F412062
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 335 | 228 | 335 | 132 |
Family's Representative Sequence
| Representative Sequence | 3300003320|rootH2_10088056|rootH2_100880562 |
| Length | 135 |
| Sequence | MMKLTPELHSLVLVAVVTVLMWIPYMAARIFTRGPVKTLANPDPAFKPDPAWAERARRAHANAVENLVVFAPLVIVAAMLGVSTPTTVMAANVYLWARIAHFVVYAAGIPVLRTLAFAAGFAATLAMAGAVLGQA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 2 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 3 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 4 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 5 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 6 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 7 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 8 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 9 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 10 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 11 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 12 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 13 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 14 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 15 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 36 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 37 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 43 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 44 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 45 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 46 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 47 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 48 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 49 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 51 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 52 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 53 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 54 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 55 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 56 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 57 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 79 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 81 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 82 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 83 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 86 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 117 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 120 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 121 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 122 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 123 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 124 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 125 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 126 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 127 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 128 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 129 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 130 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 131 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 132 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 133 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 134 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 135 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 136 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 137 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 138 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 139 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 140 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 141 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 142 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 143 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 144 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 145 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 146 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 147 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 148 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 149 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 150 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 151 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 190 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 191 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 192 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 193 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 194 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 195 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 196 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 197 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 198 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 199 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 200 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 201 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 202 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 203 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 204 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 205 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 206 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 207 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 208 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 209 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 210 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 211 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 212 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 213 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 214 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 215 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 216 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 217 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 218 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 219 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 224 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 225 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 226 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 227 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 228 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.04 |
| Nodule | 0 |
| Rhizoplane | 11.94 |
| Rhizosphere | 72.84 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.18 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25153J46596_10032940 | 3300003215 | Bacteria | 1719 |
