga0070670_100003364 | 3300005331 | Bacteria | 13247 |
| 9 | Ga0070677_10000063 | 3300005333 | Bacteria | 33591 |
| 10 | Ga0068869_100000030 | 3300005334 | Bacteria | 61018 |
| 11 | Ga0070666_10000458 | 3300005335 | Bacteria | 24870 |
| 12 | Ga0068868_100000118 | 3300005338 | Bacteria | 49828 |
| 13 | Ga0070660_100000050 | 3300005339 | Bacteria | 68623 |
| 14 | Ga0070689_100000415 | 3300005340 | Bacteria | 25092 |
| 15 | Ga0070689_100161558 | 3300005340 | Bacteria | 1811 |
| 16 | Ga0070691_10121190 | 3300005341 | Unclassified | 1317 |
| 17 | Ga0070687_100000138 | 3300005343 | Bacteria | 25149 |
| 18 | Ga0070661_100000117 | 3300005344 | Bacteria | 66096 |
| 19 | Ga0070692_10017140 | 3300005345 | Bacteria | 3458 |
| 20 | Ga0070668_100000051 | 3300005347 | Bacteria | 73027 |
| 21 | Ga0070668_100036916 | 3300005347 | Bacteria | 3730 |
| 22 | Ga0070669_100000325 | 3300005353 | Bacteria | 37285 |
| 23 | Ga0070675_100000130 | 3300005354 | Bacteria | 45128 |
| 24 | Ga0070671_100002282 | 3300005355 | Bacteria | 14795 |
| 25 | Ga0070671_100197633 | 3300005355 | Bacteria | 1705 |
| 26 | Ga0070674_100000572 | 3300005356 | Bacteria | 18557 |
| 27 | Ga0070673_100036677 | 3300005364 | Bacteria | 3729 |
| 28 | Ga0070688_100000060 | 3300005365 | Bacteria | 53765 |
| 29 | Ga0070659_100000161 | 3300005366 | Bacteria | 51528 |
| 30 | Ga0070659_100134903 | 3300005366 | Bacteria | 2007 |
| 31 | Ga0070667_100000585 | 3300005367 | Bacteria | 35928 |
| 32 | Ga0070709_10074039 | 3300005434 | Bacteria | 2206 |
| 33 | Ga0070714_100313787 | 3300005435 | Bacteria | 1465 |
| 34 | Ga0070701_10014361 | 3300005438 | Bacteria | 3629 |
| 35 | Ga0070711_100116228 | 3300005439 | Bacteria | 1971 |
| 36 | Ga0070705_100000326 | 3300005440 | Bacteria | 28155 |
| 37 | Ga0070700_100036164 | 3300005441 | Bacteria | 2993 |
| 38 | Ga0070708_100026355 | 3300005445 | Bacteria | 4974 |
| 39 | Ga0070708_100053151 | 3300005445 | Bacteria | 3593 |
| 40 | Ga0070708_100278520 | 3300005445 | Bacteria | 1574 |
| 41 | Ga0070708_100469220 | 3300005445 | Bacteria | 1187 |
| 42 | Ga0070663_100044656 | 3300005455 | Bacteria | 3126 |
| 43 | Ga0070662_100000392 | 3300005457 | Bacteria | 26173 |
| 44 | Ga0068867_100000317 | 3300005459 | Bacteria | 31905 |
| 45 | Ga0068867_100085105 | 3300005459 | Bacteria | 2390 |
| 46 | Ga0070685_10000091 | 3300005466 | Bacteria | 55498 |
| 47 | Ga0070685_10055689 | 3300005466 | Bacteria | 2298 |
| 48 | Ga0070706_100000006 | 3300005467 | Bacteria | 262251 |
| 49 | Ga0070706_100045069 | 3300005467 | Bacteria | 4074 |
| 50 | Ga0070706_100498462 | 3300005467 | Bacteria | 1133 |
| 51 | Ga0070707_100102482 | 3300005468 | Bacteria | 2773 |
| 52 | Ga0070707_100121696 | 3300005468 | Bacteria | 2534 |
| 53 | Ga0070698_100156731 | 3300005471 | Bacteria | 2223 |
| 54 | Ga0070698_100159356 | 3300005471 | Bacteria | 2201 |
| 55 | Ga0070698_100530314 | 3300005471 | Bacteria | 1116 |
| 56 | Ga0070699_100005296 | 3300005518 | Bacteria | 11314 |
| 57 | Ga0070699_100013921 | 3300005518 | Bacteria | 6918 |
| 58 | Ga0070699_100110565 | 3300005518 | Bacteria | 2412 |
| 59 | Ga0070679_100029014 | 3300005530 | Bacteria | 5458 |
| 60 | Ga0070679_100048090 | 3300005530 | Bacteria | 4251 |
| 61 | Ga0070684_100026207 | 3300005535 | Bacteria | 4909 |
| 62 | Ga0070697_100005087 | 3300005536 | Bacteria | 10100 |
| 63 | Ga0070697_100236887 | 3300005536 | Bacteria | 1558 |
| 64 | Ga0068853_100000168 | 3300005539 | Bacteria | 45251 |
| 65 | Ga0070672_100000413 | 3300005543 | Bacteria | 24736 |
| 66 | Ga0070686_100002752 | 3300005544 | Bacteria | 9682 |
| 67 | Ga0070665_100062636 | 3300005548 | Bacteria | 3729 |
| 68 | Ga0070665_100066052 | 3300005548 | Bacteria | 3629 |
| 69 | Ga0070704_100010371 | 3300005549 | Bacteria | 5666 |
| 70 | Ga0068855_100000205 | 3300005563 | Bacteria | 75775 |
| 71 | Ga0070664_100456708 | 3300005564 | Bacteria | 1173 |
| 72 | Ga0070664_100485754 | 3300005564 | Bacteria | 1137 |
| 73 | Ga0068857_100000129 | 3300005577 | Bacteria | 45576 |
| 74 | Ga0068857_100008573 | 3300005577 | Bacteria | 8842 |
| 75 | Ga0068854_100000250 | 3300005578 | Bacteria | 36541 |
| 76 | Ga0068856_100005213 | 3300005614 | Bacteria | 12828 |
| 77 | Ga0070702_100031168 | 3300005615 | Bacteria | 2915 |
| 78 | Ga0068852_100000245 | 3300005616 | Bacteria | 36948 |
| 79 | Ga0068852_100062244 | 3300005616 | Bacteria | 3245 |
| 80 | Ga0068859_100000218 | 3300005617 | Bacteria | 56857 |
| 81 | Ga0068864_100000408 | 3300005618 | Bacteria | 37250 |
| 82 | Ga0068866_10000026 | 3300005718 | Bacteria | 59473 |
| 83 | Ga0068861_100000053 | 3300005719 | Bacteria | 53769 |
| 84 | Ga0068861_100328534 | 3300005719 | Bacteria | 1334 |
| 85 | Ga0068851_10000095 | 3300005834 | Bacteria | 48657 |
| 86 | Ga0068851_10070709 | 3300005834 | Bacteria | 1805 |
| 87 | Ga0068870_10000141 | 3300005840 | Bacteria | 25078 |
| 88 | Ga0068863_100001172 | 3300005841 | Bacteria | 26170 |
| 89 | Ga0068858_100001427 | 3300005842 | Bacteria | 24562 |
| 90 | Ga0068860_100001481 | 3300005843 | Bacteria | 25356 |
| 91 | Ga0068860_100025323 | 3300005843 | Bacteria | 5726 |
| 92 | Ga0068862_100000535 | 3300005844 | Bacteria | 39698 |
| 93 | Ga0081540_1001160 | 3300005983 | Bacteria | 23192 |
| 94 | Ga0081540_1001298 | 3300005983 | Bacteria | 21828 |
| 95 | Ga0081540_1002770 | 3300005983 | Bacteria | 14218 |
| 96 | Ga0081539_10002491 | 3300005985 | Bacteria | 25867 |
| 97 | Ga0070717_10001822 | 3300006028 | Bacteria | 14898 |
| 98 | Ga0070717_10026299 | 3300006028 | Bacteria | 4641 |
| 99 | Ga0070717_10034284 | 3300006028 | Bacteria | 4103 |
| 100 | Ga0097621_100000570 | 3300006237 | Bacteria | 25924 |
| 101 | Ga0068871_100000143 | 3300006358 | Bacteria | 46464 |
| 102 | Ga0068871_100012870 | 3300006358 | Bacteria | 6194 |
| 103 | Ga0075428_100065537 | 3300006844 | Bacteria | 3978 |
| 104 | Ga0075430_100051422 | 3300006846 | Bacteria | 3472 |
| 105 | Ga0075430_100137216 | 3300006846 | Bacteria | 2037 |
| 106 | Ga0068865_100000077 | 3300006881 | Bacteria | 51600 |
| 107 | Ga0068865_100056308 | 3300006881 | Bacteria | 2739 |
| 108 | Ga0097620_100000218 | 3300006931 | Bacteria | 56857 |
| 109 | Ga0105240_10014212 | 3300009093 | Bacteria | 10874 |
| 110 | Ga0111539_10052273 | 3300009094 | Bacteria | 4864 |
| 111 | Ga0111539_10055254 | 3300009094 | Bacteria | 4720 |
| 112 | Ga0111539_10065301 | 3300009094 | Bacteria | 4301 |
| 113 | Ga0105245_10000841 | 3300009098 | Bacteria | 27906 |
| 114 | Ga0105247_10000615 | 3300009101 | Bacteria | 28678 |
| 115 | Ga0114129_10050035 | 3300009147 | Bacteria | 5871 |
| 116 | Ga0114129_10167304 | 3300009147 | Bacteria | 2999 |
| 117 | Ga0114129_10815042 | 3300009147 | Bacteria | 1190 |
| 118 | Ga0105243_10000914 | 3300009148 | Bacteria | 27704 |
| 119 | Ga0105241_10000444 | 3300009174 | Bacteria | 31192 |
| 120 | Ga0105241_10157207 | 3300009174 | Bacteria | 1865 |
| 121 | Ga0105241_10410902 | 3300009174 | Bacteria | 1189 |
| 122 | Ga0105242_10000925 | 3300009176 | Bacteria | 22817 |
| 123 | Ga0105242_10040566 | 3300009176 | Bacteria | 3751 |
| 124 | Ga0105248_10000420 | 3300009177 | Bacteria | 48678 |
| 125 | Ga0105237_10000339 | 3300009545 | Bacteria | 65782 |
| 126 | Ga0105238_10000245 | 3300009551 | Bacteria | 60477 |
| 127 | Ga0105249_10000229 | 3300009553 | Bacteria | 63587 |
| 128 | Ga0105239_10001848 | 3300010375 | Bacteria | 27708 |
| 129 | Ga0105239_10189580 | 3300010375 | Unclassified | 2302 |
| 130 | Ga0157373_10000481 | 3300013100 | Bacteria | 31671 |
| 131 | Ga0157371_10000743 | 3300013102 | Bacteria | 38074 |
| 132 | Ga0157369_10000161 | 3300013105 | Bacteria | 94988 |
| 133 | Ga0157374_10000342 | 3300013296 | Bacteria | 43128 |
| 134 | Ga0157378_10000244 | 3300013297 | Bacteria | 53235 |
| 135 | Ga0163162_10000138 | 3300013306 | Bacteria | 66425 |
| 136 | Ga0157372_10001412 | 3300013307 | Bacteria | 25922 |
| 137 | Ga0157372_10344260 | 3300013307 | Bacteria | 1737 |
| 138 | Ga0157375_10001320 | 3300013308 | Bacteria | 21394 |
| 139 | Ga0163163_10010443 | 3300014325 | Bacteria | 8354 |
| 140 | Ga0163163_10176606 | 3300014325 | Bacteria | 2182 |
| 141 | Ga0163163_10496185 | 3300014325 | Bacteria | 1283 |
| 142 | Ga0157377_10000181 | 3300014745 | Bacteria | 36462 |
| 143 | Ga0157379_10000195 | 3300014968 | Bacteria | 46895 |
| 144 | Ga0157376_10001254 | 3300014969 | Bacteria | 16727 |
| 145 | Ga0157376_10134880 | 3300014969 | Bacteria | 2208 |
| 146 | Ga0182006_1003302 | 3300015261 | Bacteria | 8332 |
| 147 | Ga0163161_10062100 | 3300017792 | Bacteria | 2721 |
| 148 | Ga0206350_11127482 | 3300020080 | Bacteria | 3785 |
| 149 | Ga0213873_10005691 | 3300021358 | Bacteria | 2407 |
| 150 | Ga0213874_10000279 | 3300021377 | Bacteria | 9943 |
| 151 | Ga0213874_10005782 | 3300021377 | Bacteria | 2899 |
| 152 | Ga0213874_10014988 | 3300021377 | Bacteria | 2036 |
| 153 | Ga0213876_10016047 | 3300021384 | Bacteria | 3961 |
| 154 | Ga0213876_10064406 | 3300021384 | Bacteria | 1935 |
| 155 | Ga0213876_10068759 | 3300021384 | Bacteria | 1871 |
| 156 | Ga0213876_10120529 | 3300021384 | Bacteria | 1392 |
| 157 | Ga0213875_10083081 | 3300021388 | Bacteria | 1494 |
| 158 | Ga0207697_10000115 | 3300025315 | Bacteria | 37680 |
| 159 | Ga0207656_10000277 | 3300025321 | Bacteria | 17723 |
| 160 | Ga0207682_10000100 | 3300025893 | Bacteria | 38942 |
| 161 | Ga0207692_10200498 | 3300025898 | Bacteria | 1173 |
| 162 | Ga0207642_10000352 | 3300025899 | Bacteria | 13792 |
| 163 | Ga0207710_10000530 | 3300025900 | Bacteria | 23407 |
| 164 | Ga0207688_10000045 | 3300025901 | Bacteria | 43332 |
| 165 | Ga0207680_10000355 | 3300025903 | Bacteria | 21937 |
| 166 | Ga0207699_10019777 | 3300025906 | Bacteria | 3597 |
| 167 | Ga0207645_10000086 | 3300025907 | Bacteria | 66756 |
| 168 | Ga0207643_10000031 | 3300025908 | Bacteria | 95652 |
| 169 | Ga0207705_10004478 | 3300025909 | Bacteria | 10558 |
| 170 | Ga0207684_10037559 | 3300025910 | Bacteria | 4109 |
| 171 | Ga0207684_10056547 | 3300025910 | Bacteria | 3328 |
| 172 | Ga0207654_10025230 | 3300025911 | Bacteria | 3204 |
| 173 | Ga0207654_10117355 | 3300025911 | Bacteria | 1665 |
| 174 | Ga0207654_10247772 | 3300025911 | Bacteria | 1193 |
| 175 | Ga0207695_10030157 | 3300025913 | Bacteria | 5974 |
| 176 | Ga0207695_10496952 | 3300025913 | Bacteria | 1102 |
| 177 | Ga0207671_10001358 | 3300025914 | Bacteria | 28581 |
| 178 | Ga0207660_10286412 | 3300025917 | Bacteria | 1309 |
| 179 | Ga0207662_10000056 | 3300025918 | Bacteria | 49440 |
| 180 | Ga0207657_10000033 | 3300025919 | Bacteria | 128982 |
| 181 | Ga0207649_10007446 | 3300025920 | Bacteria | 5954 |
| 182 | Ga0207652_10114297 | 3300025921 | Bacteria | 2397 |
| 183 | Ga0207652_10154858 | 3300025921 | Bacteria | 2053 |
| 184 | Ga0207646_10013895 | 3300025922 | Bacteria | 7678 |
| 185 | Ga0207646_10037566 | 3300025922 | Bacteria | 4365 |
| 186 | Ga0207646_10151741 | 3300025922 | Bacteria | 2090 |
| 187 | Ga0207681_10000166 | 3300025923 | Bacteria | 54482 |
| 188 | Ga0207650_10000305 | 3300025925 | Bacteria | 48659 |
| 189 | Ga0207659_10000103 | 3300025926 | Bacteria | 50400 |
| 190 | Ga0207687_10001081 | 3300025927 | Bacteria | 18512 |
| 191 | Ga0207644_10001343 | 3300025931 | Bacteria | 15806 |
| 192 | Ga0207690_10004431 | 3300025932 | Bacteria | 8285 |
| 193 | Ga0207706_10000303 | 3300025933 | Bacteria | 53405 |
| 194 | Ga0207686_10005356 | 3300025934 | Bacteria | 6880 |
| 195 | Ga0207686_10097211 | 3300025934 | Bacteria | 1958 |
| 196 | Ga0207709_10001792 | 3300025935 | Bacteria | 14393 |
| 197 | Ga0207670_10000082 | 3300025936 | Bacteria | 66331 |
| 198 | Ga0207669_10000189 | 3300025937 | Bacteria | 27965 |
| 199 | Ga0207704_10000087 | 3300025938 | Bacteria | 54736 |
| 200 | Ga0207691_10000035 | 3300025940 | Bacteria | 110640 |
| 201 | Ga0207711_10000208 | 3300025941 | Bacteria | 62806 |
| 202 | Ga0207711_10100299 | 3300025941 | Bacteria | 2561 |
| 203 | Ga0207689_10000012 | 3300025942 | Bacteria | 122873 |
| 204 | Ga0207661_10000731 | 3300025944 | Bacteria | 21330 |
| 205 | Ga0207679_10000253 | 3300025945 | Bacteria | 40824 |
| 206 | Ga0207667_10003992 | 3300025949 | Bacteria | 18129 |
| 207 | Ga0207651_10000029 | 3300025960 | Bacteria | 67124 |
| 208 | Ga0207712_10000192 | 3300025961 | Bacteria | 62880 |
| 209 | Ga0207668_10032574 | 3300025972 | Bacteria | 3445 |
| 210 | Ga0207668_10318971 | 3300025972 | Bacteria | 1289 |
| 211 | Ga0207640_10000569 | 3300025981 | Bacteria | 22011 |
| 212 | Ga0207658_10000651 | 3300025986 | Bacteria | 30352 |
| 213 | Ga0207658_10191633 | 3300025986 | Bacteria | 1700 |
| 214 | Ga0207677_10000196 | 3300026023 | Bacteria | 48661 |
| 215 | Ga0207677_10382153 | 3300026023 | Bacteria | 1189 |
| 216 | Ga0207703_10000239 | 3300026035 | Bacteria | 62391 |
| 217 | Ga0207639_10000227 | 3300026041 | Bacteria | 42131 |
| 218 | Ga0207678_10001711 | 3300026067 | Bacteria | 20099 |
| 219 | Ga0207708_10054395 | 3300026075 | Bacteria | 3052 |
| 220 | Ga0207702_10001102 | 3300026078 | Bacteria | 27600 |
| 221 | Ga0207702_10600666 | 3300026078 | Unclassified | 1080 |
| 222 | Ga0207641_10001188 | 3300026088 | Bacteria | 26101 |
| 223 | Ga0207648_10000315 | 3300026089 | Bacteria | 53058 |
| 224 | Ga0207648_10026408 | 3300026089 | Bacteria | 5160 |
| 225 | Ga0207648_10077059 | 3300026089 | Bacteria | 2906 |
| 226 | Ga0207676_10000238 | 3300026095 | Bacteria | 48232 |
| 227 | Ga0207676_10289494 | 3300026095 | Bacteria | 1491 |
| 228 | Ga0207674_10000286 | 3300026116 | Bacteria | 63883 |
| 229 | Ga0207674_10004855 | 3300026116 | Bacteria | 16099 |
| 230 | Ga0207674_10440583 | 3300026116 | Unclassified | 1259 |
| 231 | Ga0207675_100000026 | 3300026118 | Bacteria | 110515 |
| 232 | Ga0207683_10000090 | 3300026121 | Bacteria | 72779 |
| 233 | Ga0207698_10000210 | 3300026142 | Bacteria | 36586 |
| 234 | Ga0207698_10046799 | 3300026142 | Bacteria | 3270 |
| 235 | Ga0207428_10119586 | 3300027907 | Bacteria | 2021 |
| 236 | Ga0268266_10000628 | 3300028379 | Bacteria | 47978 |
| 237 | Ga0268265_10000533 | 3300028380 | Bacteria | 38830 |
| 238 | Ga0268264_10000522 | 3300028381 | Bacteria | 48701 |
| 239 | Ga0268264_10027133 | 3300028381 | Bacteria | 4678 |
| 240 | Ga0265319_1000015 | 3300028563 | Bacteria | 176382 |
| 241 | Ga0265320_10027177 | 3300031240 | Unclassified | 2987 |
| 242 | Ga0265320_10043402 | 3300031240 | Bacteria | 2223 |
| 243 | Ga0307405_10129724 | 3300031731 | Bacteria | 1740 |
| 244 | Ga0316577_10002351 | 3300031733 | Bacteria | 9337 |
| 245 | Ga0307407_10000041 | 3300031903 | Bacteria | 65180 |
| 246 | Ga0307411_10621199 | 3300032005 | Bacteria | 932 |
| 247 | Ga0373956_0001662 | 3300035119 | Bacteria | 9153 |
| 248 | Ga0373955_0187368 | 3300035172 | Bacteria | 1229 |
| 249 | Ga0373935_0214773 | 3300035692 | Bacteria | 1334 |
| 250 | Ga0373927_0000009 | 3300035695 | Bacteria | 186799 |
| 251 | Ga0373933_0003893 | 3300035724 | Bacteria | 8235 |
| 252 | Ga0373933_0005767 | 3300035724 | Bacteria | 6736 |
| 253 | Ga0316582_0089542 | 3300036647 | Bacteria | 2023 |
| 254 | Ga0395900_0001240 | 3300037418 | Bacteria | 31317 |
| 255 | Ga0395898_0001183 | 3300037466 | Bacteria | 39710 |
| 256 | Ga0436364_0309374 | 3300037853 | Bacteria | 1458 |
| 257 | Ga0436364_0496747 | 3300037853 | Bacteria | 12455 |
| 258 | Ga0436364_1189683 | 3300037853 | Bacteria | 6982 |
| 259 | Ga0436365_0110418 | 3300039437 | Bacteria | 1305 |
| 260 | Ga0436365_0130869 | 3300039437 | Bacteria | 2525 |
| 261 | Ga0436365_0135600 | 3300039437 | Bacteria | 15237 |
| 262 | Ga0436365_0519198 | 3300039437 | Bacteria | 7359 |
| 263 | Ga0436365_0547247 | 3300039437 | Bacteria | 9788 |
| 264 | Ga0436365_0592067 | 3300039437 | Bacteria | 1289 |
| 265 | Ga0436365_1468503 | 3300039437 | Bacteria | 2326 |
| 266 | Ga0436363_0572509 | 3300039450 | Bacteria | 1825 |
| 267 | Ga0436363_0645487 | 3300039450 | Unclassified | 3024 |
| 268 | Ga0436363_0942783 | 3300039450 | Bacteria | 1775 |
| 269 | Ga0436363_1236354 | 3300039450 | Bacteria | 27353 |
| 270 | Ga0436363_1327862 | 3300039450 | Bacteria | 6081 |
| 271 | Ga0436363_1354269 | 3300039450 | Bacteria | 1257 |
| 272 | Ga0436362_0200775 | 3300039453 | Bacteria | 2276 |
| 273 | Ga0436362_0941391 | 3300039453 | Bacteria | 12509 |
| 274 | Ga0439448_0112330 | 3300042005 | Bacteria | 931 |
| 275 | Ga0450920_024652 | 3300042122 | Bacteria | 1169 |
| 276 | Ga0450894_000822 | 3300042131 | Bacteria | 4996 |
| 277 | Ga0450896_001291 | 3300042133 | Bacteria | 3038 |
| 278 | Ga0450906_004392 | 3300042145 | Bacteria | 2956 |
| 279 | Ga0466969_0000773 | 3300044656 | Bacteria | 17432 |
| 280 | Ga0466972_0023105 | 3300044658 | Bacteria | 3094 |
| 281 | Ga0466972_0061656 | 3300044658 | Bacteria | 1798 |
| 282 | Ga0466965_0178239 | 3300044683 | Bacteria | 1120 |
| 283 | Ga0466966_0001114 | 3300044684 | Bacteria | 17238 |
| 284 | Ga0466963_0021187 | 3300044694 | Bacteria | 4097 |
| 285 | Ga0466963_0048827 | 3300044694 | Bacteria | 2798 |
| 286 | Ga0466963_0219141 | 3300044694 | Bacteria | 1332 |
| 287 | Ga0466964_0000308 | 3300044706 | Bacteria | 14405 |
| 288 | Ga0466971_0013005 | 3300044719 | Bacteria | 3651 |
| 289 | Ga0466968_0000040 | 3300044735 | Bacteria | 36417 |
| 290 | Ga0466970_0000014 | 3300044765 | Bacteria | 69370 |
| 291 | Ga0466957_0126493 | 3300044842 | Bacteria | 1633 |
| 292 | Ga0466957_0249093 | 3300044842 | Bacteria | 1181 |
| 293 | Ga0466959_0008053 | 3300045049 | Bacteria | 7428 |
| 294 | Ga0466959_0191363 | 3300045049 | Bacteria | 1428 |
| 295 | Ga0466959_0271435 | 3300045049 | Bacteria | 1166 |
| 296 | Ga0466958_0131450 | 3300045836 | Bacteria | 1572 |
| 297 | Ga0466967_0007145 | 3300045976 | Bacteria | 8015 |
| 298 | Ga0466967_0010564 | 3300045976 | Bacteria | 6934 |
| 299 | Ga0495653_0095294 | 3300046463 | Bacteria | 2167 |
| 300 | Ga0495654_0099299 | 3300046530 | Bacteria | 1342 |
| 301 | Ga0495645_0004740 | 3300046543 | Bacteria | 9297 |
| 302 | Ga0495658_0014365 | 3300046683 | Bacteria | 4046 |
| 303 | Ga0495636_0020184 | 3300047318 | Bacteria | 2684 |
| 304 | Ga0495684_0065237 | 3300047471 | Bacteria | 2768 |
| 305 | Ga0496100_0013895 | 3300048903 | Bacteria | 4659 |
| 306 | Ga0496101_0490343 | 3300048904 | Bacteria | 970 |
| 307 | Ga0496102_0000002 | 3300048905 | Bacteria | 814588 |
| 308 | Ga0496102_0004726 | 3300048905 | Bacteria | 11533 |
| 309 | Ga0496103_0000017 | 3300048906 | Bacteria | 244768 |
| 310 | Ga0496104_0000001 | 3300048907 | Bacteria | 711867 |
| 311 | Ga0496104_0025335 | 3300048907 | Bacteria | 5468 |
| 312 | Ga0496105_0030481 | 3300048908 | Bacteria | 4420 |
| 313 | Ga0496108_0243848 | 3300048911 | Bacteria | 1563 |
| 314 | Ga0496109_0179605 | 3300048912 | Bacteria | 1987 |
| 315 | Ga0496110_0002884 | 3300048913 | Bacteria | 12998 |
| 316 | Ga0496111_0000021 | 3300048914 | Bacteria | 67813 |
| 317 | Ga0496112_0000088 | 3300048915 | Bacteria | 60691 |
| 318 | Ga0496113_0004164 | 3300048916 | Bacteria | 8832 |
| 319 | Ga0496114_0005946 | 3300048917 | Bacteria | 9593 |
| 320 | Ga0496114_0032519 | 3300048917 | Bacteria | 4294 |
| 321 | Ga0496115_0150335 | 3300048918 | Bacteria | 1923 |
| 322 | Ga0496122_0144859 | 3300048925 | Bacteria | 1478 |
| 323 | Ga0496126_0187830 | 3300048929 | Bacteria | 1752 |
| 324 | nmdc:mga05p37_265888_c1 | 3300050507 | Bacteria | 2051 |
| 325 | nmdc:mga05p37_323730_c1 | 3300050507 | Bacteria | 1823 |
| 326 | nmdc:mga09592_292134_c1 | 3300050508 | Bacteria | 1413 |
| 327 | nmdc:mga08y16_193128_c1 | 3300050511 | Bacteria | 2111 |
| 328 | nmdc:mga08y16_40209_c1 | 3300050511 | Bacteria | 4902 |
| 329 | nmdc:mga08y16_73153_c1 | 3300050511 | Bacteria | 3571 |
| 330 | Ga0495601_0043669 | 3300053077 | Bacteria | 2815 |
| 331 | Ga0495601_0273558 | 3300053077 | Bacteria | 1102 |
| 332 | Ga0495619_0008964 | 3300053085 | Bacteria | 6311 |
| 333 | Ga0500556_0000593 | 3300053104 | Bacteria | 23858 |
| 334 | Ga0500616_0004992 | 3300053153 | Bacteria | 9198 |
| 335 | Ga0500599_006026 | 3300053736 | Bacteria | 1539 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005518 | Ga0070699_100013921 | Ga0070699_1000139212 | 239 |
| 2 | 3300009093 | Ga0105240_10014212 | Ga0105240_100142123 | 249 |
| 3 | 3300009147 | Ga0114129_10815042 | Ga0114129_108150421 | 249 |
| 4 | 3300021384 | Ga0213876_10120529 | Ga0213876_101205292 | 249 |
| 5 | 3300025913 | Ga0207695_10030157 | Ga0207695_100301575 | 249 |
| 6 | 3300039437 | Ga0436365_0547247 | Ga0436365_0547247_1615_2508 | 249 |
| 7 | 3300046543 | Ga0495645_0004740 | Ga0495645_0004740_6689_7537 | 251 |
| 8 | 3300039450 | Ga0436363_1354269 | Ga0436363_1354269_329_1168 | 256 |
| 9 | 3300009174 | Ga0105241_10157207 | Ga0105241_101572072 | 258 |
| 10 | 3300036647 | Ga0316582_0089542 | Ga0316582_0089542_332_1264 | 261 |
| 11 | 3300037418 | Ga0395900_0001240 | Ga0395900_0001240_1546_2442 | 263 |
| 12 | 3300037466 | Ga0395898_0001183 | Ga0395898_0001183_23622_24518 | 263 |
| 13 | 3300028563 | Ga0265319_1000015 | Ga0265319_1000015102 | 268 |
| 14 | 3300032005 | Ga0307411_10621199 | Ga0307411_106211991 | 269 |
| 15 | 3300005435 | Ga0070714_100313787 | Ga0070714_1003137871 | 270 |
| 16 | 3300044694 | Ga0466963_0021187 | Ga0466963_0021187_1199_2020 | 271 |
| 17 | 3300045976 | Ga0466967_0007145 | Ga0466967_0007145_6616_7437 | 271 |
| 18 | 3300005330 | Ga0070690_100041832 | Ga0070690_1000418323 | 272 |
| 19 | 3300009094 | Ga0111539_10055254 | Ga0111539_100552543 | 272 |
| 20 | 3300025911 | Ga0207654_10117355 | Ga0207654_101173552 | 272 |
| 21 | 3300026078 | Ga0207702_10600666 | Ga0207702_106006662 | 272 |
| 22 | 3300037853 | Ga0436364_0309374 | Ga0436364_0309374_54_920 | 272 |
| 23 | 3300039437 | Ga0436365_0110418 | Ga0436365_0110418_44_901 | 272 |
| 24 | 3300044694 | Ga0466963_0048827 | Ga0466963_0048827_1326_2153 | 272 |
| 25 | 3300044694 | Ga0466963_0219141 | Ga0466963_0219141_404_1231 | 272 |
| 26 | 3300044719 | Ga0466971_0013005 | Ga0466971_0013005_281_1108 | 272 |
| 27 | 3300045836 | Ga0466958_0131450 | Ga0466958_0131450_356_1183 | 272 |
| 28 | 3300050511 | nmdc:mga08y16_73153_c1 | nmdc:mga08y16_73153_c1_2307_3155 | 272 |
| 29 | 3300053104 | Ga0500556_0000593 | Ga0500556_0000593_10989_11810 | 272 |
| 30 | 3300053153 | Ga0500616_0004992 | Ga0500616_0004992_4594_5415 | 272 |
| 31 | 3300053736 | Ga0500599_006026 | Ga0500599_006026_335_1156 | 272 |
| 32 | 3300005329 | Ga0070683_100122542 | Ga0070683_1001225422 | 273 |
| 33 | 3300005564 | Ga0070664_100456708 | Ga0070664_1004567082 | 273 |
| 34 | 3300006846 | Ga0075430_100051422 | Ga0075430_1000514223 | 273 |
| 35 | 3300009147 | Ga0114129_10050035 | Ga0114129_100500354 | 273 |
| 36 | 3300013307 | Ga0157372_10344260 | Ga0157372_103442602 | 273 |
| 37 | 3300015261 | Ga0182006_1003302 | Ga0182006_10033026 | 273 |
| 38 | 3300031903 | Ga0307407_10000041 | Ga0307407_1000004145 | 273 |
| 39 | 3300050507 | nmdc:mga05p37_265888_c1 | nmdc:mga05p37_265888_c1_257_1114 | 273 |
| 40 | 3300005340 | Ga0070689_100161558 | Ga0070689_1001615582 | 274 |
| 41 | 3300005341 | Ga0070691_10121190 | Ga0070691_101211901 | 274 |
| 42 | 3300005445 | Ga0070708_100026355 | Ga0070708_1000263553 | 274 |
| 43 | 3300005445 | Ga0070708_100053151 | Ga0070708_1000531513 | 274 |
| 44 | 3300005445 | Ga0070708_100278520 | Ga0070708_1002785202 | 274 |
| 45 | 3300005459 | Ga0068867_100085105 | Ga0068867_1000851053 | 274 |
| 46 | 3300005466 | Ga0070685_10055689 | Ga0070685_100556892 | 274 |
| 47 | 3300005467 | Ga0070706_100045069 | Ga0070706_1000450692 | 274 |
| 48 | 3300005468 | Ga0070707_100102482 | Ga0070707_1001024823 | 274 |
| 49 | 3300005468 | Ga0070707_100121696 | Ga0070707_1001216962 | 274 |
| 50 | 3300005471 | Ga0070698_100156731 | Ga0070698_1001567312 | 274 |
| 51 | 3300005471 | Ga0070698_100159356 | Ga0070698_1001593562 | 274 |
| 52 | 3300005518 | Ga0070699_100005296 | Ga0070699_1000052969 | 274 |
| 53 | 3300005518 | Ga0070699_100110565 | Ga0070699_1001105652 | 274 |
| 54 | 3300005530 | Ga0070679_100029014 | Ga0070679_1000290144 | 274 |
| 55 | 3300005536 | Ga0070697_100005087 | Ga0070697_1000050874 | 274 |
| 56 | 3300005536 | Ga0070697_100236887 | Ga0070697_1002368872 | 274 |
| 57 | 3300005548 | Ga0070665_100066052 | Ga0070665_1000660522 | 274 |
| 58 | 3300005577 | Ga0068857_100008573 | Ga0068857_1000085732 | 274 |
| 59 | 3300005616 | Ga0068852_100062244 | Ga0068852_1000622443 | 274 |
| 60 | 3300005834 | Ga0068851_10070709 | Ga0068851_100707092 | 274 |
| 61 | 3300006028 | Ga0070717_10001822 | Ga0070717_100018223 | 274 |
| 62 | 3300006028 | Ga0070717_10026299 | Ga0070717_100262993 | 274 |
| 63 | 3300006358 | Ga0068871_100012870 | Ga0068871_1000128703 | 274 |
| 64 | 3300006881 | Ga0068865_100056308 | Ga0068865_1000563084 | 274 |
| 65 | 3300009176 | Ga0105242_10040566 | Ga0105242_100405662 | 274 |
| 66 | 3300010375 | Ga0105239_10189580 | Ga0105239_101895802 | 274 |
| 67 | 3300014325 | Ga0163163_10176606 | Ga0163163_101766062 | 274 |
| 68 | 3300014325 | Ga0163163_10496185 | Ga0163163_104961852 | 274 |
| 69 | 3300014969 | Ga0157376_10134880 | Ga0157376_101348801 | 274 |
| 70 | 3300017792 | Ga0163161_10062100 | Ga0163161_100621002 | 274 |
| 71 | 3300020080 | Ga0206350_11127482 | Ga0206350_111274822 | 274 |
| 72 | 3300021377 | Ga0213874_10005782 | Ga0213874_100057822 | 274 |
| 73 | 3300021384 | Ga0213876_10068759 | Ga0213876_100687592 | 274 |
| 74 | 3300025910 | Ga0207684_10037559 | Ga0207684_100375593 | 274 |
| 75 | 3300025910 | Ga0207684_10056547 | Ga0207684_100565472 | 274 |
| 76 | 3300025921 | Ga0207652_10114297 | Ga0207652_101142972 | 274 |
| 77 | 3300025922 | Ga0207646_10013895 | Ga0207646_100138952 | 274 |
| 78 | 3300025922 | Ga0207646_10037566 | Ga0207646_100375662 | 274 |
| 79 | 3300025922 | Ga0207646_10151741 | Ga0207646_101517412 | 274 |
| 80 | 3300025934 | Ga0207686_10097211 | Ga0207686_100972112 | 274 |
| 81 | 3300025941 | Ga0207711_10100299 | Ga0207711_101002993 | 274 |
| 82 | 3300025986 | Ga0207658_10191633 | Ga0207658_101916332 | 274 |
| 83 | 3300026089 | Ga0207648_10026408 | Ga0207648_100264082 | 274 |
| 84 | 3300026095 | Ga0207676_10289494 | Ga0207676_102894942 | 274 |
| 85 | 3300026116 | Ga0207674_10004855 | Ga0207674_100048556 | 274 |
| 86 | 3300026116 | Ga0207674_10440583 | Ga0207674_104405832 | 274 |
| 87 | 3300026142 | Ga0207698_10046799 | Ga0207698_100467992 | 274 |
| 88 | 3300031240 | Ga0265320_10027177 | Ga0265320_100271772 | 274 |
| 89 | 3300031733 | Ga0316577_10002351 | Ga0316577_100023515 | 274 |
| 90 | 3300035119 | Ga0373956_0001662 | Ga0373956_0001662_689_1531 | 274 |
| 91 | 3300035172 | Ga0373955_0187368 | Ga0373955_0187368_309_1151 | 274 |
| 92 | 3300035692 | Ga0373935_0214773 | Ga0373935_0214773_404_1246 | 274 |
| 93 | 3300035695 | Ga0373927_0000009 | Ga0373927_0000009_151230_152072 | 274 |
| 94 | 3300035724 | Ga0373933_0003893 | Ga0373933_0003893_6251_7093 | 274 |
| 95 | 3300035724 | Ga0373933_0005767 | Ga0373933_0005767_1393_2235 | 274 |
| 96 | 3300039437 | Ga0436365_0130869 | Ga0436365_0130869_879_1721 | 274 |
| 97 | 3300039450 | Ga0436363_0645487 | Ga0436363_0645487_368_1210 | 274 |
| 98 | 3300042122 | Ga0450920_024652 | Ga0450920_024652_113_973 | 274 |
| 99 | 3300042131 | Ga0450894_000822 | Ga0450894_000822_1700_2560 | 274 |
| 100 | 3300042133 | Ga0450896_001291 | Ga0450896_001291_153_1013 | 274 |
| 101 | 3300042145 | Ga0450906_004392 | Ga0450906_004392_1905_2765 | 274 |
| 102 | 3300044658 | Ga0466972_0061656 | Ga0466972_0061656_234_1076 | 274 |
| 103 | 3300044842 | Ga0466957_0126493 | Ga0466957_0126493_225_1067 | 274 |
| 104 | 3300044842 | Ga0466957_0249093 | Ga0466957_0249093_218_1060 | 274 |
| 105 | 3300045049 | Ga0466959_0191363 | Ga0466959_0191363_223_1065 | 274 |
| 106 | 3300045976 | Ga0466967_0010564 | Ga0466967_0010564_2411_3244 | 274 |
| 107 | 3300046463 | Ga0495653_0095294 | Ga0495653_0095294_528_1394 | 274 |
| 108 | 3300046530 | Ga0495654_0099299 | Ga0495654_0099299_94_933 | 274 |
| 109 | 3300047471 | Ga0495684_0065237 | Ga0495684_0065237_1579_2445 | 274 |
| 110 | 3300048907 | Ga0496104_0025335 | Ga0496104_0025335_1525_2391 | 274 |
| 111 | 3300048908 | Ga0496105_0030481 | Ga0496105_0030481_868_1734 | 274 |
| 112 | 3300048911 | Ga0496108_0243848 | Ga0496108_0243848_50_916 | 274 |
| 113 | 3300048917 | Ga0496114_0005946 | Ga0496114_0005946_881_1747 | 274 |
| 114 | 3300048917 | Ga0496114_0032519 | Ga0496114_0032519_347_1213 | 274 |
| 115 | 3300048918 | Ga0496115_0150335 | Ga0496115_0150335_523_1389 | 274 |
| 116 | 3300053077 | Ga0495601_0043669 | Ga0495601_0043669_1586_2452 | 274 |
| 117 | 3300053077 | Ga0495601_0273558 | Ga0495601_0273558_20_886 | 274 |
| 118 | 3300053085 | Ga0495619_0008964 | Ga0495619_0008964_71_937 | 274 |
| 119 | 3300005347 | Ga0070668_100036916 | Ga0070668_1000369163 | 275 |
| 120 | 3300005366 | Ga0070659_100134903 | Ga0070659_1001349032 | 275 |
| 121 | 3300005434 | Ga0070709_10074039 | Ga0070709_100740392 | 275 |
| 122 | 3300005445 | Ga0070708_100469220 | Ga0070708_1004692201 | 275 |
| 123 | 3300005467 | Ga0070706_100498462 | Ga0070706_1004984621 | 275 |
| 124 | 3300005471 | Ga0070698_100530314 | Ga0070698_1005303141 | 275 |
| 125 | 3300005985 | Ga0081539_10002491 | Ga0081539_1000249118 | 275 |
| 126 | 3300006844 | Ga0075428_100065537 | Ga0075428_1000655372 | 275 |
| 127 | 3300009094 | Ga0111539_10052273 | Ga0111539_100522733 | 275 |
| 128 | 3300009094 | Ga0111539_10065301 | Ga0111539_100653012 | 275 |
| 129 | 3300009147 | Ga0114129_10167304 | Ga0114129_101673042 | 275 |
| 130 | 3300021384 | Ga0213876_10016047 | Ga0213876_100160472 | 275 |
| 131 | 3300021384 | Ga0213876_10064406 | Ga0213876_100644062 | 275 |
| 132 | 3300021388 | Ga0213875_10083081 | Ga0213875_100830812 | 275 |
| 133 | 3300025898 | Ga0207692_10200498 | Ga0207692_102004982 | 275 |
| 134 | 3300025906 | Ga0207699_10019777 | Ga0207699_100197772 | 275 |
| 135 | 3300025972 | Ga0207668_10318971 | Ga0207668_103189712 | 275 |
| 136 | 3300026089 | Ga0207648_10077059 | Ga0207648_100770592 | 275 |
| 137 | 3300027907 | Ga0207428_10119586 | Ga0207428_101195863 | 275 |
| 138 | 3300031240 | Ga0265320_10043402 | Ga0265320_100434023 | 275 |
| 139 | 3300037853 | Ga0436364_0496747 | Ga0436364_0496747_10369_11241 | 275 |
| 140 | 3300037853 | Ga0436364_1189683 | Ga0436364_1189683_3627_4511 | 275 |
| 141 | 3300039437 | Ga0436365_0135600 | Ga0436365_0135600_7143_7988 | 275 |
| 142 | 3300039437 | Ga0436365_0519198 | Ga0436365_0519198_3501_4385 | 275 |
| 143 | 3300039437 | Ga0436365_0592067 | Ga0436365_0592067_314_1186 | 275 |
| 144 | 3300039437 | Ga0436365_1468503 | Ga0436365_1468503_1387_2271 | 275 |
| 145 | 3300039450 | Ga0436363_0572509 | Ga0436363_0572509_69_953 | 275 |
| 146 | 3300039453 | Ga0436362_0200775 | Ga0436362_0200775_1328_2173 | 275 |
| 147 | 3300044656 | Ga0466969_0000773 | Ga0466969_0000773_14843_15691 | 275 |
| 148 | 3300044683 | Ga0466965_0178239 | Ga0466965_0178239_254_1102 | 275 |
| 149 | 3300044684 | Ga0466966_0001114 | Ga0466966_0001114_10805_11653 | 275 |
| 150 | 3300044706 | Ga0466964_0000308 | Ga0466964_0000308_7220_8068 | 275 |
| 151 | 3300044735 | Ga0466968_0000040 | Ga0466968_0000040_29646_30494 | 275 |
| 152 | 3300044765 | Ga0466970_0000014 | Ga0466970_0000014_61288_62136 | 275 |
| 153 | 3300045049 | Ga0466959_0008053 | Ga0466959_0008053_4946_5794 | 275 |
| 154 | 3300045049 | Ga0466959_0271435 | Ga0466959_0271435_257_1111 | 275 |
| 155 | 3300050507 | nmdc:mga05p37_323730_c1 | nmdc:mga05p37_323730_c1_872_1780 | 275 |
| 156 | 3300050508 | nmdc:mga09592_292134_c1 | nmdc:mga09592_292134_c1_180_1028 | 275 |
| 157 | 3300050511 | nmdc:mga08y16_40209_c1 | nmdc:mga08y16_40209_c1_2668_3516 | 275 |
| 158 | 3300005719 | Ga0068861_100328534 | Ga0068861_1003285342 | 276 |
| 159 | 3300009174 | Ga0105241_10410902 | Ga0105241_104109022 | 276 |
| 160 | 3300021358 | Ga0213873_10005691 | Ga0213873_100056912 | 276 |
| 161 | 3300021377 | Ga0213874_10000279 | Ga0213874_100002792 | 276 |
| 162 | 3300021377 | Ga0213874_10014988 | Ga0213874_100149882 | 276 |
| 163 | 3300025911 | Ga0207654_10247772 | Ga0207654_102477722 | 276 |
| 164 | 3300039450 | Ga0436363_1236354 | Ga0436363_1236354_16414_17274 | 276 |
| 165 | 3300039450 | Ga0436363_1327862 | Ga0436363_1327862_2856_3716 | 276 |
| 166 | 3300039453 | Ga0436362_0941391 | Ga0436362_0941391_9400_10260 | 276 |
| 167 | 3300048903 | Ga0496100_0013895 | Ga0496100_0013895_818_1720 | 276 |
| 168 | 3300048905 | Ga0496102_0000002 | Ga0496102_0000002_524683_525537 | 276 |
| 169 | 3300048906 | Ga0496103_0000017 | Ga0496103_0000017_117900_118754 | 276 |
| 170 | 3300048907 | Ga0496104_0000001 | Ga0496104_0000001_571396_572247 | 276 |
| 171 | 3300048913 | Ga0496110_0002884 | Ga0496110_0002884_2697_3548 | 276 |
| 172 | 3300048914 | Ga0496111_0000021 | Ga0496111_0000021_17000_17851 | 276 |
| 173 | 3300048925 | Ga0496122_0144859 | Ga0496122_0144859_448_1305 | 276 |
| 174 | 3300048929 | Ga0496126_0187830 | Ga0496126_0187830_874_1731 | 276 |
| 175 | 3300050511 | nmdc:mga08y16_193128_c1 | nmdc:mga08y16_193128_c1_1030_1878 | 276 |
| 176 | 3300005843 | Ga0068860_100025323 | Ga0068860_1000253232 | 277 |
| 177 | 3300028381 | Ga0268264_10027133 | Ga0268264_100271333 | 277 |
| 178 | 2162886012 | MBSR1b_contig_9199985 | MBSR1b_0205.00003150 | 278 |
| 179 | 3300001990 | JGI24737J22298_10075327 | JGI24737J22298_100753272 | 278 |
| 180 | 3300005327 | Ga0070658_10000364 | Ga0070658_1000036429 | 278 |
| 181 | 3300005328 | Ga0070676_10000047 | Ga0070676_1000004741 | 278 |
| 182 | 3300005330 | Ga0070690_100000098 | Ga0070690_10000009812 | 278 |
| 183 | 3300005331 | Ga0070670_100003364 | Ga0070670_1000033643 | 278 |
| 184 | 3300005333 | Ga0070677_10000063 | Ga0070677_1000006323 | 278 |
| 185 | 3300005334 | Ga0068869_100000030 | Ga0068869_10000003021 | 278 |
| 186 | 3300005335 | Ga0070666_10000458 | Ga0070666_1000045814 | 278 |
| 187 | 3300005338 | Ga0068868_100000118 | Ga0068868_10000011811 | 278 |
| 188 | 3300005339 | Ga0070660_100000050 | Ga0070660_10000005022 | 278 |
| 189 | 3300005340 | Ga0070689_100000415 | Ga0070689_10000041511 | 278 |
| 190 | 3300005343 | Ga0070687_100000138 | Ga0070687_10000013812 | 278 |
| 191 | 3300005344 | Ga0070661_100000117 | Ga0070661_10000011757 | 278 |
| 192 | 3300005345 | Ga0070692_10017140 | Ga0070692_100171403 | 278 |
| 193 | 3300005347 | Ga0070668_100000051 | Ga0070668_10000005146 | 278 |
| 194 | 3300005353 | Ga0070669_100000325 | Ga0070669_10000032514 | 278 |
| 195 | 3300005354 | Ga0070675_100000130 | Ga0070675_10000013036 | 278 |
| 196 | 3300005355 | Ga0070671_100002282 | Ga0070671_1000022826 | 278 |
| 197 | 3300005355 | Ga0070671_100197633 | Ga0070671_1001976332 | 278 |
| 198 | 3300005356 | Ga0070674_100000572 | Ga0070674_1000005728 | 278 |
| 199 | 3300005364 | Ga0070673_100036677 | Ga0070673_1000366773 | 278 |
| 200 | 3300005365 | Ga0070688_100000060 | Ga0070688_10000006012 | 278 |
| 201 | 3300005366 | Ga0070659_100000161 | Ga0070659_10000016142 | 278 |
| 202 | 3300005367 | Ga0070667_100000585 | Ga0070667_10000058514 | 278 |
| 203 | 3300005438 | Ga0070701_10014361 | Ga0070701_100143613 | 278 |
| 204 | 3300005439 | Ga0070711_100116228 | Ga0070711_1001162281 | 278 |
| 205 | 3300005440 | Ga0070705_100000326 | Ga0070705_1000003264 | 278 |
| 206 | 3300005441 | Ga0070700_100036164 | Ga0070700_1000361643 | 278 |
| 207 | 3300005455 | Ga0070663_100044656 | Ga0070663_1000446563 | 278 |
| 208 | 3300005457 | Ga0070662_100000392 | Ga0070662_1000003923 | 278 |
| 209 | 3300005459 | Ga0068867_100000317 | Ga0068867_10000031723 | 278 |
| 210 | 3300005466 | Ga0070685_10000091 | Ga0070685_1000009113 | 278 |
| 211 | 3300005467 | Ga0070706_100000006 | Ga0070706_100000006152 | 278 |
| 212 | 3300005530 | Ga0070679_100048090 | Ga0070679_1000480904 | 278 |
| 213 | 3300005535 | Ga0070684_100026207 | Ga0070684_1000262073 | 278 |
| 214 | 3300005539 | Ga0068853_100000168 | Ga0068853_10000016847 | 278 |
| 215 | 3300005543 | Ga0070672_100000413 | Ga0070672_10000041314 | 278 |
| 216 | 3300005544 | Ga0070686_100002752 | Ga0070686_1000027527 | 278 |
| 217 | 3300005548 | Ga0070665_100062636 | Ga0070665_1000626363 | 278 |
| 218 | 3300005549 | Ga0070704_100010371 | Ga0070704_1000103715 | 278 |
| 219 | 3300005563 | Ga0068855_100000205 | Ga0068855_10000020556 | 278 |
| 220 | 3300005564 | Ga0070664_100485754 | Ga0070664_1004857542 | 278 |
| 221 | 3300005577 | Ga0068857_100000129 | Ga0068857_10000012926 | 278 |
| 222 | 3300005578 | Ga0068854_100000250 | Ga0068854_10000025022 | 278 |
| 223 | 3300005614 | Ga0068856_100005213 | Ga0068856_10000521314 | 278 |
| 224 | 3300005615 | Ga0070702_100031168 | Ga0070702_1000311683 | 278 |
| 225 | 3300005616 | Ga0068852_100000245 | Ga0068852_10000024514 | 278 |
| 226 | 3300005617 | Ga0068859_100000218 | Ga0068859_10000021836 | 278 |
| 227 | 3300005618 | Ga0068864_100000408 | Ga0068864_10000040814 | 278 |
| 228 | 3300005718 | Ga0068866_10000026 | Ga0068866_1000002622 | 278 |
| 229 | 3300005719 | Ga0068861_100000053 | Ga0068861_10000005345 | 278 |
| 230 | 3300005834 | Ga0068851_10000095 | Ga0068851_100000958 | 278 |
| 231 | 3300005840 | Ga0068870_10000141 | Ga0068870_1000014112 | 278 |
| 232 | 3300005841 | Ga0068863_100001172 | Ga0068863_10000117212 | 278 |
| 233 | 3300005842 | Ga0068858_100001427 | Ga0068858_10000142714 | 278 |
| 234 | 3300005843 | Ga0068860_100001481 | Ga0068860_10000148114 | 278 |
| 235 | 3300005844 | Ga0068862_100000535 | Ga0068862_10000053542 | 278 |
| 236 | 3300005983 | Ga0081540_1001160 | Ga0081540_100116016 | 278 |
| 237 | 3300005983 | Ga0081540_1001298 | Ga0081540_10012986 | 278 |
| 238 | 3300005983 | Ga0081540_1002770 | Ga0081540_100277011 | 278 |
| 239 | 3300006028 | Ga0070717_10034284 | Ga0070717_100342843 | 278 |
| 240 | 3300006237 | Ga0097621_100000570 | Ga0097621_10000057014 | 278 |
| 241 | 3300006358 | Ga0068871_100000143 | Ga0068871_10000014344 | 278 |
| 242 | 3300006846 | Ga0075430_100137216 | Ga0075430_1001372162 | 278 |
| 243 | 3300006881 | Ga0068865_100000077 | Ga0068865_10000007712 | 278 |
| 244 | 3300006931 | Ga0097620_100000218 | Ga0097620_10000021836 | 278 |
| 245 | 3300009098 | Ga0105245_10000841 | Ga0105245_1000084122 | 278 |
| 246 | 3300009101 | Ga0105247_10000615 | Ga0105247_100006155 | 278 |
| 247 | 3300009148 | Ga0105243_10000914 | Ga0105243_100009148 | 278 |
| 248 | 3300009174 | Ga0105241_10000444 | Ga0105241_100004444 | 278 |
| 249 | 3300009176 | Ga0105242_10000925 | Ga0105242_1000092519 | 278 |
| 250 | 3300009177 | Ga0105248_10000420 | Ga0105248_1000042041 | 278 |
| 251 | 3300009545 | Ga0105237_10000339 | Ga0105237_1000033945 | 278 |
| 252 | 3300009551 | Ga0105238_10000245 | Ga0105238_1000024541 | 278 |
| 253 | 3300009553 | Ga0105249_10000229 | Ga0105249_1000022921 | 278 |
| 254 | 3300010375 | Ga0105239_10001848 | Ga0105239_1000184816 | 278 |
| 255 | 3300013100 | Ga0157373_10000481 | Ga0157373_1000048112 | 278 |
| 256 | 3300013102 | Ga0157371_10000743 | Ga0157371_100007433 | 278 |
| 257 | 3300013105 | Ga0157369_10000161 | Ga0157369_1000016145 | 278 |
| 258 | 3300013296 | Ga0157374_10000342 | Ga0157374_1000034236 | 278 |
| 259 | 3300013297 | Ga0157378_10000244 | Ga0157378_1000024445 | 278 |
| 260 | 3300013306 | Ga0163162_10000138 | Ga0163162_1000013822 | 278 |
| 261 | 3300013307 | Ga0157372_10001412 | Ga0157372_100014121 | 278 |
| 262 | 3300013308 | Ga0157375_10001320 | Ga0157375_1000132014 | 278 |
| 263 | 3300014325 | Ga0163163_10010443 | Ga0163163_100104433 | 278 |
| 264 | 3300014745 | Ga0157377_10000181 | Ga0157377_1000018121 | 278 |
| 265 | 3300014968 | Ga0157379_10000195 | Ga0157379_1000019545 | 278 |
| 266 | 3300014969 | Ga0157376_10001254 | Ga0157376_100012549 | 278 |
| 267 | 3300025315 | Ga0207697_10000115 | Ga0207697_1000011514 | 278 |
| 268 | 3300025321 | Ga0207656_10000277 | Ga0207656_100002777 | 278 |
| 269 | 3300025893 | Ga0207682_10000100 | Ga0207682_1000010010 | 278 |
| 270 | 3300025899 | Ga0207642_10000352 | Ga0207642_100003523 | 278 |
| 271 | 3300025900 | Ga0207710_10000530 | Ga0207710_100005305 | 278 |
| 272 | 3300025901 | Ga0207688_10000045 | Ga0207688_1000004548 | 278 |
| 273 | 3300025903 | Ga0207680_10000355 | Ga0207680_100003558 | 278 |
| 274 | 3300025907 | Ga0207645_10000086 | Ga0207645_1000008623 | 278 |
| 275 | 3300025908 | Ga0207643_10000031 | Ga0207643_1000003172 | 278 |
| 276 | 3300025909 | Ga0207705_10004478 | Ga0207705_100044784 | 278 |
| 277 | 3300025911 | Ga0207654_10025230 | Ga0207654_100252303 | 278 |
| 278 | 3300025913 | Ga0207695_10496952 | Ga0207695_104969521 | 278 |
| 279 | 3300025914 | Ga0207671_10001358 | Ga0207671_1000135814 | 278 |
| 280 | 3300025917 | Ga0207660_10286412 | Ga0207660_102864122 | 278 |
| 281 | 3300025918 | Ga0207662_10000056 | Ga0207662_1000005628 | 278 |
| 282 | 3300025919 | Ga0207657_10000033 | Ga0207657_1000003394 | 278 |
| 283 | 3300025920 | Ga0207649_10007446 | Ga0207649_100074465 | 278 |
| 284 | 3300025921 | Ga0207652_10154858 | Ga0207652_101548583 | 278 |
| 285 | 3300025923 | Ga0207681_10000166 | Ga0207681_1000016620 | 278 |
| 286 | 3300025925 | Ga0207650_10000305 | Ga0207650_1000030541 | 278 |
| 287 | 3300025926 | Ga0207659_10000103 | Ga0207659_1000010341 | 278 |
| 288 | 3300025927 | Ga0207687_10001081 | Ga0207687_100010813 | 278 |
| 289 | 3300025931 | Ga0207644_10001343 | Ga0207644_1000134316 | 278 |
| 290 | 3300025932 | Ga0207690_10004431 | Ga0207690_100044313 | 278 |
| 291 | 3300025933 | Ga0207706_10000303 | Ga0207706_1000030311 | 278 |
| 292 | 3300025934 | Ga0207686_10005356 | Ga0207686_100053566 | 278 |
| 293 | 3300025935 | Ga0207709_10001792 | Ga0207709_100017923 | 278 |
| 294 | 3300025936 | Ga0207670_10000082 | Ga0207670_1000008246 | 278 |
| 295 | 3300025937 | Ga0207669_10000189 | Ga0207669_1000018915 | 278 |
| 296 | 3300025938 | Ga0207704_10000087 | Ga0207704_1000008710 | 278 |
| 297 | 3300025940 | Ga0207691_10000035 | Ga0207691_1000003512 | 278 |
| 298 | 3300025941 | Ga0207711_10000208 | Ga0207711_1000020823 | 278 |
| 299 | 3300025942 | Ga0207689_10000012 | Ga0207689_1000001294 | 278 |
| 300 | 3300025944 | Ga0207661_10000731 | Ga0207661_1000073113 | 278 |
| 301 | 3300025945 | Ga0207679_10000253 | Ga0207679_1000025312 | 278 |
| 302 | 3300025949 | Ga0207667_10003992 | Ga0207667_100039928 | 278 |
| 303 | 3300025960 | Ga0207651_10000029 | Ga0207651_1000002921 | 278 |
| 304 | 3300025961 | Ga0207712_10000192 | Ga0207712_1000019243 | 278 |
| 305 | 3300025972 | Ga0207668_10032574 | Ga0207668_100325743 | 278 |
| 306 | 3300025981 | Ga0207640_10000569 | Ga0207640_1000056911 | 278 |
| 307 | 3300025986 | Ga0207658_10000651 | Ga0207658_1000065111 | 278 |
| 308 | 3300026023 | Ga0207677_10000196 | Ga0207677_1000019641 | 278 |
| 309 | 3300026023 | Ga0207677_10382153 | Ga0207677_103821531 | 278 |
| 310 | 3300026035 | Ga0207703_10000239 | Ga0207703_1000023923 | 278 |
| 311 | 3300026041 | Ga0207639_10000227 | Ga0207639_1000022711 | 278 |
| 312 | 3300026067 | Ga0207678_10001711 | Ga0207678_1000171121 | 278 |
| 313 | 3300026075 | Ga0207708_10054395 | Ga0207708_100543953 | 278 |
| 314 | 3300026078 | Ga0207702_10001102 | Ga0207702_1000110212 | 278 |
| 315 | 3300026088 | Ga0207641_10001188 | Ga0207641_1000118811 | 278 |
| 316 | 3300026089 | Ga0207648_10000315 | Ga0207648_1000031511 | 278 |
| 317 | 3300026095 | Ga0207676_10000238 | Ga0207676_1000023841 | 278 |
| 318 | 3300026116 | Ga0207674_10000286 | Ga0207674_1000028651 | 278 |
| 319 | 3300026118 | Ga0207675_100000026 | Ga0207675_10000002611 | 278 |
| 320 | 3300026121 | Ga0207683_10000090 | Ga0207683_1000009046 | 278 |
| 321 | 3300026142 | Ga0207698_10000210 | Ga0207698_1000021021 | 278 |
| 322 | 3300028379 | Ga0268266_10000628 | Ga0268266_1000062841 | 278 |
| 323 | 3300028380 | Ga0268265_10000533 | Ga0268265_1000053315 | 278 |
| 324 | 3300028381 | Ga0268264_10000522 | Ga0268264_1000052211 | 278 |
| 325 | 3300031731 | Ga0307405_10129724 | Ga0307405_101297242 | 278 |
| 326 | 3300039450 | Ga0436363_0942783 | Ga0436363_0942783_45_881 | 278 |
| 327 | 3300042005 | Ga0439448_0112330 | Ga0439448_0112330_71_910 | 278 |
| 328 | 3300044658 | Ga0466972_0023105 | Ga0466972_0023105_1530_2378 | 278 |
| 329 | 3300046683 | Ga0495658_0014365 | Ga0495658_0014365_2075_2911 | 278 |
| 330 | 3300047318 | Ga0495636_0020184 | Ga0495636_0020184_1628_2470 | 278 |
| 331 | 3300048904 | Ga0496101_0490343 | Ga0496101_0490343_65_901 | 278 |
| 332 | 3300048905 | Ga0496102_0004726 | Ga0496102_0004726_4725_5561 | 278 |
| 333 | 3300048912 | Ga0496109_0179605 | Ga0496109_0179605_192_1028 | 278 |
| 334 | 3300048915 | Ga0496112_0000088 | Ga0496112_0000088_24866_25702 | 278 |
| 335 | 3300048916 | Ga0496113_0004164 | Ga0496113_0004164_7409_8245 | 278 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3l0g-assembly1.cif.gz_C | crystal structure of nicotinate-nucleotide pyrophosphorylase from ehrlichia chaffeensis at 2.05a resolution | 0.9656 | 5 | 276 |
| 1x1o-assembly1.cif.gz_A | crystal structure of project id tt0268 from thermus thermophilus hb8 | 0.9639 | 4 | 278 |
| 5hul-assembly1.cif.gz_A | crystal structure of nadc deletion mutant in cubic space group | 0.9585 | 5 | 278 |
| 3gnn-assembly1.cif.gz_A | crystal structure of nicotinate-nucleotide pyrophosphorylase from burkholderi pseudomallei | 0.9556 | 3 | 276 |
| 5huo-assembly1.cif.gz_E-3 | crystal structure of nadc deletion mutant in c2221 space group | 0.9516 | 4 | 278 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D6EUR3_65_193_3.90.1170.20 | Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Quinolinate phosphoribosyl transferase, N-terminal domain | 0.9737 | 4 | 119 | 3.90.1170.20 |
| af_Q9ZU32_47_153_3.90.1170.20 | Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Quinolinate phosphoribosyl transferase, N-terminal domain | 0.9712 | 6 | 110 | 3.90.1170.20 |
| 1x1oB01 | Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Quinolinate phosphoribosyl transferase, N-terminal domain | 0.9615 | 1 | 121 | 3.90.1170.20 |
| 3l0gD02 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.96 | 112 | 265 | 3.20.20.70 |
| af_P30011_147_280_3.90.1170.20 | Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Quinolinate phosphoribosyl transferase, N-terminal domain | 0.9563 | 125 | 259 | 3.90.1170.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A848LF09-F1-model_v4 | nicotinate-nucleotide diphosphorylase (carboxylating) (EC 2.4.2.19) (Quinolinate phosphoribosyltransferase [decarboxylating]) | 0.9851 | 9 | 277 |
GO:0004514
GO:0005737 GO:0009435 GO:0034213 |
| AF-A0A7C6DMD4-F1-model_v4 | Nicotinate-nucleotide diphosphorylase (Carboxylating) | 0.9841 | 3 | 156 |
GO:0004514
GO:0005737 GO:0009435 GO:0034213 |
| AF-A0A4Q5Z927-F1-model_v4 | deleted | 0.9839 | 9 | 270 |
|
| AF-A0A1Q3HHV6-F1-model_v4 | nicotinate-nucleotide diphosphorylase (carboxylating) (EC 2.4.2.19) (Quinolinate phosphoribosyltransferase [decarboxylating]) | 0.9838 | 34 | 278 |
GO:0004514
GO:0005737 GO:0009435 GO:0034213 |
| AF-A0A4Q3C2S7-F1-model_v4 | deleted | 0.9832 | 71 | 278 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar