F412062

General Info

Members Datasets Scaffolds Average Seq Length
335 228 335 132

Family's Representative Sequence

Representative Sequence 3300003320|rootH2_10088056|rootH2_100880562
Length 135
Sequence MMKLTPELHSLVLVAVVTVLMWIPYMAARIFTRGPVKTLANPDPAFKPDPAWAERARRAHANAVENLVVFAPLVIVAAMLGVSTPTTVMAANVYLWARIAHFVVYAAGIPVLRTLAFAAGFAATLAMAGAVLGQA

Samples

Sample ID Description Type Environment
1 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
6 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
7 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
8 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
9 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
10 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
11 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
12 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
13 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
14 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
83 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
84 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
120 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
121 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
122 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
123 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
124 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
125 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
126 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
127 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
128 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
129 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
130 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
131 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
132 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
133 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
134 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
135 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
136 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
137 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
138 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
139 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
140 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
141 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
142 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
143 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
144 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
145 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
146 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
147 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
148 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
150 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
151 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
152 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
153 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
154 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
155 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
156 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
157 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
158 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
159 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
160 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
161 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
162 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
163 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
164 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
165 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
166 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
167 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
168 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
169 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
170 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
171 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
172 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
173 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
174 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
175 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
176 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
177 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
178 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
179 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
180 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
181 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
182 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
183 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
184 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
185 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
186 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
187 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
188 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
189 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
190 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
191 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
192 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
193 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
194 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
195 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
196 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
197 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
198 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
199 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
200 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
201 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
202 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
203 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
204 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
205 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
206 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
207 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
208 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
209 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
210 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
211 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
212 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
213 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
214 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
215 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
216 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
217 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
218 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
219 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
220 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
221 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
222 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
223 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
224 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
225 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
226 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
227 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
228 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.04
Nodule 0
Rhizoplane 11.94
Rhizosphere 72.84
Stem 0
Stem Tuber 0
Unclassified 4.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10032940 3300003215 Bacteria 1719
2 rootH2_10088056 3300003320 Bacteria 2404
3 rootL2_10309207 3300003322 Bacteria 1100
4 rootH1_10308701 3300003323 Bacteria 1418
5 rootH1_10340903 3300003323 Bacteria 5139
6 Ga0055535_1026428 3300003761 Unclassified 643
7 Ga0055529_1004789 3300003763 Bacteria 2025
8 Ga0055526_1018945 3300003771 Bacteria 2534
9 Ga0055537_1000005 3300003773 Bacteria 160497
10 Ga0055524_1004182 3300003775 Bacteria 6734
11 Ga0055524_1081161 3300003775 Bacteria 590
12 Ga0055534_1000127 3300003784 Bacteria 57100
13 Ga0055528_1000063 3300003790 Bacteria 85587
14 Ga0055530_10000085 3300003791 Bacteria 80382
15 Ga0055531_10001673 3300003794 Bacteria 15960
16 Ga0065165_1000414 3300005262 Bacteria 67711
17 Ga0070676_11075099 3300005328 Unclassified 607
18 Ga0070690_100706065 3300005330 Bacteria 775
19 Ga0070670_101049204 3300005331 Unclassified 742
20 Ga0070677_10675820 3300005333 Unclassified 579
21 Ga0070666_10707459 3300005335 Unclassified 739
22 Ga0070680_100163741 3300005336 Bacteria 1870
23 Ga0070680_101567504 3300005336 Unclassified 571
24 Ga0070682_100217738 3300005337 Bacteria 1357
25 Ga0070682_100253163 3300005337 Bacteria 1271
26 Ga0070682_101000624 3300005337 Unclassified 694
27 Ga0070660_100628306 3300005339 Bacteria 899
28 Ga0070691_10236617 3300005341 Unclassified 974
29 Ga0070661_100595732 3300005344 Bacteria 893
30 Ga0070671_100095816 3300005355 Bacteria 2488
31 Ga0070671_100104266 3300005355 Bacteria 2380
32 Ga0070674_100210494 3300005356 Bacteria 1506
33 Ga0070710_10109446 3300005437 Bacteria 1657
34 Ga0070711_100221127 3300005439 Bacteria 1472
35 Ga0070711_100580043 3300005439 Unclassified 933
36 Ga0070705_100736665 3300005440 Unclassified 778
37 Ga0070700_100249980 3300005441 Unclassified 1271
38 Ga0070700_100274770 3300005441 Bacteria 1219
39 Ga0070663_101623692 3300005455 Bacteria 577
40 Ga0070678_100232533 3300005456 Bacteria 1537
41 Ga0070678_100359196 3300005456 Bacteria 1255
42 Ga0070662_100230124 3300005457 Bacteria 1482
43 Ga0070681_10883438 3300005458 Unclassified 812
44 Ga0068867_100244031 3300005459 Bacteria 1458
45 Ga0068853_102097031 3300005539 Unclassified 548
46 Ga0070672_101278252 3300005543 Bacteria 655
47 Ga0070695_100504852 3300005545 Unclassified 936
48 Ga0070695_100775502 3300005545 Bacteria 766
49 Ga0070693_100012005 3300005547 Bacteria 4374
50 Ga0070693_100449225 3300005547 Unclassified 904
51 Ga0070665_102415871 3300005548 Unclassified 528
52 Ga0070665_102456461 3300005548 Unclassified 523
53 Ga0070664_100197764 3300005564 Unclassified 1793
54 Ga0068864_100721469 3300005618 Unclassified 975
55 Ga0068866_10415002 3300005718 Unclassified 872
56 Ga0068863_100056085 3300005841 Bacteria 3730
57 Ga0068862_100894801 3300005844 Bacteria 872
58 Ga0075365_10645772 3300006038 Bacteria 748
59 Ga0075364_10297373 3300006051 Bacteria 1099
60 Ga0075367_10720052 3300006178 Bacteria 635
61 Ga0097621_100191313 3300006237 Bacteria 1772
62 Ga0097621_101239641 3300006237 Unclassified 703
63 Ga0097621_101435892 3300006237 Bacteria 654
64 Ga0097621_102138584 3300006237 Bacteria 535
65 Ga0068871_100019344 3300006358 Bacteria 5198
66 Ga0068871_100117668 3300006358 Bacteria 2241
67 Ga0068871_100318579 3300006358 Bacteria 1369
68 Ga0068871_100729545 3300006358 Bacteria 909
69 Ga0068871_101153230 3300006358 Bacteria 726
70 Ga0075428_100622405 3300006844 Bacteria 1152
71 Ga0075431_100209398 3300006847 Bacteria 1992
72 Ga0075433_10017141 3300006852 Bacteria 5993
73 Ga0075434_100024715 3300006871 Bacteria 5874
74 Ga0075434_100212226 3300006871 Unclassified 1956
75 Ga0068865_100238045 3300006881 Bacteria 1431
76 Ga0068865_100479819 3300006881 Bacteria 1033
77 Ga0075436_100878475 3300006914 Bacteria 670
78 Ga0105240_10000115 3300009093 Bacteria 165594
79 Ga0105240_12567477 3300009093 Bacteria 526
80 Ga0111539_10086028 3300009094 Bacteria 3695
81 Ga0105245_10034576 3300009098 Bacteria 4483
82 Ga0105245_10110740 3300009098 Bacteria 2553
83 Ga0105245_11451914 3300009098 Bacteria 736
84 Ga0105247_11223535 3300009101 Unclassified 599
85 Ga0105243_10244928 3300009148 Bacteria 1597
86 Ga0105243_10929634 3300009148 Bacteria 867
87 Ga0105243_11649630 3300009148 Unclassified 669
88 Ga0105241_10132492 3300009174 Bacteria 2020
89 Ga0105242_10083958 3300009176 Bacteria 2668
90 Ga0105242_10545496 3300009176 Bacteria 1111
91 Ga0105248_10017412 3300009177 Bacteria 7922
92 Ga0105248_10039894 3300009177 Bacteria 5263
93 Ga0105248_10653408 3300009177 Bacteria 1186
94 Ga0105248_12231352 3300009177 Bacteria 623
95 Ga0105237_10749337 3300009545 Bacteria 983
96 Ga0105238_10520081 3300009551 Bacteria 1192
97 Ga0105238_11216852 3300009551 Bacteria 778
98 Ga0105239_10206423 3300010375 Bacteria 2201
99 Ga0105239_10481381 3300010375 Bacteria 1410
100 Ga0105239_11243928 3300010375 Unclassified 858
101 Ga0105246_10427733 3300011119 Bacteria 1107
102 Ga0157370_10220488 3300013104 Bacteria 1757
103 Ga0157374_11934180 3300013296 Unclassified 616
104 Ga0157378_10186479 3300013297 Bacteria 1954
105 Ga0157378_10835310 3300013297 Bacteria 949
106 Ga0163162_10054199 3300013306 Bacteria 4033
107 Ga0163162_10483511 3300013306 Bacteria 1369
108 Ga0157380_10378616 3300014326 Bacteria 1335
109 Ga0157377_10645693 3300014745 Unclassified 761
110 Ga0157376_10139715 3300014969 Bacteria 2171
111 Ga0157376_10260507 3300014969 Bacteria 1624
112 Ga0157376_10359069 3300014969 Unclassified 1397
113 Ga0163161_10032455 3300017792 Bacteria 3728
114 Ga0163161_10034854 3300017792 Bacteria 3600
115 Ga0209258_102814 3300025242 Bacteria 4173
116 Ga0209565_1000074 3300025263 Bacteria 164237
117 Ga0209455_1001534 3300025272 Bacteria 10303
118 Ga0209673_1000129 3300025273 Bacteria 164238
119 Ga0209675_1000072 3300025291 Bacteria 164237
120 Ga0209564_1000160 3300025295 Bacteria 164214
121 Ga0209758_1001079 3300025297 Bacteria 35474
122 Ga0209050_1000034 3300025298 Bacteria 433906
123 Ga0209256_1000125 3300025299 Bacteria 165336
124 Ga0209256_1000146 3300025299 Bacteria 149440
125 Ga0209257_1000052 3300025304 Bacteria 430947
126 Ga0209257_1000100 3300025304 Bacteria 253399
127 Ga0209257_1011367 3300025304 Bacteria 4297
128 Ga0207692_10210710 3300025898 Unclassified 1147
129 Ga0207692_10283808 3300025898 Unclassified 1003
130 Ga0207680_10900082 3300025903 Unclassified 634
131 Ga0207685_10210128 3300025905 Unclassified 920
132 Ga0207654_10467527 3300025911 Bacteria 887
133 Ga0207707_10180230 3300025912 Bacteria 1844
134 Ga0207707_10218064 3300025912 Bacteria 1661
135 Ga0207695_10000116 3300025913 Bacteria 239510
136 Ga0207663_10322942 3300025916 Bacteria 1160
137 Ga0207657_10441459 3300025919 Unclassified 1022
138 Ga0207652_10277703 3300025921 Unclassified 1511
139 Ga0207687_10027802 3300025927 Bacteria 3796
140 Ga0207687_11056927 3300025927 Unclassified 697
141 Ga0207700_11209557 3300025928 Bacteria 674
142 Ga0207644_10990428 3300025931 Unclassified 705
143 Ga0207644_11248859 3300025931 Bacteria 624
144 Ga0207706_10080149 3300025933 Bacteria 2871
145 Ga0207686_10097083 3300025934 Bacteria 1959
146 Ga0207686_10892387 3300025934 Unclassified 717
147 Ga0207709_11131032 3300025935 Unclassified 644
148 Ga0207669_10187554 3300025937 Bacteria 1489
149 Ga0207704_10534632 3300025938 Unclassified 950
150 Ga0207704_11147033 3300025938 Bacteria 661
151 Ga0207665_10382394 3300025939 Bacteria 1068
152 Ga0207691_10799722 3300025940 Bacteria 792
153 Ga0207711_10013223 3300025941 Bacteria 6857
154 Ga0207711_10446267 3300025941 Bacteria 1204
155 Ga0207651_10982302 3300025960 Bacteria 754
156 Ga0207651_11411780 3300025960 Unclassified 627
157 Ga0207658_10180925 3300025986 Bacteria 1745
158 Ga0207677_12241543 3300026023 Bacteria 508
159 Ga0207703_10304394 3300026035 Bacteria 1455
160 Ga0207678_10017033 3300026067 Bacteria 6381
161 Ga0207708_10425045 3300026075 Bacteria 1102
162 Ga0207708_10467888 3300026075 Bacteria 1052
163 Ga0207641_10182504 3300026088 Bacteria 1923
164 Ga0207675_100513441 3300026118 Bacteria 1194
165 Ga0207683_10057789 3300026121 Bacteria 3405
166 Ga0207683_10489607 3300026121 Bacteria 1135
167 Ga0207428_10179995 3300027907 Bacteria 1598
168 Ga0268266_10000003 3300028379 Bacteria 1701703
169 Ga0268266_10290464 3300028379 Bacteria 1523
170 Ga0268266_11041090 3300028379 Bacteria 792
171 Ga0268265_11085253 3300028380 Bacteria 794
172 Ga0268265_11365736 3300028380 Unclassified 710
173 Ga0265325_10007227 3300031241 Bacteria 6677
174 Ga0265325_10238480 3300031241 Bacteria 827
175 Ga0265331_10326680 3300031250 Bacteria 687
176 Ga0307509_10020609 3300031507 Bacteria 7477
177 Ga0307509_10468540 3300031507 Bacteria 950
178 Ga0307416_100960561 3300032002 Bacteria 957
179 Ga0373950_0138436 3300034818 Unclassified 550
180 Ga0373958_0009154 3300034819 Bacteria 1624
181 Ga0373938_0053811 3300034957 Bacteria 925
182 Ga0373929_0001716 3300035085 Bacteria 4119
183 Ga0373934_0039890 3300035086 Bacteria 1851
184 Ga0373940_0032211 3300035088 Bacteria 1404
185 Ga0373944_0125292 3300035089 Bacteria 889
186 Ga0373951_0104333 3300035091 Unclassified 757
187 Ga0373951_0109965 3300035091 Unclassified 741
188 Ga0373923_0211088 3300035111 Bacteria 900
189 Ga0373941_0491737 3300035115 Unclassified 520
190 Ga0373953_0045821 3300035117 Bacteria 1754
191 Ga0373954_0160005 3300035118 Bacteria 1101
192 Ga0373956_0001709 3300035119 Bacteria 9055
193 Ga0373960_0029630 3300035121 Bacteria 1519
194 Ga0373943_0026041 3300035170 Bacteria 2738
195 Ga0373943_0624267 3300035170 Bacteria 636
196 Ga0373946_0150984 3300035171 Bacteria 1084
197 Ga0373955_0047021 3300035172 Bacteria 2335
198 Ga0373942_0008860 3300035207 Bacteria 2350
199 Ga0373961_0031127 3300035241 Bacteria 1488
200 Ga0373962_0202186 3300035242 Unclassified 673
201 Ga0373931_0003638 3300035691 Bacteria 6962
202 Ga0373931_0009778 3300035691 Bacteria 4592
203 Ga0373931_0067587 3300035691 Bacteria 1943
204 Ga0373931_0445544 3300035691 Bacteria 827
205 Ga0373935_0174954 3300035692 Bacteria 1470
206 Ga0373927_0270578 3300035695 Bacteria 1117
207 Ga0373927_0608462 3300035695 Bacteria 722
208 Ga0373933_0337171 3300035724 Unclassified 978
209 Ga0373933_0671302 3300035724 Bacteria 681
210 Ga0373947_0018023 3300035725 Bacteria 4063
211 Ga0373947_0053316 3300035725 Bacteria 2438
212 Ga0373947_0224498 3300035725 Bacteria 1236
213 Ga0373937_0374761 3300036401 Bacteria 1349
214 Ga0373925_0072489 3300037068 Bacteria 2606
215 Ga0373925_0098481 3300037068 Bacteria 2244
216 Ga0373925_0830001 3300037068 Unclassified 762
217 Ga0436365_0211847 3300039437 Bacteria 772
218 Ga0495592_0008274 3300046454 Bacteria 7808
219 Ga0495592_0268512 3300046454 Bacteria 1120
220 Ga0495603_0170817 3300046455 Bacteria 1259
221 Ga0495629_0414726 3300046459 Bacteria 914
222 Ga0495638_0397934 3300046460 Bacteria 715
223 Ga0495651_0007988 3300046462 Bacteria 8113
224 Ga0495653_0302605 3300046463 Bacteria 1042
225 Ga0495664_0031346 3300046477 Bacteria 3116
226 Ga0495664_0129665 3300046477 Bacteria 1526
227 Ga0495594_0116188 3300046499 Bacteria 1511
228 Ga0495606_0000194 3300046507 Bacteria 106498
229 Ga0495608_0009002 3300046511 Bacteria 6981
230 Ga0495618_0156829 3300046514 Bacteria 1452
231 Ga0495620_0000016 3300046515 Bacteria 153638
232 Ga0495628_0081667 3300046516 Bacteria 2510
233 Ga0495628_0370127 3300046516 Bacteria 1051
234 Ga0495630_0043991 3300046517 Bacteria 3337
235 Ga0495631_0486863 3300046518 Bacteria 525
236 Ga0495652_0086128 3300046529 Bacteria 2580
237 Ga0495652_0927833 3300046529 Bacteria 573
238 Ga0495640_0098782 3300046533 Bacteria 1918
239 Ga0495586_0007328 3300046535 Bacteria 5888
240 Ga0495587_0000789 3300046536 Bacteria 21156
241 Ga0495645_0021815 3300046543 Bacteria 4629
242 Ga0495645_0184457 3300046543 Bacteria 1427
243 Ga0495667_0004879 3300046559 Bacteria 9068
244 Ga0495634_0437966 3300046642 Unclassified 772
245 Ga0495635_0015470 3300046663 Bacteria 5334
246 Ga0495657_0004003 3300046675 Bacteria 11826
247 Ga0495599_0003713 3300046678 Bacteria 8948
248 Ga0495623_0022240 3300046679 Bacteria 4095
249 Ga0495646_0015592 3300046680 Bacteria 4821
250 Ga0495647_0186262 3300046681 Bacteria 905
251 Ga0495613_0381205 3300046689 Bacteria 964
252 Ga0495624_0299465 3300046690 Bacteria 970
253 Ga0495589_0183997 3300046794 Bacteria 990
254 Ga0495600_0087597 3300046809 Bacteria 2031
255 Ga0495604_0010602 3300047317 Bacteria 7308
256 Ga0495604_0459849 3300047317 Bacteria 830
257 Ga0495674_0050112 3300047319 Bacteria 3685
258 Ga0495674_0338990 3300047319 Bacteria 1222
259 Ga0495680_0108951 3300047322 Bacteria 2055
260 Ga0495680_0227718 3300047322 Bacteria 1328
261 Ga0495675_0053782 3300047444 Bacteria 2555
262 Ga0495593_0040321 3300047673 Bacteria 2514
263 Ga0495593_0140729 3300047673 Unclassified 1222
264 Ga0495602_0051885 3300048088 Bacteria 3648
265 Ga0495602_0575511 3300048088 Bacteria 777
266 Ga0496100_0001666 3300048903 Bacteria 11022
267 Ga0496100_0015882 3300048903 Bacteria 4408
268 Ga0496100_0395275 3300048903 Bacteria 1052
269 Ga0496101_0001037 3300048904 Bacteria 16401
270 Ga0496102_0008876 3300048905 Bacteria 8628
271 Ga0496102_0203145 3300048905 Unclassified 1868
272 Ga0496102_0431299 3300048905 Bacteria 1238
273 Ga0496102_0855612 3300048905 Bacteria 831
274 Ga0496104_0018257 3300048907 Bacteria 6399
275 Ga0496104_0566662 3300048907 Unclassified 1046
276 Ga0496104_0660688 3300048907 Bacteria 954
277 Ga0496104_1307823 3300048907 Unclassified 628
278 Ga0496105_0004561 3300048908 Bacteria 10432
279 Ga0496105_0301487 3300048908 Unclassified 1288
280 Ga0496106_0016464 3300048909 Bacteria 5470
281 Ga0496106_0051586 3300048909 Bacteria 3102
282 Ga0496106_0778726 3300048909 Unclassified 759
283 Ga0496107_0035841 3300048910 Bacteria 3558
284 Ga0496107_0111107 3300048910 Bacteria 2014
285 Ga0496107_0216104 3300048910 Bacteria 1426
286 Ga0496108_0017308 3300048911 Bacteria 5895
287 Ga0496108_0104912 3300048911 Bacteria 2413
288 Ga0496109_0418156 3300048912 Bacteria 1266
289 Ga0496110_0016195 3300048913 Bacteria 6218
290 Ga0496111_0054501 3300048914 Bacteria 2891
291 Ga0496112_0127134 3300048915 Bacteria 2519
292 Ga0496112_0659719 3300048915 Bacteria 975
293 Ga0496113_0138598 3300048916 Bacteria 1913
294 Ga0496113_0750652 3300048916 Unclassified 777
295 Ga0496114_0004415 3300048917 Bacteria 10917
296 Ga0496114_0028188 3300048917 Bacteria 4606
297 Ga0496114_0792254 3300048917 Unclassified 826
298 Ga0496114_1098740 3300048917 Unclassified 680
299 Ga0496114_1135755 3300048917 Bacteria 667
300 Ga0496115_0012480 3300048918 Bacteria 6396
301 Ga0496115_0053387 3300048918 Bacteria 3243
302 Ga0496115_0077194 3300048918 Bacteria 2708
303 Ga0496115_0159783 3300048918 Bacteria 1862
304 Ga0496115_0419842 3300048918 Bacteria 1084
305 Ga0496115_0460834 3300048918 Bacteria 1025
306 Ga0496119_0038357 3300048922 Bacteria 3097
307 Ga0496120_0052590 3300048923 Bacteria 2319
308 Ga0496121_0001427 3300048924 Bacteria 40370
309 Ga0496121_0011460 3300048924 Bacteria 9843
310 Ga0496125_0067152 3300048928 Bacteria 2828
311 Ga0496126_0029098 3300048929 Bacteria 5251
312 Ga0496126_0401537 3300048929 Bacteria 1111
313 Ga0501071_1611960 3300049587 Bacteria 501
314 Ga0501079_0614055 3300049741 Bacteria 856
315 Ga0501083_0127817 3300049744 Bacteria 1666
316 nmdc:mga03683_563118_c1 3300050489 Bacteria 555
317 nmdc:mga03n38_698587_c1 3300050490 Unclassified 584
318 nmdc:mga00v17_123656_c1 3300050491 Bacteria 1649
319 nmdc:mga06z11_438596_c1 3300050494 Bacteria 788
320 nmdc:mga08y16_246020_c1 3300050511 Bacteria 1848
321 nmdc:mga0n895_100378_c1 3300050512 Bacteria 2903
322 nmdc:mga0a205_137759_c1 3300050515 Bacteria 2341
323 Ga0495601_0092067 3300053077 Bacteria 1952
324 Ga0495601_0142376 3300053077 Bacteria 1564
325 Ga0495612_0013082 3300053078 Bacteria 3342
326 Ga0495595_0026689 3300053084 Bacteria 2567
327 Ga0495595_0032060 3300053084 Bacteria 2365
328 Ga0495619_0015112 3300053085 Bacteria 4879
329 Ga0495619_0170007 3300053085 Bacteria 1507
330 Ga0500652_000546 3300053131 Bacteria 13134
331 Ga0500658_0053302 3300053134 Bacteria 1659
332 Ga0500559_0508287 3300053136 Bacteria 553
333 Ga0500588_0000070 3300053146 Bacteria 15026
334 Ga0500616_0220378 3300053153 Bacteria 828
335 Ga0501082_0755929 3300060353 Bacteria 851

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005333 Ga0070677_10675820 Ga0070677_106758202 105
2 3300005336 Ga0070680_101567504 Ga0070680_1015675041 105
3 3300005355 Ga0070671_100104266 Ga0070671_1001042666 105
4 3300005439 Ga0070711_100580043 Ga0070711_1005800432 105
5 3300005456 Ga0070678_100232533 Ga0070678_1002325332 105
6 3300005539 Ga0068853_102097031 Ga0068853_1020970312 105
7 3300005718 Ga0068866_10415002 Ga0068866_104150021 108
8 3300025898 Ga0207692_10283808 Ga0207692_102838082 108
9 3300025931 Ga0207644_10990428 Ga0207644_109904282 108
10 3300010375 Ga0105239_10206423 Ga0105239_102064233 109
11 3300006358 Ga0068871_100729545 Ga0068871_1007295452 110
12 3300025905 Ga0207685_10210128 Ga0207685_102101282 110
13 3300050494 nmdc:mga06z11_438596_c1 nmdc:mga06z11_438596_c1_435_776 112
14 3300048917 Ga0496114_1098740 Ga0496114_1098740_303_665 118
15 3300053146 Ga0500588_0000070 Ga0500588_0000070_11723_12127 120
16 3300046529 Ga0495652_0927833 Ga0495652_0927833_189_560 122
17 3300005331 Ga0070670_101049204 Ga0070670_1010492041 125
18 3300005548 Ga0070665_102415871 Ga0070665_1024158711 125
19 3300049587 Ga0501071_1611960 Ga0501071_1611960_12_395 126
20 3300048922 Ga0496119_0038357 Ga0496119_0038357_974_1366 129
21 3300048923 Ga0496120_0052590 Ga0496120_0052590_1064_1456 129
22 3300048924 Ga0496121_0011460 Ga0496121_0011460_8868_9260 129
23 3300048928 Ga0496125_0067152 Ga0496125_0067152_503_895 129
24 3300053153 Ga0500616_0220378 Ga0500616_0220378_416_811 130
25 3300005328 Ga0070676_11075099 Ga0070676_110750992 131
26 3300005330 Ga0070690_100706065 Ga0070690_1007060652 131
27 3300005335 Ga0070666_10707459 Ga0070666_107074592 131
28 3300005336 Ga0070680_100163741 Ga0070680_1001637411 131
29 3300005337 Ga0070682_100217738 Ga0070682_1002177381 131
30 3300005337 Ga0070682_100253163 Ga0070682_1002531632 131
31 3300005337 Ga0070682_101000624 Ga0070682_1010006241 131
32 3300005339 Ga0070660_100628306 Ga0070660_1006283062 131
33 3300005341 Ga0070691_10236617 Ga0070691_102366171 131
34 3300005355 Ga0070671_100095816 Ga0070671_1000958161 131
35 3300005356 Ga0070674_100210494 Ga0070674_1002104942 131
36 3300005437 Ga0070710_10109446 Ga0070710_101094463 131
37 3300005440 Ga0070705_100736665 Ga0070705_1007366652 131
38 3300005441 Ga0070700_100249980 Ga0070700_1002499802 131
39 3300005441 Ga0070700_100274770 Ga0070700_1002747702 131
40 3300005455 Ga0070663_101623692 Ga0070663_1016236921 131
41 3300005456 Ga0070678_100359196 Ga0070678_1003591962 131
42 3300005457 Ga0070662_100230124 Ga0070662_1002301241 131
43 3300005458 Ga0070681_10883438 Ga0070681_108834381 131
44 3300005459 Ga0068867_100244031 Ga0068867_1002440312 131
45 3300005543 Ga0070672_101278252 Ga0070672_1012782522 131
46 3300005545 Ga0070695_100504852 Ga0070695_1005048521 131
47 3300005545 Ga0070695_100775502 Ga0070695_1007755021 131
48 3300005547 Ga0070693_100012005 Ga0070693_1000120053 131
49 3300005547 Ga0070693_100449225 Ga0070693_1004492251 131
50 3300005548 Ga0070665_102456461 Ga0070665_1024564611 131
51 3300005564 Ga0070664_100197764 Ga0070664_1001977642 131
52 3300005618 Ga0068864_100721469 Ga0068864_1007214692 131
53 3300005841 Ga0068863_100056085 Ga0068863_1000560855 131
54 3300005844 Ga0068862_100894801 Ga0068862_1008948012 131
55 3300006038 Ga0075365_10645772 Ga0075365_106457722 131
56 3300006051 Ga0075364_10297373 Ga0075364_102973732 131
57 3300006178 Ga0075367_10720052 Ga0075367_107200522 131
58 3300006237 Ga0097621_100191313 Ga0097621_1001913133 131
59 3300006237 Ga0097621_101239641 Ga0097621_1012396412 131
60 3300006237 Ga0097621_101435892 Ga0097621_1014358922 131
61 3300006237 Ga0097621_102138584 Ga0097621_1021385841 131
62 3300006358 Ga0068871_100019344 Ga0068871_1000193446 131
63 3300006358 Ga0068871_100117668 Ga0068871_1001176682 131
64 3300006358 Ga0068871_100318579 Ga0068871_1003185792 131
65 3300006358 Ga0068871_101153230 Ga0068871_1011532301 131
66 3300006844 Ga0075428_100622405 Ga0075428_1006224051 131
67 3300006847 Ga0075431_100209398 Ga0075431_1002093983 131
68 3300006852 Ga0075433_10017141 Ga0075433_100171412 131
69 3300006871 Ga0075434_100024715 Ga0075434_1000247156 131
70 3300006871 Ga0075434_100212226 Ga0075434_1002122262 131
71 3300006881 Ga0068865_100238045 Ga0068865_1002380453 131
72 3300006881 Ga0068865_100479819 Ga0068865_1004798191 131
73 3300006914 Ga0075436_100878475 Ga0075436_1008784751 131
74 3300009093 Ga0105240_12567477 Ga0105240_125674771 131
75 3300009094 Ga0111539_10086028 Ga0111539_100860282 131
76 3300009098 Ga0105245_10034576 Ga0105245_100345766 131
77 3300009098 Ga0105245_10110740 Ga0105245_101107403 131
78 3300009101 Ga0105247_11223535 Ga0105247_112235351 131
79 3300009148 Ga0105243_10244928 Ga0105243_102449282 131
80 3300009148 Ga0105243_11649630 Ga0105243_116496302 131
81 3300009174 Ga0105241_10132492 Ga0105241_101324921 131
82 3300009176 Ga0105242_10083958 Ga0105242_100839583 131
83 3300009176 Ga0105242_10545496 Ga0105242_105454962 131
84 3300009177 Ga0105248_10017412 Ga0105248_100174123 131
85 3300009177 Ga0105248_10039894 Ga0105248_100398942 131
86 3300009177 Ga0105248_10653408 Ga0105248_106534081 131
87 3300009177 Ga0105248_12231352 Ga0105248_122313521 131
88 3300009545 Ga0105237_10749337 Ga0105237_107493371 131
89 3300009551 Ga0105238_10520081 Ga0105238_105200812 131
90 3300010375 Ga0105239_10481381 Ga0105239_104813811 131
91 3300010375 Ga0105239_11243928 Ga0105239_112439282 131
92 3300011119 Ga0105246_10427733 Ga0105246_104277331 131
93 3300013296 Ga0157374_11934180 Ga0157374_119341802 131
94 3300013297 Ga0157378_10186479 Ga0157378_101864792 131
95 3300013297 Ga0157378_10835310 Ga0157378_108353102 131
96 3300013306 Ga0163162_10054199 Ga0163162_100541994 131
97 3300013306 Ga0163162_10483511 Ga0163162_104835112 131
98 3300014745 Ga0157377_10645693 Ga0157377_106456932 131
99 3300014969 Ga0157376_10139715 Ga0157376_101397154 131
100 3300014969 Ga0157376_10260507 Ga0157376_102605072 131
101 3300014969 Ga0157376_10359069 Ga0157376_103590692 131
102 3300017792 Ga0163161_10034854 Ga0163161_100348542 131
103 3300025304 Ga0209257_1011367 Ga0209257_10113672 131
104 3300025898 Ga0207692_10210710 Ga0207692_102107102 131
105 3300025903 Ga0207680_10900082 Ga0207680_109000821 131
106 3300025911 Ga0207654_10467527 Ga0207654_104675272 131
107 3300025912 Ga0207707_10180230 Ga0207707_101802303 131
108 3300025912 Ga0207707_10218064 Ga0207707_102180642 131
109 3300025919 Ga0207657_10441459 Ga0207657_104414592 131
110 3300025921 Ga0207652_10277703 Ga0207652_102777032 131
111 3300025927 Ga0207687_10027802 Ga0207687_100278027 131
112 3300025927 Ga0207687_11056927 Ga0207687_110569272 131
113 3300025928 Ga0207700_11209557 Ga0207700_112095572 131
114 3300025931 Ga0207644_11248859 Ga0207644_112488591 131
115 3300025933 Ga0207706_10080149 Ga0207706_100801493 131
116 3300025934 Ga0207686_10097083 Ga0207686_100970831 131
117 3300025934 Ga0207686_10892387 Ga0207686_108923872 131
118 3300025935 Ga0207709_11131032 Ga0207709_111310322 131
119 3300025937 Ga0207669_10187554 Ga0207669_101875542 131
120 3300025938 Ga0207704_10534632 Ga0207704_105346321 131
121 3300025938 Ga0207704_11147033 Ga0207704_111470331 131
122 3300025939 Ga0207665_10382394 Ga0207665_103823942 131
123 3300025940 Ga0207691_10799722 Ga0207691_107997222 131
124 3300025941 Ga0207711_10013223 Ga0207711_100132234 131
125 3300025941 Ga0207711_10446267 Ga0207711_104462672 131
126 3300025960 Ga0207651_10982302 Ga0207651_109823021 131
127 3300025960 Ga0207651_11411780 Ga0207651_114117801 131
128 3300025986 Ga0207658_10180925 Ga0207658_101809252 131
129 3300026023 Ga0207677_12241543 Ga0207677_122415431 131
130 3300026035 Ga0207703_10304394 Ga0207703_103043943 131
131 3300026067 Ga0207678_10017033 Ga0207678_100170333 131
132 3300026075 Ga0207708_10425045 Ga0207708_104250451 131
133 3300026075 Ga0207708_10467888 Ga0207708_104678882 131
134 3300026088 Ga0207641_10182504 Ga0207641_101825042 131
135 3300026118 Ga0207675_100513441 Ga0207675_1005134412 131
136 3300026121 Ga0207683_10057789 Ga0207683_100577894 131
137 3300026121 Ga0207683_10489607 Ga0207683_104896072 131
138 3300027907 Ga0207428_10179995 Ga0207428_101799952 131
139 3300028379 Ga0268266_10290464 Ga0268266_102904642 131
140 3300028379 Ga0268266_11041090 Ga0268266_110410901 131
141 3300028380 Ga0268265_11085253 Ga0268265_110852532 131
142 3300028380 Ga0268265_11365736 Ga0268265_113657362 131
143 3300031241 Ga0265325_10007227 Ga0265325_100072274 131
144 3300031241 Ga0265325_10238480 Ga0265325_102384802 131
145 3300031250 Ga0265331_10326680 Ga0265331_103266802 131
146 3300031507 Ga0307509_10020609 Ga0307509_100206093 131
147 3300031507 Ga0307509_10468540 Ga0307509_104685402 131
148 3300032002 Ga0307416_100960561 Ga0307416_1009605611 131
149 3300034818 Ga0373950_0138436 Ga0373950_0138436_67_468 131
150 3300034819 Ga0373958_0009154 Ga0373958_0009154_1163_1558 131
151 3300034957 Ga0373938_0053811 Ga0373938_0053811_440_835 131
152 3300035085 Ga0373929_0001716 Ga0373929_0001716_2523_2918 131
153 3300035086 Ga0373934_0039890 Ga0373934_0039890_250_651 131
154 3300035088 Ga0373940_0032211 Ga0373940_0032211_855_1250 131
155 3300035089 Ga0373944_0125292 Ga0373944_0125292_239_637 131
156 3300035091 Ga0373951_0104333 Ga0373951_0104333_83_484 131
157 3300035091 Ga0373951_0109965 Ga0373951_0109965_246_647 131
158 3300035111 Ga0373923_0211088 Ga0373923_0211088_418_819 131
159 3300035115 Ga0373941_0491737 Ga0373941_0491737_97_498 131
160 3300035117 Ga0373953_0045821 Ga0373953_0045821_374_775 131
161 3300035118 Ga0373954_0160005 Ga0373954_0160005_168_569 131
162 3300035119 Ga0373956_0001709 Ga0373956_0001709_1135_1536 131
163 3300035121 Ga0373960_0029630 Ga0373960_0029630_985_1380 131
164 3300035170 Ga0373943_0026041 Ga0373943_0026041_2045_2443 131
165 3300035170 Ga0373943_0624267 Ga0373943_0624267_165_563 131
166 3300035171 Ga0373946_0150984 Ga0373946_0150984_67_465 131
167 3300035172 Ga0373955_0047021 Ga0373955_0047021_805_1206 131
168 3300035207 Ga0373942_0008860 Ga0373942_0008860_1292_1687 131
169 3300035241 Ga0373961_0031127 Ga0373961_0031127_288_686 131
170 3300035242 Ga0373962_0202186 Ga0373962_0202186_227_628 131
171 3300035691 Ga0373931_0003638 Ga0373931_0003638_6164_6559 131
172 3300035691 Ga0373931_0009778 Ga0373931_0009778_14_415 131
173 3300035691 Ga0373931_0067587 Ga0373931_0067587_1074_1475 131
174 3300035691 Ga0373931_0445544 Ga0373931_0445544_284_682 131
175 3300035692 Ga0373935_0174954 Ga0373935_0174954_35_433 131
176 3300035695 Ga0373927_0270578 Ga0373927_0270578_608_1006 131
177 3300035695 Ga0373927_0608462 Ga0373927_0608462_289_690 131
178 3300035724 Ga0373933_0337171 Ga0373933_0337171_253_654 131
179 3300035724 Ga0373933_0671302 Ga0373933_0671302_114_512 131
180 3300035725 Ga0373947_0018023 Ga0373947_0018023_2951_3349 131
181 3300035725 Ga0373947_0053316 Ga0373947_0053316_1041_1442 131
182 3300035725 Ga0373947_0224498 Ga0373947_0224498_201_599 131
183 3300036401 Ga0373937_0374761 Ga0373937_0374761_432_833 131
184 3300037068 Ga0373925_0072489 Ga0373925_0072489_931_1329 131
185 3300037068 Ga0373925_0098481 Ga0373925_0098481_1807_2205 131
186 3300037068 Ga0373925_0830001 Ga0373925_0830001_250_651 131
187 3300039437 Ga0436365_0211847 Ga0436365_0211847_115_513 131
188 3300046454 Ga0495592_0008274 Ga0495592_0008274_4912_5313 131
189 3300046454 Ga0495592_0268512 Ga0495592_0268512_544_942 131
190 3300046455 Ga0495603_0170817 Ga0495603_0170817_733_1134 131
191 3300046459 Ga0495629_0414726 Ga0495629_0414726_293_694 131
192 3300046462 Ga0495651_0007988 Ga0495651_0007988_647_1048 131
193 3300046463 Ga0495653_0302605 Ga0495653_0302605_498_899 131
194 3300046477 Ga0495664_0031346 Ga0495664_0031346_214_615 131
195 3300046477 Ga0495664_0129665 Ga0495664_0129665_988_1389 131
196 3300046499 Ga0495594_0116188 Ga0495594_0116188_610_1011 131
197 3300046511 Ga0495608_0009002 Ga0495608_0009002_2558_2959 131
198 3300046514 Ga0495618_0156829 Ga0495618_0156829_275_676 131
199 3300046516 Ga0495628_0081667 Ga0495628_0081667_22_423 131
200 3300046516 Ga0495628_0370127 Ga0495628_0370127_248_646 131
201 3300046517 Ga0495630_0043991 Ga0495630_0043991_2875_3276 131
202 3300046529 Ga0495652_0086128 Ga0495652_0086128_1312_1713 131
203 3300046533 Ga0495640_0098782 Ga0495640_0098782_765_1166 131
204 3300046535 Ga0495586_0007328 Ga0495586_0007328_1397_1798 131
205 3300046536 Ga0495587_0000789 Ga0495587_0000789_18213_18614 131
206 3300046543 Ga0495645_0021815 Ga0495645_0021815_1834_2235 131
207 3300046543 Ga0495645_0184457 Ga0495645_0184457_534_932 131
208 3300046559 Ga0495667_0004879 Ga0495667_0004879_524_925 131
209 3300046642 Ga0495634_0437966 Ga0495634_0437966_305_706 131
210 3300046663 Ga0495635_0015470 Ga0495635_0015470_843_1244 131
211 3300046675 Ga0495657_0004003 Ga0495657_0004003_2552_2953 131
212 3300046678 Ga0495599_0003713 Ga0495599_0003713_7736_8137 131
213 3300046679 Ga0495623_0022240 Ga0495623_0022240_2624_3025 131
214 3300046680 Ga0495646_0015592 Ga0495646_0015592_2203_2604 131
215 3300046681 Ga0495647_0186262 Ga0495647_0186262_341_739 131
216 3300046689 Ga0495613_0381205 Ga0495613_0381205_77_478 131
217 3300046690 Ga0495624_0299465 Ga0495624_0299465_524_925 131
218 3300046794 Ga0495589_0183997 Ga0495589_0183997_177_575 131
219 3300046809 Ga0495600_0087597 Ga0495600_0087597_644_1045 131
220 3300047317 Ga0495604_0010602 Ga0495604_0010602_4835_5236 131
221 3300047317 Ga0495604_0459849 Ga0495604_0459849_77_475 131
222 3300047319 Ga0495674_0050112 Ga0495674_0050112_2395_2796 131
223 3300047319 Ga0495674_0338990 Ga0495674_0338990_697_1095 131
224 3300047322 Ga0495680_0108951 Ga0495680_0108951_875_1273 131
225 3300047322 Ga0495680_0227718 Ga0495680_0227718_890_1291 131
226 3300047444 Ga0495675_0053782 Ga0495675_0053782_856_1257 131
227 3300047673 Ga0495593_0040321 Ga0495593_0040321_1503_1904 131
228 3300048088 Ga0495602_0051885 Ga0495602_0051885_853_1254 131
229 3300048088 Ga0495602_0575511 Ga0495602_0575511_38_436 131
230 3300048903 Ga0496100_0001666 Ga0496100_0001666_8539_8934 131
231 3300048903 Ga0496100_0015882 Ga0496100_0015882_1194_1595 131
232 3300048904 Ga0496101_0001037 Ga0496101_0001037_10846_11241 131
233 3300048905 Ga0496102_0008876 Ga0496102_0008876_3386_3781 131
234 3300048905 Ga0496102_0203145 Ga0496102_0203145_493_894 131
235 3300048905 Ga0496102_0431299 Ga0496102_0431299_263_661 131
236 3300048905 Ga0496102_0855612 Ga0496102_0855612_53_454 131
237 3300048907 Ga0496104_0018257 Ga0496104_0018257_3082_3483 131
238 3300048907 Ga0496104_0566662 Ga0496104_0566662_263_664 131
239 3300048907 Ga0496104_0660688 Ga0496104_0660688_370_771 131
240 3300048907 Ga0496104_1307823 Ga0496104_1307823_123_521 131
241 3300048908 Ga0496105_0004561 Ga0496105_0004561_5797_6192 131
242 3300048908 Ga0496105_0301487 Ga0496105_0301487_232_633 131
243 3300048909 Ga0496106_0016464 Ga0496106_0016464_4744_5139 131
244 3300048909 Ga0496106_0051586 Ga0496106_0051586_236_637 131
245 3300048909 Ga0496106_0778726 Ga0496106_0778726_330_731 131
246 3300048910 Ga0496107_0035841 Ga0496107_0035841_80_475 131
247 3300048910 Ga0496107_0111107 Ga0496107_0111107_267_668 131
248 3300048910 Ga0496107_0216104 Ga0496107_0216104_987_1388 131
249 3300048911 Ga0496108_0017308 Ga0496108_0017308_4344_4739 131
250 3300048911 Ga0496108_0104912 Ga0496108_0104912_617_1018 131
251 3300048912 Ga0496109_0418156 Ga0496109_0418156_704_1099 131
252 3300048913 Ga0496110_0016195 Ga0496110_0016195_5639_6034 131
253 3300048914 Ga0496111_0054501 Ga0496111_0054501_1108_1503 131
254 3300048915 Ga0496112_0127134 Ga0496112_0127134_1309_1704 131
255 3300048915 Ga0496112_0659719 Ga0496112_0659719_250_645 131
256 3300048916 Ga0496113_0138598 Ga0496113_0138598_787_1182 131
257 3300048916 Ga0496113_0750652 Ga0496113_0750652_31_426 131
258 3300048917 Ga0496114_0004415 Ga0496114_0004415_4472_4867 131
259 3300048917 Ga0496114_0028188 Ga0496114_0028188_2150_2551 131
260 3300048917 Ga0496114_0792254 Ga0496114_0792254_19_420 131
261 3300048917 Ga0496114_1135755 Ga0496114_1135755_170_571 131
262 3300048918 Ga0496115_0012480 Ga0496115_0012480_1577_1978 131
263 3300048918 Ga0496115_0053387 Ga0496115_0053387_2598_2993 131
264 3300048918 Ga0496115_0077194 Ga0496115_0077194_2114_2515 131
265 3300048918 Ga0496115_0419842 Ga0496115_0419842_595_996 131
266 3300048918 Ga0496115_0460834 Ga0496115_0460834_51_452 131
267 3300049741 Ga0501079_0614055 Ga0501079_0614055_443_841 131
268 3300049744 Ga0501083_0127817 Ga0501083_0127817_1016_1414 131
269 3300050489 nmdc:mga03683_563118_c1 nmdc:mga03683_563118_c1_38_436 131
270 3300050490 nmdc:mga03n38_698587_c1 nmdc:mga03n38_698587_c1_17_418 131
271 3300050491 nmdc:mga00v17_123656_c1 nmdc:mga00v17_123656_c1_345_743 131
272 3300050511 nmdc:mga08y16_246020_c1 nmdc:mga08y16_246020_c1_503_904 131
273 3300050512 nmdc:mga0n895_100378_c1 nmdc:mga0n895_100378_c1_187_588 131
274 3300050515 nmdc:mga0a205_137759_c1 nmdc:mga0a205_137759_c1_92_493 131
275 3300053077 Ga0495601_0092067 Ga0495601_0092067_268_669 131
276 3300053077 Ga0495601_0142376 Ga0495601_0142376_876_1274 131
277 3300053078 Ga0495612_0013082 Ga0495612_0013082_374_775 131
278 3300053084 Ga0495595_0026689 Ga0495595_0026689_323_724 131
279 3300053084 Ga0495595_0032060 Ga0495595_0032060_600_998 131
280 3300053085 Ga0495619_0015112 Ga0495619_0015112_758_1159 131
281 3300053085 Ga0495619_0170007 Ga0495619_0170007_592_990 131
282 3300053131 Ga0500652_000546 Ga0500652_000546_11698_12096 131
283 3300053136 Ga0500559_0508287 Ga0500559_0508287_73_474 131
284 3300060353 Ga0501082_0755929 Ga0501082_0755929_261_659 131
285 3300005344 Ga0070661_100595732 Ga0070661_1005957322 132
286 3300005439 Ga0070711_100221127 Ga0070711_1002211272 132
287 3300013104 Ga0157370_10220488 Ga0157370_102204882 132
288 3300014326 Ga0157380_10378616 Ga0157380_103786162 132
289 3300017792 Ga0163161_10032455 Ga0163161_100324554 132
290 3300025916 Ga0207663_10322942 Ga0207663_103229422 132
291 3300046460 Ga0495638_0397934 Ga0495638_0397934_214_612 132
292 3300046507 Ga0495606_0000194 Ga0495606_0000194_46338_46736 132
293 3300046515 Ga0495620_0000016 Ga0495620_0000016_57432_57830 132
294 3300046518 Ga0495631_0486863 Ga0495631_0486863_44_442 132
295 3300048929 Ga0496126_0401537 Ga0496126_0401537_466_864 132
296 3300003215 JGI25153J46596_10032940 JGI25153J46596_100329401 133
297 3300003320 rootH2_10088056 rootH2_100880562 133
298 3300003322 rootL2_10309207 rootL2_103092072 133
299 3300003323 rootH1_10308701 rootH1_103087012 133
300 3300003323 rootH1_10340903 rootH1_103409034 133
301 3300003761 Ga0055535_1026428 Ga0055535_10264281 133
302 3300003763 Ga0055529_1004789 Ga0055529_10047892 133
303 3300003771 Ga0055526_1018945 Ga0055526_10189451 133
304 3300003773 Ga0055537_1000005 Ga0055537_100000539 133
305 3300003775 Ga0055524_1004182 Ga0055524_10041825 133
306 3300003775 Ga0055524_1081161 Ga0055524_10811611 133
307 3300003784 Ga0055534_1000127 Ga0055534_100012743 133
308 3300003790 Ga0055528_1000063 Ga0055528_100006339 133
309 3300003791 Ga0055530_10000085 Ga0055530_1000008559 133
310 3300003794 Ga0055531_10001673 Ga0055531_100016735 133
311 3300005262 Ga0065165_1000414 Ga0065165_100041437 133
312 3300009093 Ga0105240_10000115 Ga0105240_10000115112 133
313 3300009098 Ga0105245_11451914 Ga0105245_114519141 133
314 3300009148 Ga0105243_10929634 Ga0105243_109296342 133
315 3300009551 Ga0105238_11216852 Ga0105238_112168522 133
316 3300025242 Ga0209258_102814 Ga0209258_1028144 133
317 3300025263 Ga0209565_1000074 Ga0209565_1000074116 133
318 3300025272 Ga0209455_1001534 Ga0209455_10015342 133
319 3300025273 Ga0209673_1000129 Ga0209673_100012945 133
320 3300025291 Ga0209675_1000072 Ga0209675_100007245 133
321 3300025295 Ga0209564_1000160 Ga0209564_100016044 133
322 3300025297 Ga0209758_1001079 Ga0209758_100107911 133
323 3300025298 Ga0209050_1000034 Ga0209050_1000034170 133
324 3300025299 Ga0209256_1000125 Ga0209256_100012545 133
325 3300025299 Ga0209256_1000146 Ga0209256_100014654 133
326 3300025304 Ga0209257_1000052 Ga0209257_1000052240 133
327 3300025304 Ga0209257_1000100 Ga0209257_1000100105 133
328 3300025913 Ga0207695_10000116 Ga0207695_10000116120 133
329 3300028379 Ga0268266_10000003 Ga0268266_10000003933 133
330 3300047673 Ga0495593_0140729 Ga0495593_0140729_185_592 133
331 3300048903 Ga0496100_0395275 Ga0496100_0395275_411_818 133
332 3300048918 Ga0496115_0159783 Ga0496115_0159783_911_1312 133
333 3300048924 Ga0496121_0001427 Ga0496121_0001427_23142_23552 133
334 3300048929 Ga0496126_0029098 Ga0496126_0029098_4703_5110 133
335 3300053134 Ga0500658_0053302 Ga0500658_0053302_40_444 133

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01124

MAPEG

MAPEG family

8

133

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4i1m-assembly2.cif.gz_B crystal structure of the legionella pneumophila gap domain of lepb 0.8471 86 129
4bpm-assembly1.cif.gz_A crystal structure of a human integral membrane enzyme 0.8 4 131
3dww-assembly1.cif.gz_C electron crystallographic structure of human microsomal prostaglandin e synthase 1 0.769 5 131
4bpm-assembly1.cif.gz_A crystal structure of a human integral membrane enzyme 0.7676 4 131
5bqg-assembly1.cif.gz_A crystal structure of mpges-1 bound to an inhibitor 0.7523 5 131
ID Description Score Start End Superfamily
4wabA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.8102 5 131 1.20.120.550
4yl1A00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.8082 5 131 1.20.120.550
af_B0R1E9_1_152_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7959 5 132 1.20.120.550
4wabA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.772 5 131 1.20.120.550
4yl1A00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.77 5 131 1.20.120.550
ID Description Score Start End GO Terms
AF-A0A533JAF3-F1-model_v4 deleted 0.9852 47 132
AF-A0A1S8FIP3-F1-model_v4 MAPEG family protein 0.9815 3 132 GO:0016020
AF-A0A7S7Z5G2-F1-model_v4 MAPEG family protein 0.9796 3 131 GO:0016020
AF-A0A2M8R4K8-F1-model_v4 MAPEG family protein 0.9794 3 132 GO:0016020
AF-A0A4R3U1U7-F1-model_v4 Putative MAPEG superfamily protein 0.9787 3 132 GO:0016020

Feature Viewer

pLDDT pTM Quality
96.11 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map