| 2 | rootH2_10088056 | 3300003320 | Bacteria | 2404 |
| 3 | rootL2_10309207 | 3300003322 | Bacteria | 1100 |
| 4 | rootH1_10308701 | 3300003323 | Bacteria | 1418 |
| 5 | rootH1_10340903 | 3300003323 | Bacteria | 5139 |
| 6 | Ga0055535_1026428 | 3300003761 | Unclassified | 643 |
| 7 | Ga0055529_1004789 | 3300003763 | Bacteria | 2025 |
| 8 | Ga0055526_1018945 | 3300003771 | Bacteria | 2534 |
| 9 | Ga0055537_1000005 | 3300003773 | Bacteria | 160497 |
| 10 | Ga0055524_1004182 | 3300003775 | Bacteria | 6734 |
| 11 | Ga0055524_1081161 | 3300003775 | Bacteria | 590 |
| 12 | Ga0055534_1000127 | 3300003784 | Bacteria | 57100 |
| 13 | Ga0055528_1000063 | 3300003790 | Bacteria | 85587 |
| 14 | Ga0055530_10000085 | 3300003791 | Bacteria | 80382 |
| 15 | Ga0055531_10001673 | 3300003794 | Bacteria | 15960 |
| 16 | Ga0065165_1000414 | 3300005262 | Bacteria | 67711 |
| 17 | Ga0070676_11075099 | 3300005328 | Unclassified | 607 |
| 18 | Ga0070690_100706065 | 3300005330 | Bacteria | 775 |
| 19 | Ga0070670_101049204 | 3300005331 | Unclassified | 742 |
| 20 | Ga0070677_10675820 | 3300005333 | Unclassified | 579 |
| 21 | Ga0070666_10707459 | 3300005335 | Unclassified | 739 |
| 22 | Ga0070680_100163741 | 3300005336 | Bacteria | 1870 |
| 23 | Ga0070680_101567504 | 3300005336 | Unclassified | 571 |
| 24 | Ga0070682_100217738 | 3300005337 | Bacteria | 1357 |
| 25 | Ga0070682_100253163 | 3300005337 | Bacteria | 1271 |
| 26 | Ga0070682_101000624 | 3300005337 | Unclassified | 694 |
| 27 | Ga0070660_100628306 | 3300005339 | Bacteria | 899 |
| 28 | Ga0070691_10236617 | 3300005341 | Unclassified | 974 |
| 29 | Ga0070661_100595732 | 3300005344 | Bacteria | 893 |
| 30 | Ga0070671_100095816 | 3300005355 | Bacteria | 2488 |
| 31 | Ga0070671_100104266 | 3300005355 | Bacteria | 2380 |
| 32 | Ga0070674_100210494 | 3300005356 | Bacteria | 1506 |
| 33 | Ga0070710_10109446 | 3300005437 | Bacteria | 1657 |
| 34 | Ga0070711_100221127 | 3300005439 | Bacteria | 1472 |
| 35 | Ga0070711_100580043 | 3300005439 | Unclassified | 933 |
| 36 | Ga0070705_100736665 | 3300005440 | Unclassified | 778 |
| 37 | Ga0070700_100249980 | 3300005441 | Unclassified | 1271 |
| 38 | Ga0070700_100274770 | 3300005441 | Bacteria | 1219 |
| 39 | Ga0070663_101623692 | 3300005455 | Bacteria | 577 |
| 40 | Ga0070678_100232533 | 3300005456 | Bacteria | 1537 |
| 41 | Ga0070678_100359196 | 3300005456 | Bacteria | 1255 |
| 42 | Ga0070662_100230124 | 3300005457 | Bacteria | 1482 |
| 43 | Ga0070681_10883438 | 3300005458 | Unclassified | 812 |
| 44 | Ga0068867_100244031 | 3300005459 | Bacteria | 1458 |
| 45 | Ga0068853_102097031 | 3300005539 | Unclassified | 548 |
| 46 | Ga0070672_101278252 | 3300005543 | Bacteria | 655 |
| 47 | Ga0070695_100504852 | 3300005545 | Unclassified | 936 |
| 48 | Ga0070695_100775502 | 3300005545 | Bacteria | 766 |
| 49 | Ga0070693_100012005 | 3300005547 | Bacteria | 4374 |
| 50 | Ga0070693_100449225 | 3300005547 | Unclassified | 904 |
| 51 | Ga0070665_102415871 | 3300005548 | Unclassified | 528 |
| 52 | Ga0070665_102456461 | 3300005548 | Unclassified | 523 |
| 53 | Ga0070664_100197764 | 3300005564 | Unclassified | 1793 |
| 54 | Ga0068864_100721469 | 3300005618 | Unclassified | 975 |
| 55 | Ga0068866_10415002 | 3300005718 | Unclassified | 872 |
| 56 | Ga0068863_100056085 | 3300005841 | Bacteria | 3730 |
| 57 | Ga0068862_100894801 | 3300005844 | Bacteria | 872 |
| 58 | Ga0075365_10645772 | 3300006038 | Bacteria | 748 |
| 59 | Ga0075364_10297373 | 3300006051 | Bacteria | 1099 |
| 60 | Ga0075367_10720052 | 3300006178 | Bacteria | 635 |
| 61 | Ga0097621_100191313 | 3300006237 | Bacteria | 1772 |
| 62 | Ga0097621_101239641 | 3300006237 | Unclassified | 703 |
| 63 | Ga0097621_101435892 | 3300006237 | Bacteria | 654 |
| 64 | Ga0097621_102138584 | 3300006237 | Bacteria | 535 |
| 65 | Ga0068871_100019344 | 3300006358 | Bacteria | 5198 |
| 66 | Ga0068871_100117668 | 3300006358 | Bacteria | 2241 |
| 67 | Ga0068871_100318579 | 3300006358 | Bacteria | 1369 |
| 68 | Ga0068871_100729545 | 3300006358 | Bacteria | 909 |
| 69 | Ga0068871_101153230 | 3300006358 | Bacteria | 726 |
| 70 | Ga0075428_100622405 | 3300006844 | Bacteria | 1152 |
| 71 | Ga0075431_100209398 | 3300006847 | Bacteria | 1992 |
| 72 | Ga0075433_10017141 | 3300006852 | Bacteria | 5993 |
| 73 | Ga0075434_100024715 | 3300006871 | Bacteria | 5874 |
| 74 | Ga0075434_100212226 | 3300006871 | Unclassified | 1956 |
| 75 | Ga0068865_100238045 | 3300006881 | Bacteria | 1431 |
| 76 | Ga0068865_100479819 | 3300006881 | Bacteria | 1033 |
| 77 | Ga0075436_100878475 | 3300006914 | Bacteria | 670 |
| 78 | Ga0105240_10000115 | 3300009093 | Bacteria | 165594 |
| 79 | Ga0105240_12567477 | 3300009093 | Bacteria | 526 |
| 80 | Ga0111539_10086028 | 3300009094 | Bacteria | 3695 |
| 81 | Ga0105245_10034576 | 3300009098 | Bacteria | 4483 |
| 82 | Ga0105245_10110740 | 3300009098 | Bacteria | 2553 |
| 83 | Ga0105245_11451914 | 3300009098 | Bacteria | 736 |
| 84 | Ga0105247_11223535 | 3300009101 | Unclassified | 599 |
| 85 | Ga0105243_10244928 | 3300009148 | Bacteria | 1597 |
| 86 | Ga0105243_10929634 | 3300009148 | Bacteria | 867 |
| 87 | Ga0105243_11649630 | 3300009148 | Unclassified | 669 |
| 88 | Ga0105241_10132492 | 3300009174 | Bacteria | 2020 |
| 89 | Ga0105242_10083958 | 3300009176 | Bacteria | 2668 |
| 90 | Ga0105242_10545496 | 3300009176 | Bacteria | 1111 |
| 91 | Ga0105248_10017412 | 3300009177 | Bacteria | 7922 |
| 92 | Ga0105248_10039894 | 3300009177 | Bacteria | 5263 |
| 93 | Ga0105248_10653408 | 3300009177 | Bacteria | 1186 |
| 94 | Ga0105248_12231352 | 3300009177 | Bacteria | 623 |
| 95 | Ga0105237_10749337 | 3300009545 | Bacteria | 983 |
| 96 | Ga0105238_10520081 | 3300009551 | Bacteria | 1192 |
| 97 | Ga0105238_11216852 | 3300009551 | Bacteria | 778 |
| 98 | Ga0105239_10206423 | 3300010375 | Bacteria | 2201 |
| 99 | Ga0105239_10481381 | 3300010375 | Bacteria | 1410 |
| 100 | Ga0105239_11243928 | 3300010375 | Unclassified | 858 |
| 101 | Ga0105246_10427733 | 3300011119 | Bacteria | 1107 |
| 102 | Ga0157370_10220488 | 3300013104 | Bacteria | 1757 |
| 103 | Ga0157374_11934180 | 3300013296 | Unclassified | 616 |
| 104 | Ga0157378_10186479 | 3300013297 | Bacteria | 1954 |
| 105 | Ga0157378_10835310 | 3300013297 | Bacteria | 949 |
| 106 | Ga0163162_10054199 | 3300013306 | Bacteria | 4033 |
| 107 | Ga0163162_10483511 | 3300013306 | Bacteria | 1369 |
| 108 | Ga0157380_10378616 | 3300014326 | Bacteria | 1335 |
| 109 | Ga0157377_10645693 | 3300014745 | Unclassified | 761 |
| 110 | Ga0157376_10139715 | 3300014969 | Bacteria | 2171 |
| 111 | Ga0157376_10260507 | 3300014969 | Bacteria | 1624 |
| 112 | Ga0157376_10359069 | 3300014969 | Unclassified | 1397 |
| 113 | Ga0163161_10032455 | 3300017792 | Bacteria | 3728 |
| 114 | Ga0163161_10034854 | 3300017792 | Bacteria | 3600 |
| 115 | Ga0209258_102814 | 3300025242 | Bacteria | 4173 |
| 116 | Ga0209565_1000074 | 3300025263 | Bacteria | 164237 |
| 117 | Ga0209455_1001534 | 3300025272 | Bacteria | 10303 |
| 118 | Ga0209673_1000129 | 3300025273 | Bacteria | 164238 |
| 119 | Ga0209675_1000072 | 3300025291 | Bacteria | 164237 |
| 120 | Ga0209564_1000160 | 3300025295 | Bacteria | 164214 |
| 121 | Ga0209758_1001079 | 3300025297 | Bacteria | 35474 |
| 122 | Ga0209050_1000034 | 3300025298 | Bacteria | 433906 |
| 123 | Ga0209256_1000125 | 3300025299 | Bacteria | 165336 |
| 124 | Ga0209256_1000146 | 3300025299 | Bacteria | 149440 |
| 125 | Ga0209257_1000052 | 3300025304 | Bacteria | 430947 |
| 126 | Ga0209257_1000100 | 3300025304 | Bacteria | 253399 |
| 127 | Ga0209257_1011367 | 3300025304 | Bacteria | 4297 |
| 128 | Ga0207692_10210710 | 3300025898 | Unclassified | 1147 |
| 129 | Ga0207692_10283808 | 3300025898 | Unclassified | 1003 |
| 130 | Ga0207680_10900082 | 3300025903 | Unclassified | 634 |
| 131 | Ga0207685_10210128 | 3300025905 | Unclassified | 920 |
| 132 | Ga0207654_10467527 | 3300025911 | Bacteria | 887 |
| 133 | Ga0207707_10180230 | 3300025912 | Bacteria | 1844 |
| 134 | Ga0207707_10218064 | 3300025912 | Bacteria | 1661 |
| 135 | Ga0207695_10000116 | 3300025913 | Bacteria | 239510 |
| 136 | Ga0207663_10322942 | 3300025916 | Bacteria | 1160 |
| 137 | Ga0207657_10441459 | 3300025919 | Unclassified | 1022 |
| 138 | Ga0207652_10277703 | 3300025921 | Unclassified | 1511 |
| 139 | Ga0207687_10027802 | 3300025927 | Bacteria | 3796 |
| 140 | Ga0207687_11056927 | 3300025927 | Unclassified | 697 |
| 141 | Ga0207700_11209557 | 3300025928 | Bacteria | 674 |
| 142 | Ga0207644_10990428 | 3300025931 | Unclassified | 705 |
| 143 | Ga0207644_11248859 | 3300025931 | Bacteria | 624 |
| 144 | Ga0207706_10080149 | 3300025933 | Bacteria | 2871 |
| 145 | Ga0207686_10097083 | 3300025934 | Bacteria | 1959 |
| 146 | Ga0207686_10892387 | 3300025934 | Unclassified | 717 |
| 147 | Ga0207709_11131032 | 3300025935 | Unclassified | 644 |
| 148 | Ga0207669_10187554 | 3300025937 | Bacteria | 1489 |
| 149 | Ga0207704_10534632 | 3300025938 | Unclassified | 950 |
| 150 | Ga0207704_11147033 | 3300025938 | Bacteria | 661 |
| 151 | Ga0207665_10382394 | 3300025939 | Bacteria | 1068 |
| 152 | Ga0207691_10799722 | 3300025940 | Bacteria | 792 |
| 153 | Ga0207711_10013223 | 3300025941 | Bacteria | 6857 |
| 154 | Ga0207711_10446267 | 3300025941 | Bacteria | 1204 |
| 155 | Ga0207651_10982302 | 3300025960 | Bacteria | 754 |
| 156 | Ga0207651_11411780 | 3300025960 | Unclassified | 627 |
| 157 | Ga0207658_10180925 | 3300025986 | Bacteria | 1745 |
| 158 | Ga0207677_12241543 | 3300026023 | Bacteria | 508 |
| 159 | Ga0207703_10304394 | 3300026035 | Bacteria | 1455 |
| 160 | Ga0207678_10017033 | 3300026067 | Bacteria | 6381 |
| 161 | Ga0207708_10425045 | 3300026075 | Bacteria | 1102 |
| 162 | Ga0207708_10467888 | 3300026075 | Bacteria | 1052 |
| 163 | Ga0207641_10182504 | 3300026088 | Bacteria | 1923 |
| 164 | Ga0207675_100513441 | 3300026118 | Bacteria | 1194 |
| 165 | Ga0207683_10057789 | 3300026121 | Bacteria | 3405 |
| 166 | Ga0207683_10489607 | 3300026121 | Bacteria | 1135 |
| 167 | Ga0207428_10179995 | 3300027907 | Bacteria | 1598 |
| 168 | Ga0268266_10000003 | 3300028379 | Bacteria | 1701703 |
| 169 | Ga0268266_10290464 | 3300028379 | Bacteria | 1523 |
| 170 | Ga0268266_11041090 | 3300028379 | Bacteria | 792 |
| 171 | Ga0268265_11085253 | 3300028380 | Bacteria | 794 |
| 172 | Ga0268265_11365736 | 3300028380 | Unclassified | 710 |
| 173 | Ga0265325_10007227 | 3300031241 | Bacteria | 6677 |
| 174 | Ga0265325_10238480 | 3300031241 | Bacteria | 827 |
| 175 | Ga0265331_10326680 | 3300031250 | Bacteria | 687 |
| 176 | Ga0307509_10020609 | 3300031507 | Bacteria | 7477 |
| 177 | Ga0307509_10468540 | 3300031507 | Bacteria | 950 |
| 178 | Ga0307416_100960561 | 3300032002 | Bacteria | 957 |
| 179 | Ga0373950_0138436 | 3300034818 | Unclassified | 550 |
| 180 | Ga0373958_0009154 | 3300034819 | Bacteria | 1624 |
| 181 | Ga0373938_0053811 | 3300034957 | Bacteria | 925 |
| 182 | Ga0373929_0001716 | 3300035085 | Bacteria | 4119 |
| 183 | Ga0373934_0039890 | 3300035086 | Bacteria | 1851 |
| 184 | Ga0373940_0032211 | 3300035088 | Bacteria | 1404 |
| 185 | Ga0373944_0125292 | 3300035089 | Bacteria | 889 |
| 186 | Ga0373951_0104333 | 3300035091 | Unclassified | 757 |
| 187 | Ga0373951_0109965 | 3300035091 | Unclassified | 741 |
| 188 | Ga0373923_0211088 | 3300035111 | Bacteria | 900 |
| 189 | Ga0373941_0491737 | 3300035115 | Unclassified | 520 |
| 190 | Ga0373953_0045821 | 3300035117 | Bacteria | 1754 |
| 191 | Ga0373954_0160005 | 3300035118 | Bacteria | 1101 |
| 192 | Ga0373956_0001709 | 3300035119 | Bacteria | 9055 |
| 193 | Ga0373960_0029630 | 3300035121 | Bacteria | 1519 |
| 194 | Ga0373943_0026041 | 3300035170 | Bacteria | 2738 |
| 195 | Ga0373943_0624267 | 3300035170 | Bacteria | 636 |
| 196 | Ga0373946_0150984 | 3300035171 | Bacteria | 1084 |
| 197 | Ga0373955_0047021 | 3300035172 | Bacteria | 2335 |
| 198 | Ga0373942_0008860 | 3300035207 | Bacteria | 2350 |
| 199 | Ga0373961_0031127 | 3300035241 | Bacteria | 1488 |
| 200 | Ga0373962_0202186 | 3300035242 | Unclassified | 673 |
| 201 | Ga0373931_0003638 | 3300035691 | Bacteria | 6962 |
| 202 | Ga0373931_0009778 | 3300035691 | Bacteria | 4592 |
| 203 | Ga0373931_0067587 | 3300035691 | Bacteria | 1943 |
| 204 | Ga0373931_0445544 | 3300035691 | Bacteria | 827 |
| 205 | Ga0373935_0174954 | 3300035692 | Bacteria | 1470 |
| 206 | Ga0373927_0270578 | 3300035695 | Bacteria | 1117 |
| 207 | Ga0373927_0608462 | 3300035695 | Bacteria | 722 |
| 208 | Ga0373933_0337171 | 3300035724 | Unclassified | 978 |
| 209 | Ga0373933_0671302 | 3300035724 | Bacteria | 681 |
| 210 | Ga0373947_0018023 | 3300035725 | Bacteria | 4063 |
| 211 | Ga0373947_0053316 | 3300035725 | Bacteria | 2438 |
| 212 | Ga0373947_0224498 | 3300035725 | Bacteria | 1236 |
| 213 | Ga0373937_0374761 | 3300036401 | Bacteria | 1349 |
| 214 | Ga0373925_0072489 | 3300037068 | Bacteria | 2606 |
| 215 | Ga0373925_0098481 | 3300037068 | Bacteria | 2244 |
| 216 | Ga0373925_0830001 | 3300037068 | Unclassified | 762 |
| 217 | Ga0436365_0211847 | 3300039437 | Bacteria | 772 |
| 218 | Ga0495592_0008274 | 3300046454 | Bacteria | 7808 |
| 219 | Ga0495592_0268512 | 3300046454 | Bacteria | 1120 |
| 220 | Ga0495603_0170817 | 3300046455 | Bacteria | 1259 |
| 221 | Ga0495629_0414726 | 3300046459 | Bacteria | 914 |
| 222 | Ga0495638_0397934 | 3300046460 | Bacteria | 715 |
| 223 | Ga0495651_0007988 | 3300046462 | Bacteria | 8113 |
| 224 | Ga0495653_0302605 | 3300046463 | Bacteria | 1042 |
| 225 | Ga0495664_0031346 | 3300046477 | Bacteria | 3116 |
| 226 | Ga0495664_0129665 | 3300046477 | Bacteria | 1526 |
| 227 | Ga0495594_0116188 | 3300046499 | Bacteria | 1511 |
| 228 | Ga0495606_0000194 | 3300046507 | Bacteria | 106498 |
| 229 | Ga0495608_0009002 | 3300046511 | Bacteria | 6981 |
| 230 | Ga0495618_0156829 | 3300046514 | Bacteria | 1452 |
| 231 | Ga0495620_0000016 | 3300046515 | Bacteria | 153638 |
| 232 | Ga0495628_0081667 | 3300046516 | Bacteria | 2510 |
| 233 | Ga0495628_0370127 | 3300046516 | Bacteria | 1051 |
| 234 | Ga0495630_0043991 | 3300046517 | Bacteria | 3337 |
| 235 | Ga0495631_0486863 | 3300046518 | Bacteria | 525 |
| 236 | Ga0495652_0086128 | 3300046529 | Bacteria | 2580 |
| 237 | Ga0495652_0927833 | 3300046529 | Bacteria | 573 |
| 238 | Ga0495640_0098782 | 3300046533 | Bacteria | 1918 |
| 239 | Ga0495586_0007328 | 3300046535 | Bacteria | 5888 |
| 240 | Ga0495587_0000789 | 3300046536 | Bacteria | 21156 |
| 241 | Ga0495645_0021815 | 3300046543 | Bacteria | 4629 |
| 242 | Ga0495645_0184457 | 3300046543 | Bacteria | 1427 |
| 243 | Ga0495667_0004879 | 3300046559 | Bacteria | 9068 |
| 244 | Ga0495634_0437966 | 3300046642 | Unclassified | 772 |
| 245 | Ga0495635_0015470 | 3300046663 | Bacteria | 5334 |
| 246 | Ga0495657_0004003 | 3300046675 | Bacteria | 11826 |
| 247 | Ga0495599_0003713 | 3300046678 | Bacteria | 8948 |
| 248 | Ga0495623_0022240 | 3300046679 | Bacteria | 4095 |
| 249 | Ga0495646_0015592 | 3300046680 | Bacteria | 4821 |
| 250 | Ga0495647_0186262 | 3300046681 | Bacteria | 905 |
| 251 | Ga0495613_0381205 | 3300046689 | Bacteria | 964 |
| 252 | Ga0495624_0299465 | 3300046690 | Bacteria | 970 |
| 253 | Ga0495589_0183997 | 3300046794 | Bacteria | 990 |
| 254 | Ga0495600_0087597 | 3300046809 | Bacteria | 2031 |
| 255 | Ga0495604_0010602 | 3300047317 | Bacteria | 7308 |
| 256 | Ga0495604_0459849 | 3300047317 | Bacteria | 830 |
| 257 | Ga0495674_0050112 | 3300047319 | Bacteria | 3685 |
| 258 | Ga0495674_0338990 | 3300047319 | Bacteria | 1222 |
| 259 | Ga0495680_0108951 | 3300047322 | Bacteria | 2055 |
| 260 | Ga0495680_0227718 | 3300047322 | Bacteria | 1328 |
| 261 | Ga0495675_0053782 | 3300047444 | Bacteria | 2555 |
| 262 | Ga0495593_0040321 | 3300047673 | Bacteria | 2514 |
| 263 | Ga0495593_0140729 | 3300047673 | Unclassified | 1222 |
| 264 | Ga0495602_0051885 | 3300048088 | Bacteria | 3648 |
| 265 | Ga0495602_0575511 | 3300048088 | Bacteria | 777 |
| 266 | Ga0496100_0001666 | 3300048903 | Bacteria | 11022 |
| 267 | Ga0496100_0015882 | 3300048903 | Bacteria | 4408 |
| 268 | Ga0496100_0395275 | 3300048903 | Bacteria | 1052 |
| 269 | Ga0496101_0001037 | 3300048904 | Bacteria | 16401 |
| 270 | Ga0496102_0008876 | 3300048905 | Bacteria | 8628 |
| 271 | Ga0496102_0203145 | 3300048905 | Unclassified | 1868 |
| 272 | Ga0496102_0431299 | 3300048905 | Bacteria | 1238 |
| 273 | Ga0496102_0855612 | 3300048905 | Bacteria | 831 |
| 274 | Ga0496104_0018257 | 3300048907 | Bacteria | 6399 |
| 275 | Ga0496104_0566662 | 3300048907 | Unclassified | 1046 |
| 276 | Ga0496104_0660688 | 3300048907 | Bacteria | 954 |
| 277 | Ga0496104_1307823 | 3300048907 | Unclassified | 628 |
| 278 | Ga0496105_0004561 | 3300048908 | Bacteria | 10432 |
| 279 | Ga0496105_0301487 | 3300048908 | Unclassified | 1288 |
| 280 | Ga0496106_0016464 | 3300048909 | Bacteria | 5470 |
| 281 | Ga0496106_0051586 | 3300048909 | Bacteria | 3102 |
| 282 | Ga0496106_0778726 | 3300048909 | Unclassified | 759 |
| 283 | Ga0496107_0035841 | 3300048910 | Bacteria | 3558 |
| 284 | Ga0496107_0111107 | 3300048910 | Bacteria | 2014 |
| 285 | Ga0496107_0216104 | 3300048910 | Bacteria | 1426 |
| 286 | Ga0496108_0017308 | 3300048911 | Bacteria | 5895 |
| 287 | Ga0496108_0104912 | 3300048911 | Bacteria | 2413 |
| 288 | Ga0496109_0418156 | 3300048912 | Bacteria | 1266 |
| 289 | Ga0496110_0016195 | 3300048913 | Bacteria | 6218 |
| 290 | Ga0496111_0054501 | 3300048914 | Bacteria | 2891 |
| 291 | Ga0496112_0127134 | 3300048915 | Bacteria | 2519 |
| 292 | Ga0496112_0659719 | 3300048915 | Bacteria | 975 |
| 293 | Ga0496113_0138598 | 3300048916 | Bacteria | 1913 |
| 294 | Ga0496113_0750652 | 3300048916 | Unclassified | 777 |
| 295 | Ga0496114_0004415 | 3300048917 | Bacteria | 10917 |
| 296 | Ga0496114_0028188 | 3300048917 | Bacteria | 4606 |
| 297 | Ga0496114_0792254 | 3300048917 | Unclassified | 826 |
| 298 | Ga0496114_1098740 | 3300048917 | Unclassified | 680 |
| 299 | Ga0496114_1135755 | 3300048917 | Bacteria | 667 |
| 300 | Ga0496115_0012480 | 3300048918 | Bacteria | 6396 |
| 301 | Ga0496115_0053387 | 3300048918 | Bacteria | 3243 |
| 302 | Ga0496115_0077194 | 3300048918 | Bacteria | 2708 |
| 303 | Ga0496115_0159783 | 3300048918 | Bacteria | 1862 |
| 304 | Ga0496115_0419842 | 3300048918 | Bacteria | 1084 |
| 305 | Ga0496115_0460834 | 3300048918 | Bacteria | 1025 |
| 306 | Ga0496119_0038357 | 3300048922 | Bacteria | 3097 |
| 307 | Ga0496120_0052590 | 3300048923 | Bacteria | 2319 |
| 308 | Ga0496121_0001427 | 3300048924 | Bacteria | 40370 |
| 309 | Ga0496121_0011460 | 3300048924 | Bacteria | 9843 |
| 310 | Ga0496125_0067152 | 3300048928 | Bacteria | 2828 |
| 311 | Ga0496126_0029098 | 3300048929 | Bacteria | 5251 |
| 312 | Ga0496126_0401537 | 3300048929 | Bacteria | 1111 |
| 313 | Ga0501071_1611960 | 3300049587 | Bacteria | 501 |
| 314 | Ga0501079_0614055 | 3300049741 | Bacteria | 856 |
| 315 | Ga0501083_0127817 | 3300049744 | Bacteria | 1666 |
| 316 | nmdc:mga03683_563118_c1 | 3300050489 | Bacteria | 555 |
| 317 | nmdc:mga03n38_698587_c1 | 3300050490 | Unclassified | 584 |
| 318 | nmdc:mga00v17_123656_c1 | 3300050491 | Bacteria | 1649 |
| 319 | nmdc:mga06z11_438596_c1 | 3300050494 | Bacteria | 788 |
| 320 | nmdc:mga08y16_246020_c1 | 3300050511 | Bacteria | 1848 |
| 321 | nmdc:mga0n895_100378_c1 | 3300050512 | Bacteria | 2903 |
| 322 | nmdc:mga0a205_137759_c1 | 3300050515 | Bacteria | 2341 |
| 323 | Ga0495601_0092067 | 3300053077 | Bacteria | 1952 |
| 324 | Ga0495601_0142376 | 3300053077 | Bacteria | 1564 |
| 325 | Ga0495612_0013082 | 3300053078 | Bacteria | 3342 |
| 326 | Ga0495595_0026689 | 3300053084 | Bacteria | 2567 |
| 327 | Ga0495595_0032060 | 3300053084 | Bacteria | 2365 |
| 328 | Ga0495619_0015112 | 3300053085 | Bacteria | 4879 |
| 329 | Ga0495619_0170007 | 3300053085 | Bacteria | 1507 |
| 330 | Ga0500652_000546 | 3300053131 | Bacteria | 13134 |
| 331 | Ga0500658_0053302 | 3300053134 | Bacteria | 1659 |
| 332 | Ga0500559_0508287 | 3300053136 | Bacteria | 553 |
| 333 | Ga0500588_0000070 | 3300053146 | Bacteria | 15026 |
| 334 | Ga0500616_0220378 | 3300053153 | Bacteria | 828 |
| 335 | Ga0501082_0755929 | 3300060353 | Bacteria | 851 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005333 | Ga0070677_10675820 | Ga0070677_106758202 | 105 |
| 2 | 3300005336 | Ga0070680_101567504 | Ga0070680_1015675041 | 105 |
| 3 | 3300005355 | Ga0070671_100104266 | Ga0070671_1001042666 | 105 |
| 4 | 3300005439 | Ga0070711_100580043 | Ga0070711_1005800432 | 105 |
| 5 | 3300005456 | Ga0070678_100232533 | Ga0070678_1002325332 | 105 |
| 6 | 3300005539 | Ga0068853_102097031 | Ga0068853_1020970312 | 105 |
| 7 | 3300005718 | Ga0068866_10415002 | Ga0068866_104150021 | 108 |
| 8 | 3300025898 | Ga0207692_10283808 | Ga0207692_102838082 | 108 |
| 9 | 3300025931 | Ga0207644_10990428 | Ga0207644_109904282 | 108 |
| 10 | 3300010375 | Ga0105239_10206423 | Ga0105239_102064233 | 109 |
| 11 | 3300006358 | Ga0068871_100729545 | Ga0068871_1007295452 | 110 |
| 12 | 3300025905 | Ga0207685_10210128 | Ga0207685_102101282 | 110 |
| 13 | 3300050494 | nmdc:mga06z11_438596_c1 | nmdc:mga06z11_438596_c1_435_776 | 112 |
| 14 | 3300048917 | Ga0496114_1098740 | Ga0496114_1098740_303_665 | 118 |
| 15 | 3300053146 | Ga0500588_0000070 | Ga0500588_0000070_11723_12127 | 120 |
| 16 | 3300046529 | Ga0495652_0927833 | Ga0495652_0927833_189_560 | 122 |
| 17 | 3300005331 | Ga0070670_101049204 | Ga0070670_1010492041 | 125 |
| 18 | 3300005548 | Ga0070665_102415871 | Ga0070665_1024158711 | 125 |
| 19 | 3300049587 | Ga0501071_1611960 | Ga0501071_1611960_12_395 | 126 |
| 20 | 3300048922 | Ga0496119_0038357 | Ga0496119_0038357_974_1366 | 129 |
| 21 | 3300048923 | Ga0496120_0052590 | Ga0496120_0052590_1064_1456 | 129 |
| 22 | 3300048924 | Ga0496121_0011460 | Ga0496121_0011460_8868_9260 | 129 |
| 23 | 3300048928 | Ga0496125_0067152 | Ga0496125_0067152_503_895 | 129 |
| 24 | 3300053153 | Ga0500616_0220378 | Ga0500616_0220378_416_811 | 130 |
| 25 | 3300005328 | Ga0070676_11075099 | Ga0070676_110750992 | 131 |
| 26 | 3300005330 | Ga0070690_100706065 | Ga0070690_1007060652 | 131 |
| 27 | 3300005335 | Ga0070666_10707459 | Ga0070666_107074592 | 131 |
| 28 | 3300005336 | Ga0070680_100163741 | Ga0070680_1001637411 | 131 |
| 29 | 3300005337 | Ga0070682_100217738 | Ga0070682_1002177381 | 131 |
| 30 | 3300005337 | Ga0070682_100253163 | Ga0070682_1002531632 | 131 |
| 31 | 3300005337 | Ga0070682_101000624 | Ga0070682_1010006241 | 131 |
| 32 | 3300005339 | Ga0070660_100628306 | Ga0070660_1006283062 | 131 |
| 33 | 3300005341 | Ga0070691_10236617 | Ga0070691_102366171 | 131 |
| 34 | 3300005355 | Ga0070671_100095816 | Ga0070671_1000958161 | 131 |
| 35 | 3300005356 | Ga0070674_100210494 | Ga0070674_1002104942 | 131 |
| 36 | 3300005437 | Ga0070710_10109446 | Ga0070710_101094463 | 131 |
| 37 | 3300005440 | Ga0070705_100736665 | Ga0070705_1007366652 | 131 |
| 38 | 3300005441 | Ga0070700_100249980 | Ga0070700_1002499802 | 131 |
| 39 | 3300005441 | Ga0070700_100274770 | Ga0070700_1002747702 | 131 |
| 40 | 3300005455 | Ga0070663_101623692 | Ga0070663_1016236921 | 131 |
| 41 | 3300005456 | Ga0070678_100359196 | Ga0070678_1003591962 | 131 |
| 42 | 3300005457 | Ga0070662_100230124 | Ga0070662_1002301241 | 131 |
| 43 | 3300005458 | Ga0070681_10883438 | Ga0070681_108834381 | 131 |
| 44 | 3300005459 | Ga0068867_100244031 | Ga0068867_1002440312 | 131 |
| 45 | 3300005543 | Ga0070672_101278252 | Ga0070672_1012782522 | 131 |
| 46 | 3300005545 | Ga0070695_100504852 | Ga0070695_1005048521 | 131 |
| 47 | 3300005545 | Ga0070695_100775502 | Ga0070695_1007755021 | 131 |
| 48 | 3300005547 | Ga0070693_100012005 | Ga0070693_1000120053 | 131 |
| 49 | 3300005547 | Ga0070693_100449225 | Ga0070693_1004492251 | 131 |
| 50 | 3300005548 | Ga0070665_102456461 | Ga0070665_1024564611 | 131 |
| 51 | 3300005564 | Ga0070664_100197764 | Ga0070664_1001977642 | 131 |
| 52 | 3300005618 | Ga0068864_100721469 | Ga0068864_1007214692 | 131 |
| 53 | 3300005841 | Ga0068863_100056085 | Ga0068863_1000560855 | 131 |
| 54 | 3300005844 | Ga0068862_100894801 | Ga0068862_1008948012 | 131 |
| 55 | 3300006038 | Ga0075365_10645772 | Ga0075365_106457722 | 131 |
| 56 | 3300006051 | Ga0075364_10297373 | Ga0075364_102973732 | 131 |
| 57 | 3300006178 | Ga0075367_10720052 | Ga0075367_107200522 | 131 |
| 58 | 3300006237 | Ga0097621_100191313 | Ga0097621_1001913133 | 131 |
| 59 | 3300006237 | Ga0097621_101239641 | Ga0097621_1012396412 | 131 |
| 60 | 3300006237 | Ga0097621_101435892 | Ga0097621_1014358922 | 131 |
| 61 | 3300006237 | Ga0097621_102138584 | Ga0097621_1021385841 | 131 |
| 62 | 3300006358 | Ga0068871_100019344 | Ga0068871_1000193446 | 131 |
| 63 | 3300006358 | Ga0068871_100117668 | Ga0068871_1001176682 | 131 |
| 64 | 3300006358 | Ga0068871_100318579 | Ga0068871_1003185792 | 131 |
| 65 | 3300006358 | Ga0068871_101153230 | Ga0068871_1011532301 | 131 |
| 66 | 3300006844 | Ga0075428_100622405 | Ga0075428_1006224051 | 131 |
| 67 | 3300006847 | Ga0075431_100209398 | Ga0075431_1002093983 | 131 |
| 68 | 3300006852 | Ga0075433_10017141 | Ga0075433_100171412 | 131 |
| 69 | 3300006871 | Ga0075434_100024715 | Ga0075434_1000247156 | 131 |
| 70 | 3300006871 | Ga0075434_100212226 | Ga0075434_1002122262 | 131 |
| 71 | 3300006881 | Ga0068865_100238045 | Ga0068865_1002380453 | 131 |
| 72 | 3300006881 | Ga0068865_100479819 | Ga0068865_1004798191 | 131 |
| 73 | 3300006914 | Ga0075436_100878475 | Ga0075436_1008784751 | 131 |
| 74 | 3300009093 | Ga0105240_12567477 | Ga0105240_125674771 | 131 |
| 75 | 3300009094 | Ga0111539_10086028 | Ga0111539_100860282 | 131 |
| 76 | 3300009098 | Ga0105245_10034576 | Ga0105245_100345766 | 131 |
| 77 | 3300009098 | Ga0105245_10110740 | Ga0105245_101107403 | 131 |
| 78 | 3300009101 | Ga0105247_11223535 | Ga0105247_112235351 | 131 |
| 79 | 3300009148 | Ga0105243_10244928 | Ga0105243_102449282 | 131 |
| 80 | 3300009148 | Ga0105243_11649630 | Ga0105243_116496302 | 131 |
| 81 | 3300009174 | Ga0105241_10132492 | Ga0105241_101324921 | 131 |
| 82 | 3300009176 | Ga0105242_10083958 | Ga0105242_100839583 | 131 |
| 83 | 3300009176 | Ga0105242_10545496 | Ga0105242_105454962 | 131 |
| 84 | 3300009177 | Ga0105248_10017412 | Ga0105248_100174123 | 131 |
| 85 | 3300009177 | Ga0105248_10039894 | Ga0105248_100398942 | 131 |
| 86 | 3300009177 | Ga0105248_10653408 | Ga0105248_106534081 | 131 |
| 87 | 3300009177 | Ga0105248_12231352 | Ga0105248_122313521 | 131 |
| 88 | 3300009545 | Ga0105237_10749337 | Ga0105237_107493371 | 131 |
| 89 | 3300009551 | Ga0105238_10520081 | Ga0105238_105200812 | 131 |
| 90 | 3300010375 | Ga0105239_10481381 | Ga0105239_104813811 | 131 |
| 91 | 3300010375 | Ga0105239_11243928 | Ga0105239_112439282 | 131 |
| 92 | 3300011119 | Ga0105246_10427733 | Ga0105246_104277331 | 131 |
| 93 | 3300013296 | Ga0157374_11934180 | Ga0157374_119341802 | 131 |
| 94 | 3300013297 | Ga0157378_10186479 | Ga0157378_101864792 | 131 |
| 95 | 3300013297 | Ga0157378_10835310 | Ga0157378_108353102 | 131 |
| 96 | 3300013306 | Ga0163162_10054199 | Ga0163162_100541994 | 131 |
| 97 | 3300013306 | Ga0163162_10483511 | Ga0163162_104835112 | 131 |
| 98 | 3300014745 | Ga0157377_10645693 | Ga0157377_106456932 | 131 |
| 99 | 3300014969 | Ga0157376_10139715 | Ga0157376_101397154 | 131 |
| 100 | 3300014969 | Ga0157376_10260507 | Ga0157376_102605072 | 131 |
| 101 | 3300014969 | Ga0157376_10359069 | Ga0157376_103590692 | 131 |
| 102 | 3300017792 | Ga0163161_10034854 | Ga0163161_100348542 | 131 |
| 103 | 3300025304 | Ga0209257_1011367 | Ga0209257_10113672 | 131 |
| 104 | 3300025898 | Ga0207692_10210710 | Ga0207692_102107102 | 131 |
| 105 | 3300025903 | Ga0207680_10900082 | Ga0207680_109000821 | 131 |
| 106 | 3300025911 | Ga0207654_10467527 | Ga0207654_104675272 | 131 |
| 107 | 3300025912 | Ga0207707_10180230 | Ga0207707_101802303 | 131 |
| 108 | 3300025912 | Ga0207707_10218064 | Ga0207707_102180642 | 131 |
| 109 | 3300025919 | Ga0207657_10441459 | Ga0207657_104414592 | 131 |
| 110 | 3300025921 | Ga0207652_10277703 | Ga0207652_102777032 | 131 |
| 111 | 3300025927 | Ga0207687_10027802 | Ga0207687_100278027 | 131 |
| 112 | 3300025927 | Ga0207687_11056927 | Ga0207687_110569272 | 131 |
| 113 | 3300025928 | Ga0207700_11209557 | Ga0207700_112095572 | 131 |
| 114 | 3300025931 | Ga0207644_11248859 | Ga0207644_112488591 | 131 |
| 115 | 3300025933 | Ga0207706_10080149 | Ga0207706_100801493 | 131 |
| 116 | 3300025934 | Ga0207686_10097083 | Ga0207686_100970831 | 131 |
| 117 | 3300025934 | Ga0207686_10892387 | Ga0207686_108923872 | 131 |
| 118 | 3300025935 | Ga0207709_11131032 | Ga0207709_111310322 | 131 |
| 119 | 3300025937 | Ga0207669_10187554 | Ga0207669_101875542 | 131 |
| 120 | 3300025938 | Ga0207704_10534632 | Ga0207704_105346321 | 131 |
| 121 | 3300025938 | Ga0207704_11147033 | Ga0207704_111470331 | 131 |
| 122 | 3300025939 | Ga0207665_10382394 | Ga0207665_103823942 | 131 |
| 123 | 3300025940 | Ga0207691_10799722 | Ga0207691_107997222 | 131 |
| 124 | 3300025941 | Ga0207711_10013223 | Ga0207711_100132234 | 131 |
| 125 | 3300025941 | Ga0207711_10446267 | Ga0207711_104462672 | 131 |
| 126 | 3300025960 | Ga0207651_10982302 | Ga0207651_109823021 | 131 |
| 127 | 3300025960 | Ga0207651_11411780 | Ga0207651_114117801 | 131 |
| 128 | 3300025986 | Ga0207658_10180925 | Ga0207658_101809252 | 131 |
| 129 | 3300026023 | Ga0207677_12241543 | Ga0207677_122415431 | 131 |
| 130 | 3300026035 | Ga0207703_10304394 | Ga0207703_103043943 | 131 |
| 131 | 3300026067 | Ga0207678_10017033 | Ga0207678_100170333 | 131 |
| 132 | 3300026075 | Ga0207708_10425045 | Ga0207708_104250451 | 131 |
| 133 | 3300026075 | Ga0207708_10467888 | Ga0207708_104678882 | 131 |
| 134 | 3300026088 | Ga0207641_10182504 | Ga0207641_101825042 | 131 |
| 135 | 3300026118 | Ga0207675_100513441 | Ga0207675_1005134412 | 131 |
| 136 | 3300026121 | Ga0207683_10057789 | Ga0207683_100577894 | 131 |
| 137 | 3300026121 | Ga0207683_10489607 | Ga0207683_104896072 | 131 |
| 138 | 3300027907 | Ga0207428_10179995 | Ga0207428_101799952 | 131 |
| 139 | 3300028379 | Ga0268266_10290464 | Ga0268266_102904642 | 131 |
| 140 | 3300028379 | Ga0268266_11041090 | Ga0268266_110410901 | 131 |
| 141 | 3300028380 | Ga0268265_11085253 | Ga0268265_110852532 | 131 |
| 142 | 3300028380 | Ga0268265_11365736 | Ga0268265_113657362 | 131 |
| 143 | 3300031241 | Ga0265325_10007227 | Ga0265325_100072274 | 131 |
| 144 | 3300031241 | Ga0265325_10238480 | Ga0265325_102384802 | 131 |
| 145 | 3300031250 | Ga0265331_10326680 | Ga0265331_103266802 | 131 |
| 146 | 3300031507 | Ga0307509_10020609 | Ga0307509_100206093 | 131 |
| 147 | 3300031507 | Ga0307509_10468540 | Ga0307509_104685402 | 131 |
| 148 | 3300032002 | Ga0307416_100960561 | Ga0307416_1009605611 | 131 |
| 149 | 3300034818 | Ga0373950_0138436 | Ga0373950_0138436_67_468 | 131 |
| 150 | 3300034819 | Ga0373958_0009154 | Ga0373958_0009154_1163_1558 | 131 |
| 151 | 3300034957 | Ga0373938_0053811 | Ga0373938_0053811_440_835 | 131 |
| 152 | 3300035085 | Ga0373929_0001716 | Ga0373929_0001716_2523_2918 | 131 |
| 153 | 3300035086 | Ga0373934_0039890 | Ga0373934_0039890_250_651 | 131 |
| 154 | 3300035088 | Ga0373940_0032211 | Ga0373940_0032211_855_1250 | 131 |
| 155 | 3300035089 | Ga0373944_0125292 | Ga0373944_0125292_239_637 | 131 |
| 156 | 3300035091 | Ga0373951_0104333 | Ga0373951_0104333_83_484 | 131 |
| 157 | 3300035091 | Ga0373951_0109965 | Ga0373951_0109965_246_647 | 131 |
| 158 | 3300035111 | Ga0373923_0211088 | Ga0373923_0211088_418_819 | 131 |
| 159 | 3300035115 | Ga0373941_0491737 | Ga0373941_0491737_97_498 | 131 |
| 160 | 3300035117 | Ga0373953_0045821 | Ga0373953_0045821_374_775 | 131 |
| 161 | 3300035118 | Ga0373954_0160005 | Ga0373954_0160005_168_569 | 131 |
| 162 | 3300035119 | Ga0373956_0001709 | Ga0373956_0001709_1135_1536 | 131 |
| 163 | 3300035121 | Ga0373960_0029630 | Ga0373960_0029630_985_1380 | 131 |
| 164 | 3300035170 | Ga0373943_0026041 | Ga0373943_0026041_2045_2443 | 131 |
| 165 | 3300035170 | Ga0373943_0624267 | Ga0373943_0624267_165_563 | 131 |
| 166 | 3300035171 | Ga0373946_0150984 | Ga0373946_0150984_67_465 | 131 |
| 167 | 3300035172 | Ga0373955_0047021 | Ga0373955_0047021_805_1206 | 131 |
| 168 | 3300035207 | Ga0373942_0008860 | Ga0373942_0008860_1292_1687 | 131 |
| 169 | 3300035241 | Ga0373961_0031127 | Ga0373961_0031127_288_686 | 131 |
| 170 | 3300035242 | Ga0373962_0202186 | Ga0373962_0202186_227_628 | 131 |
| 171 | 3300035691 | Ga0373931_0003638 | Ga0373931_0003638_6164_6559 | 131 |
| 172 | 3300035691 | Ga0373931_0009778 | Ga0373931_0009778_14_415 | 131 |
| 173 | 3300035691 | Ga0373931_0067587 | Ga0373931_0067587_1074_1475 | 131 |
| 174 | 3300035691 | Ga0373931_0445544 | Ga0373931_0445544_284_682 | 131 |
| 175 | 3300035692 | Ga0373935_0174954 | Ga0373935_0174954_35_433 | 131 |
| 176 | 3300035695 | Ga0373927_0270578 | Ga0373927_0270578_608_1006 | 131 |
| 177 | 3300035695 | Ga0373927_0608462 | Ga0373927_0608462_289_690 | 131 |
| 178 | 3300035724 | Ga0373933_0337171 | Ga0373933_0337171_253_654 | 131 |
| 179 | 3300035724 | Ga0373933_0671302 | Ga0373933_0671302_114_512 | 131 |
| 180 | 3300035725 | Ga0373947_0018023 | Ga0373947_0018023_2951_3349 | 131 |
| 181 | 3300035725 | Ga0373947_0053316 | Ga0373947_0053316_1041_1442 | 131 |
| 182 | 3300035725 | Ga0373947_0224498 | Ga0373947_0224498_201_599 | 131 |
| 183 | 3300036401 | Ga0373937_0374761 | Ga0373937_0374761_432_833 | 131 |
| 184 | 3300037068 | Ga0373925_0072489 | Ga0373925_0072489_931_1329 | 131 |
| 185 | 3300037068 | Ga0373925_0098481 | Ga0373925_0098481_1807_2205 | 131 |
| 186 | 3300037068 | Ga0373925_0830001 | Ga0373925_0830001_250_651 | 131 |
| 187 | 3300039437 | Ga0436365_0211847 | Ga0436365_0211847_115_513 | 131 |
| 188 | 3300046454 | Ga0495592_0008274 | Ga0495592_0008274_4912_5313 | 131 |
| 189 | 3300046454 | Ga0495592_0268512 | Ga0495592_0268512_544_942 | 131 |
| 190 | 3300046455 | Ga0495603_0170817 | Ga0495603_0170817_733_1134 | 131 |
| 191 | 3300046459 | Ga0495629_0414726 | Ga0495629_0414726_293_694 | 131 |
| 192 | 3300046462 | Ga0495651_0007988 | Ga0495651_0007988_647_1048 | 131 |
| 193 | 3300046463 | Ga0495653_0302605 | Ga0495653_0302605_498_899 | 131 |
| 194 | 3300046477 | Ga0495664_0031346 | Ga0495664_0031346_214_615 | 131 |
| 195 | 3300046477 | Ga0495664_0129665 | Ga0495664_0129665_988_1389 | 131 |
| 196 | 3300046499 | Ga0495594_0116188 | Ga0495594_0116188_610_1011 | 131 |
| 197 | 3300046511 | Ga0495608_0009002 | Ga0495608_0009002_2558_2959 | 131 |
| 198 | 3300046514 | Ga0495618_0156829 | Ga0495618_0156829_275_676 | 131 |
| 199 | 3300046516 | Ga0495628_0081667 | Ga0495628_0081667_22_423 | 131 |
| 200 | 3300046516 | Ga0495628_0370127 | Ga0495628_0370127_248_646 | 131 |
| 201 | 3300046517 | Ga0495630_0043991 | Ga0495630_0043991_2875_3276 | 131 |
| 202 | 3300046529 | Ga0495652_0086128 | Ga0495652_0086128_1312_1713 | 131 |
| 203 | 3300046533 | Ga0495640_0098782 | Ga0495640_0098782_765_1166 | 131 |
| 204 | 3300046535 | Ga0495586_0007328 | Ga0495586_0007328_1397_1798 | 131 |
| 205 | 3300046536 | Ga0495587_0000789 | Ga0495587_0000789_18213_18614 | 131 |
| 206 | 3300046543 | Ga0495645_0021815 | Ga0495645_0021815_1834_2235 | 131 |
| 207 | 3300046543 | Ga0495645_0184457 | Ga0495645_0184457_534_932 | 131 |
| 208 | 3300046559 | Ga0495667_0004879 | Ga0495667_0004879_524_925 | 131 |
| 209 | 3300046642 | Ga0495634_0437966 | Ga0495634_0437966_305_706 | 131 |
| 210 | 3300046663 | Ga0495635_0015470 | Ga0495635_0015470_843_1244 | 131 |
| 211 | 3300046675 | Ga0495657_0004003 | Ga0495657_0004003_2552_2953 | 131 |
| 212 | 3300046678 | Ga0495599_0003713 | Ga0495599_0003713_7736_8137 | 131 |
| 213 | 3300046679 | Ga0495623_0022240 | Ga0495623_0022240_2624_3025 | 131 |
| 214 | 3300046680 | Ga0495646_0015592 | Ga0495646_0015592_2203_2604 | 131 |
| 215 | 3300046681 | Ga0495647_0186262 | Ga0495647_0186262_341_739 | 131 |
| 216 | 3300046689 | Ga0495613_0381205 | Ga0495613_0381205_77_478 | 131 |
| 217 | 3300046690 | Ga0495624_0299465 | Ga0495624_0299465_524_925 | 131 |
| 218 | 3300046794 | Ga0495589_0183997 | Ga0495589_0183997_177_575 | 131 |
| 219 | 3300046809 | Ga0495600_0087597 | Ga0495600_0087597_644_1045 | 131 |
| 220 | 3300047317 | Ga0495604_0010602 | Ga0495604_0010602_4835_5236 | 131 |
| 221 | 3300047317 | Ga0495604_0459849 | Ga0495604_0459849_77_475 | 131 |
| 222 | 3300047319 | Ga0495674_0050112 | Ga0495674_0050112_2395_2796 | 131 |
| 223 | 3300047319 | Ga0495674_0338990 | Ga0495674_0338990_697_1095 | 131 |
| 224 | 3300047322 | Ga0495680_0108951 | Ga0495680_0108951_875_1273 | 131 |
| 225 | 3300047322 | Ga0495680_0227718 | Ga0495680_0227718_890_1291 | 131 |
| 226 | 3300047444 | Ga0495675_0053782 | Ga0495675_0053782_856_1257 | 131 |
| 227 | 3300047673 | Ga0495593_0040321 | Ga0495593_0040321_1503_1904 | 131 |
| 228 | 3300048088 | Ga0495602_0051885 | Ga0495602_0051885_853_1254 | 131 |
| 229 | 3300048088 | Ga0495602_0575511 | Ga0495602_0575511_38_436 | 131 |
| 230 | 3300048903 | Ga0496100_0001666 | Ga0496100_0001666_8539_8934 | 131 |
| 231 | 3300048903 | Ga0496100_0015882 | Ga0496100_0015882_1194_1595 | 131 |
| 232 | 3300048904 | Ga0496101_0001037 | Ga0496101_0001037_10846_11241 | 131 |
| 233 | 3300048905 | Ga0496102_0008876 | Ga0496102_0008876_3386_3781 | 131 |
| 234 | 3300048905 | Ga0496102_0203145 | Ga0496102_0203145_493_894 | 131 |
| 235 | 3300048905 | Ga0496102_0431299 | Ga0496102_0431299_263_661 | 131 |
| 236 | 3300048905 | Ga0496102_0855612 | Ga0496102_0855612_53_454 | 131 |
| 237 | 3300048907 | Ga0496104_0018257 | Ga0496104_0018257_3082_3483 | 131 |
| 238 | 3300048907 | Ga0496104_0566662 | Ga0496104_0566662_263_664 | 131 |
| 239 | 3300048907 | Ga0496104_0660688 | Ga0496104_0660688_370_771 | 131 |
| 240 | 3300048907 | Ga0496104_1307823 | Ga0496104_1307823_123_521 | 131 |
| 241 | 3300048908 | Ga0496105_0004561 | Ga0496105_0004561_5797_6192 | 131 |
| 242 | 3300048908 | Ga0496105_0301487 | Ga0496105_0301487_232_633 | 131 |
| 243 | 3300048909 | Ga0496106_0016464 | Ga0496106_0016464_4744_5139 | 131 |
| 244 | 3300048909 | Ga0496106_0051586 | Ga0496106_0051586_236_637 | 131 |
| 245 | 3300048909 | Ga0496106_0778726 | Ga0496106_0778726_330_731 | 131 |
| 246 | 3300048910 | Ga0496107_0035841 | Ga0496107_0035841_80_475 | 131 |
| 247 | 3300048910 | Ga0496107_0111107 | Ga0496107_0111107_267_668 | 131 |
| 248 | 3300048910 | Ga0496107_0216104 | Ga0496107_0216104_987_1388 | 131 |
| 249 | 3300048911 | Ga0496108_0017308 | Ga0496108_0017308_4344_4739 | 131 |
| 250 | 3300048911 | Ga0496108_0104912 | Ga0496108_0104912_617_1018 | 131 |
| 251 | 3300048912 | Ga0496109_0418156 | Ga0496109_0418156_704_1099 | 131 |
| 252 | 3300048913 | Ga0496110_0016195 | Ga0496110_0016195_5639_6034 | 131 |
| 253 | 3300048914 | Ga0496111_0054501 | Ga0496111_0054501_1108_1503 | 131 |
| 254 | 3300048915 | Ga0496112_0127134 | Ga0496112_0127134_1309_1704 | 131 |
| 255 | 3300048915 | Ga0496112_0659719 | Ga0496112_0659719_250_645 | 131 |
| 256 | 3300048916 | Ga0496113_0138598 | Ga0496113_0138598_787_1182 | 131 |
| 257 | 3300048916 | Ga0496113_0750652 | Ga0496113_0750652_31_426 | 131 |
| 258 | 3300048917 | Ga0496114_0004415 | Ga0496114_0004415_4472_4867 | 131 |
| 259 | 3300048917 | Ga0496114_0028188 | Ga0496114_0028188_2150_2551 | 131 |
| 260 | 3300048917 | Ga0496114_0792254 | Ga0496114_0792254_19_420 | 131 |
| 261 | 3300048917 | Ga0496114_1135755 | Ga0496114_1135755_170_571 | 131 |
| 262 | 3300048918 | Ga0496115_0012480 | Ga0496115_0012480_1577_1978 | 131 |
| 263 | 3300048918 | Ga0496115_0053387 | Ga0496115_0053387_2598_2993 | 131 |
| 264 | 3300048918 | Ga0496115_0077194 | Ga0496115_0077194_2114_2515 | 131 |
| 265 | 3300048918 | Ga0496115_0419842 | Ga0496115_0419842_595_996 | 131 |
| 266 | 3300048918 | Ga0496115_0460834 | Ga0496115_0460834_51_452 | 131 |
| 267 | 3300049741 | Ga0501079_0614055 | Ga0501079_0614055_443_841 | 131 |
| 268 | 3300049744 | Ga0501083_0127817 | Ga0501083_0127817_1016_1414 | 131 |
| 269 | 3300050489 | nmdc:mga03683_563118_c1 | nmdc:mga03683_563118_c1_38_436 | 131 |
| 270 | 3300050490 | nmdc:mga03n38_698587_c1 | nmdc:mga03n38_698587_c1_17_418 | 131 |
| 271 | 3300050491 | nmdc:mga00v17_123656_c1 | nmdc:mga00v17_123656_c1_345_743 | 131 |
| 272 | 3300050511 | nmdc:mga08y16_246020_c1 | nmdc:mga08y16_246020_c1_503_904 | 131 |
| 273 | 3300050512 | nmdc:mga0n895_100378_c1 | nmdc:mga0n895_100378_c1_187_588 | 131 |
| 274 | 3300050515 | nmdc:mga0a205_137759_c1 | nmdc:mga0a205_137759_c1_92_493 | 131 |
| 275 | 3300053077 | Ga0495601_0092067 | Ga0495601_0092067_268_669 | 131 |
| 276 | 3300053077 | Ga0495601_0142376 | Ga0495601_0142376_876_1274 | 131 |
| 277 | 3300053078 | Ga0495612_0013082 | Ga0495612_0013082_374_775 | 131 |
| 278 | 3300053084 | Ga0495595_0026689 | Ga0495595_0026689_323_724 | 131 |
| 279 | 3300053084 | Ga0495595_0032060 | Ga0495595_0032060_600_998 | 131 |
| 280 | 3300053085 | Ga0495619_0015112 | Ga0495619_0015112_758_1159 | 131 |
| 281 | 3300053085 | Ga0495619_0170007 | Ga0495619_0170007_592_990 | 131 |
| 282 | 3300053131 | Ga0500652_000546 | Ga0500652_000546_11698_12096 | 131 |
| 283 | 3300053136 | Ga0500559_0508287 | Ga0500559_0508287_73_474 | 131 |
| 284 | 3300060353 | Ga0501082_0755929 | Ga0501082_0755929_261_659 | 131 |
| 285 | 3300005344 | Ga0070661_100595732 | Ga0070661_1005957322 | 132 |
| 286 | 3300005439 | Ga0070711_100221127 | Ga0070711_1002211272 | 132 |
| 287 | 3300013104 | Ga0157370_10220488 | Ga0157370_102204882 | 132 |
| 288 | 3300014326 | Ga0157380_10378616 | Ga0157380_103786162 | 132 |
| 289 | 3300017792 | Ga0163161_10032455 | Ga0163161_100324554 | 132 |
| 290 | 3300025916 | Ga0207663_10322942 | Ga0207663_103229422 | 132 |
| 291 | 3300046460 | Ga0495638_0397934 | Ga0495638_0397934_214_612 | 132 |
| 292 | 3300046507 | Ga0495606_0000194 | Ga0495606_0000194_46338_46736 | 132 |
| 293 | 3300046515 | Ga0495620_0000016 | Ga0495620_0000016_57432_57830 | 132 |
| 294 | 3300046518 | Ga0495631_0486863 | Ga0495631_0486863_44_442 | 132 |
| 295 | 3300048929 | Ga0496126_0401537 | Ga0496126_0401537_466_864 | 132 |
| 296 | 3300003215 | JGI25153J46596_10032940 | JGI25153J46596_100329401 | 133 |
| 297 | 3300003320 | rootH2_10088056 | rootH2_100880562 | 133 |
| 298 | 3300003322 | rootL2_10309207 | rootL2_103092072 | 133 |
| 299 | 3300003323 | rootH1_10308701 | rootH1_103087012 | 133 |
| 300 | 3300003323 | rootH1_10340903 | rootH1_103409034 | 133 |
| 301 | 3300003761 | Ga0055535_1026428 | Ga0055535_10264281 | 133 |
| 302 | 3300003763 | Ga0055529_1004789 | Ga0055529_10047892 | 133 |
| 303 | 3300003771 | Ga0055526_1018945 | Ga0055526_10189451 | 133 |
| 304 | 3300003773 | Ga0055537_1000005 | Ga0055537_100000539 | 133 |
| 305 | 3300003775 | Ga0055524_1004182 | Ga0055524_10041825 | 133 |
| 306 | 3300003775 | Ga0055524_1081161 | Ga0055524_10811611 | 133 |
| 307 | 3300003784 | Ga0055534_1000127 | Ga0055534_100012743 | 133 |
| 308 | 3300003790 | Ga0055528_1000063 | Ga0055528_100006339 | 133 |
| 309 | 3300003791 | Ga0055530_10000085 | Ga0055530_1000008559 | 133 |
| 310 | 3300003794 | Ga0055531_10001673 | Ga0055531_100016735 | 133 |
| 311 | 3300005262 | Ga0065165_1000414 | Ga0065165_100041437 | 133 |
| 312 | 3300009093 | Ga0105240_10000115 | Ga0105240_10000115112 | 133 |
| 313 | 3300009098 | Ga0105245_11451914 | Ga0105245_114519141 | 133 |
| 314 | 3300009148 | Ga0105243_10929634 | Ga0105243_109296342 | 133 |
| 315 | 3300009551 | Ga0105238_11216852 | Ga0105238_112168522 | 133 |
| 316 | 3300025242 | Ga0209258_102814 | Ga0209258_1028144 | 133 |
| 317 | 3300025263 | Ga0209565_1000074 | Ga0209565_1000074116 | 133 |
| 318 | 3300025272 | Ga0209455_1001534 | Ga0209455_10015342 | 133 |
| 319 | 3300025273 | Ga0209673_1000129 | Ga0209673_100012945 | 133 |
| 320 | 3300025291 | Ga0209675_1000072 | Ga0209675_100007245 | 133 |
| 321 | 3300025295 | Ga0209564_1000160 | Ga0209564_100016044 | 133 |
| 322 | 3300025297 | Ga0209758_1001079 | Ga0209758_100107911 | 133 |
| 323 | 3300025298 | Ga0209050_1000034 | Ga0209050_1000034170 | 133 |
| 324 | 3300025299 | Ga0209256_1000125 | Ga0209256_100012545 | 133 |
| 325 | 3300025299 | Ga0209256_1000146 | Ga0209256_100014654 | 133 |
| 326 | 3300025304 | Ga0209257_1000052 | Ga0209257_1000052240 | 133 |
| 327 | 3300025304 | Ga0209257_1000100 | Ga0209257_1000100105 | 133 |
| 328 | 3300025913 | Ga0207695_10000116 | Ga0207695_10000116120 | 133 |
| 329 | 3300028379 | Ga0268266_10000003 | Ga0268266_10000003933 | 133 |
| 330 | 3300047673 | Ga0495593_0140729 | Ga0495593_0140729_185_592 | 133 |
| 331 | 3300048903 | Ga0496100_0395275 | Ga0496100_0395275_411_818 | 133 |
| 332 | 3300048918 | Ga0496115_0159783 | Ga0496115_0159783_911_1312 | 133 |
| 333 | 3300048924 | Ga0496121_0001427 | Ga0496121_0001427_23142_23552 | 133 |
| 334 | 3300048929 | Ga0496126_0029098 | Ga0496126_0029098_4703_5110 | 133 |
| 335 | 3300053134 | Ga0500658_0053302 | Ga0500658_0053302_40_444 | 133 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4i1m-assembly2.cif.gz_B | crystal structure of the legionella pneumophila gap domain of lepb | 0.8471 | 86 | 129 |
| 4bpm-assembly1.cif.gz_A | crystal structure of a human integral membrane enzyme | 0.8 | 4 | 131 |
| 3dww-assembly1.cif.gz_C | electron crystallographic structure of human microsomal prostaglandin e synthase 1 | 0.769 | 5 | 131 |
| 4bpm-assembly1.cif.gz_A | crystal structure of a human integral membrane enzyme | 0.7676 | 4 | 131 |
| 5bqg-assembly1.cif.gz_A | crystal structure of mpges-1 bound to an inhibitor | 0.7523 | 5 | 131 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4wabA00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain | 0.8102 | 5 | 131 | 1.20.120.550 |
| 4yl1A00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain | 0.8082 | 5 | 131 | 1.20.120.550 |
| af_B0R1E9_1_152_1.20.120.550 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain | 0.7959 | 5 | 132 | 1.20.120.550 |
| 4wabA00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain | 0.772 | 5 | 131 | 1.20.120.550 |
| 4yl1A00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain | 0.77 | 5 | 131 | 1.20.120.550 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A533JAF3-F1-model_v4 | deleted | 0.9852 | 47 | 132 |
|
| AF-A0A1S8FIP3-F1-model_v4 | MAPEG family protein | 0.9815 | 3 | 132 |
GO:0016020
|
| AF-A0A7S7Z5G2-F1-model_v4 | MAPEG family protein | 0.9796 | 3 | 131 |
GO:0016020
|
| AF-A0A2M8R4K8-F1-model_v4 | MAPEG family protein | 0.9794 | 3 | 132 |
GO:0016020
|
| AF-A0A4R3U1U7-F1-model_v4 | Putative MAPEG superfamily protein | 0.9787 | 3 | 132 |
GO:0016020
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar