F411898

General Info

Members Datasets Scaffolds Average Seq Length
334 175 668 170

Family's Representative Sequence

Representative Sequence 3300041512|Ga0451853_2867917|Ga0451853_2867917_934_1473
Length 179
Sequence MTGVDAVRVGAVRVAVVVGNPKPQSRTLQAATYVATELSGQEPDLVVDLALLGARLLDWQDELVAEAVAEVGAADLVVVASPTYKGTYTGLLKLFLDRFATDGLRGVAVPLMLGAGPGHALAPELTLRPVLTEIGGVVATKGLYVVDSAHDDPSAYEHWLGLSRPTITALLGSRTAASA

Samples

Sample ID Description Type Environment
1 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
22 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
23 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
24 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
25 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
26 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
27 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
28 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
29 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
30 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
35 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
38 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
39 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
40 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
41 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
42 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
43 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
44 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
45 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
46 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
64 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
67 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
68 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
69 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
70 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
71 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
72 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
73 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
74 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
75 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
76 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
77 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
78 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
79 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
80 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
81 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
82 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
83 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
84 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
85 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
86 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
87 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
88 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
89 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
90 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
91 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
92 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
93 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
94 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
95 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
96 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
97 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
98 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
99 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
100 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
101 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
102 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
103 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
104 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
105 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
106 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
107 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
108 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
109 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
110 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
111 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
112 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
113 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
114 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
115 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
116 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
117 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
118 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
119 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
120 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
121 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
122 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
123 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
124 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
125 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
126 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
127 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
128 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
129 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
130 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
144 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
145 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
146 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
147 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
148 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
149 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
150 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
151 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
152 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
153 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
154 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
157 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
158 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
159 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
160 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
161 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
162 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
163 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
164 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
165 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
166 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
167 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
168 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
169 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
170 2643221615 Nocardioides sp. Root224 Isolate Unclassified
171 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
172 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
173 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
174 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
175 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root

Type Distribution

Type Percentage (%)
Metagenomes 97.6
Metatranscriptomes 0
Isolates 2.4

Biome Distribution

Category Percentage (%)
Aerial Root 0.3
Bulb 0
Endosphere 20.66
Nodule 0
Rhizoplane 10.78
Rhizosphere 64.07
Stem 0
Stem Tuber 0
Unclassified 0.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451853_2867917 3300041512 Bacteria 1619
2 rootL2_10022135 3300003322 Bacteria 1172
3 Ga0070658_10231628 3300005327 Bacteria 1564
4 Ga0070683_100760928 3300005329 Bacteria 928
5 Ga0070682_100181679 3300005337 Bacteria 1470
6 Ga0068868_100239106 3300005338 Bacteria 1525
7 Ga0068868_100520658 3300005338 Bacteria 1044
8 Ga0068868_101042853 3300005338 Bacteria 750
9 Ga0070661_100299630 3300005344 Bacteria 1251
10 Ga0070675_100347381 3300005354 Bacteria 1315
11 Ga0070674_100338614 3300005356 Bacteria 1211
12 Ga0070667_100022584 3300005367 Bacteria 5217
13 Ga0070663_100045131 3300005455 Bacteria 3112
14 Ga0070678_102023225 3300005456 Bacteria 545
15 Ga0070662_100017491 3300005457 Bacteria 4835
16 Ga0068867_101051547 3300005459 Bacteria 741
17 Ga0070685_10723015 3300005466 Bacteria 728
18 Ga0070665_100985790 3300005548 Bacteria 855
19 Ga0070665_101768494 3300005548 Bacteria 625
20 Ga0070664_100073544 3300005564 Bacteria 2933
21 Ga0070664_100852702 3300005564 Bacteria 853
22 Ga0068857_100344548 3300005577 Bacteria 1379
23 Ga0068856_100495812 3300005614 Bacteria 1242
24 Ga0068852_100786416 3300005616 Bacteria 965
25 Ga0068861_100206113 3300005719 Bacteria 1654
26 Ga0068858_100910625 3300005842 Bacteria 860
27 Ga0068860_100000622 3300005843 Bacteria 41944
28 Ga0075365_10024134 3300006038 Bacteria 3832
29 Ga0075365_10032089 3300006038 Bacteria 3374
30 Ga0075365_10058401 3300006038 Bacteria 2569
31 Ga0075365_10086026 3300006038 Bacteria 2136
32 Ga0075365_10300124 3300006038 Bacteria 1130
33 Ga0075365_10466981 3300006038 Bacteria 891
34 Ga0075368_10021202 3300006042 Bacteria 2466
35 Ga0075363_100000428 3300006048 Bacteria 13104
36 Ga0075363_100014863 3300006048 Bacteria 3816
37 Ga0075363_100062822 3300006048 Bacteria 2003
38 Ga0075363_100068216 3300006048 Bacteria 1928
39 Ga0075363_100155526 3300006048 Bacteria 1292
40 Ga0075363_100482012 3300006048 Bacteria 735
41 Ga0075363_100706977 3300006048 Bacteria 609
42 Ga0075364_10008212 3300006051 Bacteria 6231
43 Ga0075364_10024565 3300006051 Bacteria 3828
44 Ga0075364_10043526 3300006051 Bacteria 2920
45 Ga0075364_10054919 3300006051 Bacteria 2605
46 Ga0075364_10068912 3300006051 Bacteria 2327
47 Ga0075364_10098445 3300006051 Bacteria 1946
48 Ga0075364_10125011 3300006051 Bacteria 1724
49 Ga0075364_10471801 3300006051 Bacteria 858
50 Ga0075364_10576833 3300006051 Bacteria 769
51 Ga0075364_10605560 3300006051 Bacteria 748
52 Ga0075362_10328338 3300006177 Bacteria 763
53 Ga0075367_10030852 3300006178 Bacteria 3076
54 Ga0075367_10105578 3300006178 Bacteria 1725
55 Ga0075367_10163901 3300006178 Bacteria 1383
56 Ga0075367_10191877 3300006178 Bacteria 1275
57 Ga0097621_100918741 3300006237 Bacteria 816
58 Ga0075370_10000190 3300006353 Bacteria 21660
59 Ga0075370_10044617 3300006353 Bacteria 2506
60 Ga0075370_10058642 3300006353 Bacteria 2190
61 Ga0075370_10098635 3300006353 Bacteria 1689
62 Ga0075370_10113317 3300006353 Bacteria 1576
63 Ga0075370_10311554 3300006353 Bacteria 937
64 Ga0075370_10745882 3300006353 Bacteria 596
65 Ga0075428_100269993 3300006844 Bacteria 1830
66 Ga0075434_100832049 3300006871 Bacteria 939
67 Ga0105245_10422292 3300009098 Bacteria 1337
68 Ga0105243_10103476 3300009148 Bacteria 2368
69 Ga0105243_10932723 3300009148 Bacteria 866
70 Ga0105243_11525080 3300009148 Bacteria 693
71 Ga0105239_10102674 3300010375 Bacteria 3164
72 Ga0105246_10030113 3300011119 Bacteria 3582
73 Ga0163162_10586568 3300013306 Bacteria 1241
74 Ga0157372_10832006 3300013307 Bacteria 1072
75 Ga0157375_10074276 3300013308 Bacteria 3421
76 Ga0157375_10226161 3300013308 Bacteria 2030
77 Ga0157375_10338595 3300013308 Bacteria 1670
78 Ga0163163_10032188 3300014325 Bacteria 5065
79 Ga0163163_11068210 3300014325 Bacteria 870
80 Ga0157380_10156652 3300014326 Bacteria 1975
81 Ga0157377_10684921 3300014745 Bacteria 742
82 Ga0157376_10380531 3300014969 Bacteria 1359
83 Ga0163161_10148901 3300017792 Bacteria 1778
84 Ga0163161_10217680 3300017792 Bacteria 1478
85 Ga0207688_10206438 3300025901 Bacteria 1179
86 Ga0207643_10054317 3300025908 Bacteria 2277
87 Ga0207657_10149597 3300025919 Bacteria 1902
88 Ga0207694_10601707 3300025924 Bacteria 925
89 Ga0207659_11003661 3300025926 Bacteria 718
90 Ga0207706_10010820 3300025933 Bacteria 8323
91 Ga0207709_10144413 3300025935 Bacteria 1640
92 Ga0207709_10685818 3300025935 Bacteria 819
93 Ga0207704_10380745 3300025938 Bacteria 1107
94 Ga0207691_10241778 3300025940 Bacteria 1560
95 Ga0207711_11066480 3300025941 Bacteria 748
96 Ga0207661_10441791 3300025944 Bacteria 1184
97 Ga0207679_10019373 3300025945 Bacteria 4569
98 Ga0207679_11077316 3300025945 Bacteria 737
99 Ga0207677_10537564 3300026023 Bacteria 1016
100 Ga0207678_10047790 3300026067 Bacteria 3700
101 Ga0207678_10173410 3300026067 Bacteria 1841
102 Ga0207675_100029400 3300026118 Bacteria 5120
103 Ga0207675_100583156 3300026118 Bacteria 1120
104 Ga0207683_10130730 3300026121 Bacteria 2258
105 Ga0207698_10697549 3300026142 Bacteria 1010
106 Ga0207698_10971888 3300026142 Bacteria 859
107 Ga0209813_10059682 3300027866 Bacteria 1215
108 Ga0268266_10066594 3300028379 Bacteria 3116
109 Ga0268264_10000371 3300028381 Bacteria 66158
110 Ga0307408_100153546 3300031548 Bacteria 1820
111 Ga0307413_10572813 3300031824 Bacteria 920
112 Ga0307413_10739275 3300031824 Bacteria 821
113 Ga0307407_10451669 3300031903 Bacteria 933
114 Ga0307412_10042202 3300031911 Bacteria 2962
115 Ga0307409_100154954 3300031995 Bacteria 1995
116 Ga0307416_100239939 3300032002 Bacteria 1755
117 Ga0307416_100783444 3300032002 Bacteria 1048
118 Ga0395900_0099008 3300037418 Bacteria 2996
119 Ga0395900_0217044 3300037418 Bacteria 1930
120 Ga0395900_0469049 3300037418 Bacteria 1213
121 Ga0395898_0662877 3300037466 Bacteria 986
122 Ga0395905_0031514 3300037471 Bacteria 4992
123 Ga0395905_1233590 3300037471 Bacteria 651
124 Ga0439436_0106370 3300041404 Bacteria 782
125 Ga0439447_009260 3300041407 Bacteria 2999
126 Ga0439466_0010585 3300041411 Bacteria 3428
127 Ga0439465_0007684 3300041413 Bacteria 3421
128 Ga0451797_0224219 3300041453 Bacteria 664
129 Ga0451839_0191803 3300041496 Bacteria 589
130 Ga0451847_0065192 3300041503 Bacteria 702
131 Ga0451853_0615511 3300041512 Bacteria 829
132 Ga0451853_1417469 3300041512 Bacteria 2097
133 Ga0451853_1443294 3300041512 Bacteria 1632
134 Ga0451853_1734708 3300041512 Bacteria 1783
135 Ga0439433_0009163 3300041999 Bacteria 2154
136 Ga0439442_001507 3300042002 Bacteria 4598
137 Ga0439432_006377 3300042006 Bacteria 4220
138 Ga0439449_0015246 3300042007 Bacteria 2887
139 Ga0439457_023898 3300042014 Bacteria 1352
140 Ga0439462_0029162 3300042015 Bacteria 1459
141 Ga0450919_001413 3300042121 Bacteria 3127
142 Ga0450920_006689 3300042122 Bacteria 2078
143 Ga0450907_002957 3300042146 Bacteria 3120
144 Ga0439446_0008028 3300042156 Bacteria 2790
145 Ga0450908_003960 3300042184 Bacteria 2861
146 Ga0450909_012192 3300042185 Bacteria 1260
147 Ga0439464_0002876 3300042439 Bacteria 4284
148 Ga0450918_002375 3300042531 Bacteria 3558
149 Ga0466972_0014772 3300044658 Bacteria 3907
150 Ga0466965_0033502 3300044683 Bacteria 2511
151 Ga0466965_0035751 3300044683 Bacteria 2434
152 Ga0466965_0114879 3300044683 Bacteria 1386
153 Ga0466965_0268221 3300044683 Bacteria 919
154 Ga0466966_0134490 3300044684 Bacteria 1513
155 Ga0466961_0236310 3300044693 Bacteria 1124
156 Ga0466963_0853970 3300044694 Unclassified 642
157 Ga0466964_0071047 3300044706 Bacteria 1472
158 Ga0466968_0745884 3300044735 Bacteria 502
159 Ga0466970_0006413 3300044765 Bacteria 5884
160 Ga0466970_0151005 3300044765 Bacteria 1282
161 Ga0466970_0415323 3300044765 Bacteria 769
162 Ga0466957_0249516 3300044842 Bacteria 1180
163 Ga0466957_0362069 3300044842 Bacteria 986
164 Ga0466957_0544094 3300044842 Bacteria 809
165 Ga0466960_0003302 3300044901 Bacteria 6190
166 Ga0466960_0068301 3300044901 Bacteria 1762
167 Ga0466960_0079073 3300044901 Bacteria 1653
168 Ga0466960_0119897 3300044901 Bacteria 1377
169 Ga0466960_0318997 3300044901 Bacteria 880
170 Ga0466959_0138686 3300045049 Bacteria 1720
171 Ga0466959_0828250 3300045049 Bacteria 618
172 Ga0466967_0028478 3300045976 Bacteria 4663
173 Ga0466967_0106729 3300045976 Bacteria 2568
174 Ga0466967_0161410 3300045976 Bacteria 2104
175 Ga0466967_0539904 3300045976 Bacteria 1147
176 Ga0495603_0116104 3300046455 Bacteria 1561
177 Ga0495603_0194418 3300046455 Bacteria 1173
178 Ga0495653_0200247 3300046463 Bacteria 1356
179 Ga0495620_0074016 3300046515 Bacteria 1388
180 Ga0495676_0171157 3300047321 Bacteria 1528
181 Ga0496100_0006967 3300048903 Bacteria 6196
182 Ga0496100_0062408 3300048903 Bacteria 2459
183 Ga0496100_0648919 3300048903 Bacteria 822
184 Ga0496101_0010142 3300048904 Bacteria 6213
185 Ga0496102_0013259 3300048905 Bacteria 7135
186 Ga0496102_0185284 3300048905 Bacteria 1962
187 Ga0496103_0050630 3300048906 Bacteria 2569
188 Ga0496104_0003217 3300048907 Bacteria 14052
189 Ga0496104_0694616 3300048907 Bacteria 925
190 Ga0496105_0034221 3300048908 Bacteria 4177
191 Ga0496105_0830185 3300048908 Bacteria 701
192 Ga0496106_0007376 3300048909 Bacteria 8127
193 Ga0496106_0164465 3300048909 Bacteria 1756
194 Ga0496106_0391188 3300048909 Bacteria 1117
195 Ga0496107_0017537 3300048910 Bacteria 5034
196 Ga0496108_0025089 3300048911 Bacteria 4912
197 Ga0496108_0203489 3300048911 Bacteria 1718
198 Ga0496108_0301015 3300048911 Bacteria 1397
199 Ga0496109_0017693 3300048912 Bacteria 6252
200 Ga0496109_0059741 3300048912 Bacteria 3483
201 Ga0496109_0386319 3300048912 Bacteria 1323
202 Ga0496109_0789064 3300048912 Bacteria 888
203 Ga0496110_0013185 3300048913 Bacteria 6825
204 Ga0496110_0143969 3300048913 Bacteria 2155
205 Ga0496110_0514634 3300048913 Bacteria 1089
206 Ga0496111_0026327 3300048914 Bacteria 4106
207 Ga0496111_0246621 3300048914 Bacteria 1326
208 Ga0496112_0151640 3300048915 Bacteria 2285
209 Ga0496113_0025704 3300048916 Bacteria 4201
210 Ga0496114_0019203 3300048917 Bacteria 5538
211 Ga0496114_0063440 3300048917 Bacteria 3093
212 Ga0496114_0294238 3300048917 Bacteria 1433
213 Ga0496114_0567966 3300048917 Bacteria 1001
214 Ga0496114_1145701 3300048917 Bacteria 663
215 Ga0496115_0054523 3300048918 Bacteria 3210
216 Ga0496124_0011980 3300048927 Bacteria 8623
217 Ga0496126_0060735 3300048929 Bacteria 3398
218 Ga0501031_0192776 3300049568 Bacteria 1330
219 Ga0501032_0051998 3300049569 Bacteria 2761
220 Ga0501033_0060690 3300049570 Bacteria 2789
221 Ga0501034_0009983 3300049571 Bacteria 9923
222 Ga0501034_0073832 3300049571 Bacteria 3419
223 Ga0501036_0000486 3300049572 Bacteria 28397
224 Ga0501036_0201588 3300049572 Bacteria 1673
225 Ga0501037_0005914 3300049573 Bacteria 8932
226 Ga0501037_0031749 3300049573 Bacteria 3899
227 Ga0501037_0145310 3300049573 Bacteria 1696
228 Ga0501037_0153972 3300049573 Bacteria 1642
229 Ga0501037_0601454 3300049573 Bacteria 738
230 Ga0501038_0002504 3300049574 Bacteria 17105
231 Ga0501038_0086730 3300049574 Bacteria 2629
232 Ga0501038_0223362 3300049574 Bacteria 1502
233 Ga0501038_0466165 3300049574 Bacteria 970
234 Ga0501039_0482797 3300049575 Bacteria 973
235 Ga0501042_0188135 3300049578 Bacteria 1489
236 Ga0501042_0244521 3300049578 Bacteria 1295
237 Ga0501043_0117206 3300049579 Bacteria 2089
238 Ga0501043_0289869 3300049579 Bacteria 1253
239 Ga0501046_0000172 3300049580 Bacteria 65712
240 Ga0501046_0014939 3300049580 Bacteria 6532
241 Ga0501046_0050790 3300049580 Bacteria 3275
242 Ga0501047_0035943 3300049581 Bacteria 4786
243 Ga0501047_0086314 3300049581 Bacteria 3015
244 Ga0501047_0265756 3300049581 Bacteria 1562
245 Ga0501047_0378898 3300049581 Bacteria 1249
246 Ga0501048_0068518 3300049582 Bacteria 2506
247 Ga0501048_0101732 3300049582 Bacteria 2027
248 Ga0501067_0000397 3300049583 Bacteria 23743
249 Ga0501067_0005914 3300049583 Bacteria 6781
250 Ga0501067_0020381 3300049583 Bacteria 3669
251 Ga0501067_0074365 3300049583 Bacteria 1883
252 Ga0501067_0152318 3300049583 Bacteria 1288
253 Ga0501068_0009704 3300049584 Bacteria 5389
254 Ga0501068_0045927 3300049584 Bacteria 2632
255 Ga0501069_0005529 3300049585 Bacteria 6577
256 Ga0501069_0048334 3300049585 Bacteria 2362
257 Ga0501069_0161016 3300049585 Bacteria 1292
258 Ga0501069_0517016 3300049585 Bacteria 713
259 Ga0501070_0006273 3300049586 Bacteria 10119
260 Ga0501070_0014303 3300049586 Bacteria 6679
261 Ga0501070_0113021 3300049586 Bacteria 2244
262 Ga0501070_0136502 3300049586 Bacteria 2025
263 Ga0501072_0005186 3300049588 Bacteria 9912
264 Ga0501072_0015953 3300049588 Bacteria 5760
265 Ga0501073_0007455 3300049589 Bacteria 8132
266 Ga0501073_0010717 3300049589 Bacteria 6713
267 Ga0501073_0026039 3300049589 Bacteria 4192
268 Ga0501073_0061546 3300049589 Bacteria 2619
269 Ga0501074_0000957 3300049590 Bacteria 18677
270 Ga0501074_0002120 3300049590 Bacteria 13704
271 Ga0501074_0007382 3300049590 Bacteria 7949
272 Ga0501077_0002136 3300049593 Bacteria 11929
273 Ga0501077_0268873 3300049593 Bacteria 1084
274 Ga0501079_0868592 3300049741 Bacteria 710
275 Ga0501080_0001513 3300049742 Bacteria 19622
276 Ga0501080_0008212 3300049742 Bacteria 9453
277 Ga0501080_0013040 3300049742 Bacteria 7632
278 Ga0501080_0870561 3300049742 Unclassified 787
279 Ga0501083_0004646 3300049744 Bacteria 9700
280 Ga0501083_0102461 3300049744 Bacteria 1887
281 Ga0501083_0159022 3300049744 Bacteria 1478
282 Ga0501035_0014079 3300049822 Bacteria 7378
283 Ga0501035_0017891 3300049822 Bacteria 6538
284 Ga0501035_0019060 3300049822 Bacteria 6314
285 Ga0501044_0004098 3300049823 Bacteria 16346
286 Ga0501044_0050278 3300049823 Bacteria 4302
287 Ga0501045_0174608 3300049824 Bacteria 1601
288 Ga0501045_0282701 3300049824 Bacteria 1235
289 nmdc:mga03n38_116555_c1 3300050490 Bacteria 1307
290 nmdc:mga03n38_203116_c1 3300050490 Bacteria 1026
291 nmdc:mga03n38_25698_c1 3300050490 Bacteria 2423
292 nmdc:mga03n38_27158_c1 3300050490 Bacteria 2372
293 nmdc:mga03n38_395374_c1 3300050490 Bacteria 760
294 nmdc:mga00v17_17500_c1 3300050491 Bacteria 4059
295 nmdc:mga00v17_18090_c1 3300050491 Bacteria 3999
296 nmdc:mga00v17_224017_c1 3300050491 Bacteria 1218
297 nmdc:mga00v17_276086_c1 3300050491 Bacteria 1091
298 nmdc:mga00v17_283006_c1 3300050491 Bacteria 1077
299 nmdc:mga00v17_43649_c1 3300050491 Bacteria 2701
300 nmdc:mga00v17_59454_c1 3300050491 Bacteria 2345
301 nmdc:mga00v17_618923_c1 3300050491 Bacteria 697
302 nmdc:mga00v17_988944_c1 3300050491 Bacteria 530
303 nmdc:mga0yw44_10766_c1 3300050492 Bacteria 4686
304 nmdc:mga0yw44_205045_c1 3300050492 Bacteria 1303
305 nmdc:mga0yw44_239517_c1 3300050492 Bacteria 1206
306 nmdc:mga0yw44_40012_c1 3300050492 Bacteria 2782
307 nmdc:mga0yw44_583622_c1 3300050492 Bacteria 759
308 nmdc:mga0yw44_682131_c1 3300050492 Bacteria 698
309 nmdc:mga06z11_164380_c1 3300050494 Bacteria 1271
310 nmdc:mga04h51_69310_c1 3300050495 Bacteria 1228
311 nmdc:mga07m45_229400_c1 3300050496 Bacteria 1080
312 nmdc:mga07m45_255471_c1 3300050496 Bacteria 1019
313 nmdc:mga07m45_50491_c1 3300050496 Bacteria 2344
314 nmdc:mga07m45_58261_c1 3300050496 Bacteria 2185
315 nmdc:mga07m45_8318_c1 3300050496 Bacteria 5328
316 Ga0495655_0006126 3300053083 Bacteria 2169
317 Ga0500643_016808 3300053087 Bacteria 2468
318 Ga0500644_0000145 3300053088 Bacteria 44098
319 Ga0500644_0395238 3300053088 Bacteria 602
320 Ga0500593_000367 3300053117 Bacteria 18158
321 Ga0500593_250878 3300053117 Unclassified 599
322 Ga0501084_0000711 3300054114 Bacteria 25412
323 Ga0501084_0025757 3300054114 Bacteria 4904
324 Ga0501084_0061592 3300054114 Bacteria 3142
325 Ga0501082_0006115 3300060353 Bacteria 10449
326 Ga0501082_1141371 3300060353 Bacteria 681
327 2523383786 2523231044 Bacteria 6434991
328 2644092801 2643221615 Bacteria 5487866
329 2644322414 2643221657 Bacteria 5490246
330 2739365215 2738543034 Bacteria 6084756
331 2739365217 2738543034 Bacteria 6084756
332 2833710569 2833709550 Bacteria 4008291
333 2919044767 2919042368 Bacteria 3905917
334 2984553065 2984551494 Bacteria 3877562
335 Ga0451853_2867917
336 rootL2_10022135
337 Ga0070658_10231628
338 Ga0070683_100760928
339 Ga0070682_100181679
340 Ga0068868_100239106
341 Ga0068868_100520658
342 Ga0068868_101042853
343 Ga0070661_100299630
344 Ga0070675_100347381
345 Ga0070674_100338614
346 Ga0070667_100022584
347 Ga0070663_100045131
348 Ga0070678_102023225
349 Ga0070662_100017491
350 Ga0068867_101051547
351 Ga0070685_10723015
352 Ga0070665_100985790
353 Ga0070665_101768494
354 Ga0070664_100073544
355 Ga0070664_100852702
356 Ga0068857_100344548
357 Ga0068856_100495812
358 Ga0068852_100786416
359 Ga0068861_100206113
360 Ga0068858_100910625
361 Ga0068860_100000622
362 Ga0075365_10024134
363 Ga0075365_10032089
364 Ga0075365_10058401
365 Ga0075365_10086026
366 Ga0075365_10300124
367 Ga0075365_10466981
368 Ga0075368_10021202
369 Ga0075363_100000428
370 Ga0075363_100014863
371 Ga0075363_100062822
372 Ga0075363_100068216
373 Ga0075363_100155526
374 Ga0075363_100482012
375 Ga0075363_100706977
376 Ga0075364_10008212
377 Ga0075364_10024565
378 Ga0075364_10043526
379 Ga0075364_10054919
380 Ga0075364_10068912
381 Ga0075364_10098445
382 Ga0075364_10125011
383 Ga0075364_10471801
384 Ga0075364_10576833
385 Ga0075364_10605560
386 Ga0075362_10328338
387 Ga0075367_10030852
388 Ga0075367_10105578
389 Ga0075367_10163901
390 Ga0075367_10191877
391 Ga0097621_100918741
392 Ga0075370_10000190
393 Ga0075370_10044617
394 Ga0075370_10058642
395 Ga0075370_10098635
396 Ga0075370_10113317
397 Ga0075370_10311554
398 Ga0075370_10745882
399 Ga0075428_100269993
400 Ga0075434_100832049
401 Ga0105245_10422292
402 Ga0105243_10103476
403 Ga0105243_10932723
404 Ga0105243_11525080
405 Ga0105239_10102674
406 Ga0105246_10030113
407 Ga0163162_10586568
408 Ga0157372_10832006
409 Ga0157375_10074276
410 Ga0157375_10226161
411 Ga0157375_10338595
412 Ga0163163_10032188
413 Ga0163163_11068210
414 Ga0157380_10156652
415 Ga0157377_10684921
416 Ga0157376_10380531
417 Ga0163161_10148901
418 Ga0163161_10217680
419 Ga0207688_10206438
420 Ga0207643_10054317
421 Ga0207657_10149597
422 Ga0207694_10601707
423 Ga0207659_11003661
424 Ga0207706_10010820
425 Ga0207709_10144413
426 Ga0207709_10685818
427 Ga0207704_10380745
428 Ga0207691_10241778
429 Ga0207711_11066480
430 Ga0207661_10441791
431 Ga0207679_10019373
432 Ga0207679_11077316
433 Ga0207677_10537564
434 Ga0207678_10047790
435 Ga0207678_10173410
436 Ga0207675_100029400
437 Ga0207675_100583156
438 Ga0207683_10130730
439 Ga0207698_10697549
440 Ga0207698_10971888
441 Ga0209813_10059682
442 Ga0268266_10066594
443 Ga0268264_10000371
444 Ga0307408_100153546
445 Ga0307413_10572813
446 Ga0307413_10739275
447 Ga0307407_10451669
448 Ga0307412_10042202
449 Ga0307409_100154954
450 Ga0307416_100239939
451 Ga0307416_100783444
452 Ga0395900_0099008
453 Ga0395900_0217044
454 Ga0395900_0469049
455 Ga0395898_0662877
456 Ga0395905_0031514
457 Ga0395905_1233590
458 Ga0439436_0106370
459 Ga0439447_009260
460 Ga0439466_0010585
461 Ga0439465_0007684
462 Ga0451797_0224219
463 Ga0451839_0191803
464 Ga0451847_0065192
465 Ga0451853_0615511
466 Ga0451853_1417469
467 Ga0451853_1443294
468 Ga0451853_1734708
469 Ga0439433_0009163
470 Ga0439442_001507
471 Ga0439432_006377
472 Ga0439449_0015246
473 Ga0439457_023898
474 Ga0439462_0029162
475 Ga0450919_001413
476 Ga0450920_006689
477 Ga0450907_002957
478 Ga0439446_0008028
479 Ga0450908_003960
480 Ga0450909_012192
481 Ga0439464_0002876
482 Ga0450918_002375
483 Ga0466972_0014772
484 Ga0466965_0033502
485 Ga0466965_0035751
486 Ga0466965_0114879
487 Ga0466965_0268221
488 Ga0466966_0134490
489 Ga0466961_0236310
490 Ga0466963_0853970
491 Ga0466964_0071047
492 Ga0466968_0745884
493 Ga0466970_0006413
494 Ga0466970_0151005
495 Ga0466970_0415323
496 Ga0466957_0249516
497 Ga0466957_0362069
498 Ga0466957_0544094
499 Ga0466960_0003302
500 Ga0466960_0068301
501 Ga0466960_0079073
502 Ga0466960_0119897
503 Ga0466960_0318997
504 Ga0466959_0138686
505 Ga0466959_0828250
506 Ga0466967_0028478
507 Ga0466967_0106729
508 Ga0466967_0161410
509 Ga0466967_0539904
510 Ga0495603_0116104
511 Ga0495603_0194418
512 Ga0495653_0200247
513 Ga0495620_0074016
514 Ga0495676_0171157
515 Ga0496100_0006967
516 Ga0496100_0062408
517 Ga0496100_0648919
518 Ga0496101_0010142
519 Ga0496102_0013259
520 Ga0496102_0185284
521 Ga0496103_0050630
522 Ga0496104_0003217
523 Ga0496104_0694616
524 Ga0496105_0034221
525 Ga0496105_0830185
526 Ga0496106_0007376
527 Ga0496106_0164465
528 Ga0496106_0391188
529 Ga0496107_0017537
530 Ga0496108_0025089
531 Ga0496108_0203489
532 Ga0496108_0301015
533 Ga0496109_0017693
534 Ga0496109_0059741
535 Ga0496109_0386319
536 Ga0496109_0789064
537 Ga0496110_0013185
538 Ga0496110_0143969
539 Ga0496110_0514634
540 Ga0496111_0026327
541 Ga0496111_0246621
542 Ga0496112_0151640
543 Ga0496113_0025704
544 Ga0496114_0019203
545 Ga0496114_0063440
546 Ga0496114_0294238
547 Ga0496114_0567966
548 Ga0496114_1145701
549 Ga0496115_0054523
550 Ga0496124_0011980
551 Ga0496126_0060735
552 Ga0501031_0192776
553 Ga0501032_0051998
554 Ga0501033_0060690
555 Ga0501034_0009983
556 Ga0501034_0073832
557 Ga0501036_0000486
558 Ga0501036_0201588
559 Ga0501037_0005914
560 Ga0501037_0031749
561 Ga0501037_0145310
562 Ga0501037_0153972
563 Ga0501037_0601454
564 Ga0501038_0002504
565 Ga0501038_0086730
566 Ga0501038_0223362
567 Ga0501038_0466165
568 Ga0501039_0482797
569 Ga0501042_0188135
570 Ga0501042_0244521
571 Ga0501043_0117206
572 Ga0501043_0289869
573 Ga0501046_0000172
574 Ga0501046_0014939
575 Ga0501046_0050790
576 Ga0501047_0035943
577 Ga0501047_0086314
578 Ga0501047_0265756
579 Ga0501047_0378898
580 Ga0501048_0068518
581 Ga0501048_0101732
582 Ga0501067_0000397
583 Ga0501067_0005914
584 Ga0501067_0020381
585 Ga0501067_0074365
586 Ga0501067_0152318
587 Ga0501068_0009704
588 Ga0501068_0045927
589 Ga0501069_0005529
590 Ga0501069_0048334
591 Ga0501069_0161016
592 Ga0501069_0517016
593 Ga0501070_0006273
594 Ga0501070_0014303
595 Ga0501070_0113021
596 Ga0501070_0136502
597 Ga0501072_0005186
598 Ga0501072_0015953
599 Ga0501073_0007455
600 Ga0501073_0010717
601 Ga0501073_0026039
602 Ga0501073_0061546
603 Ga0501074_0000957
604 Ga0501074_0002120
605 Ga0501074_0007382
606 Ga0501077_0002136
607 Ga0501077_0268873
608 Ga0501079_0868592
609 Ga0501080_0001513
610 Ga0501080_0008212
611 Ga0501080_0013040
612 Ga0501080_0870561
613 Ga0501083_0004646
614 Ga0501083_0102461
615 Ga0501083_0159022
616 Ga0501035_0014079
617 Ga0501035_0017891
618 Ga0501035_0019060
619 Ga0501044_0004098
620 Ga0501044_0050278
621 Ga0501045_0174608
622 Ga0501045_0282701
623 nmdc:mga03n38_116555_c1
624 nmdc:mga03n38_203116_c1
625 nmdc:mga03n38_25698_c1
626 nmdc:mga03n38_27158_c1
627 nmdc:mga03n38_395374_c1
628 nmdc:mga00v17_17500_c1
629 nmdc:mga00v17_18090_c1
630 nmdc:mga00v17_224017_c1
631 nmdc:mga00v17_276086_c1
632 nmdc:mga00v17_283006_c1
633 nmdc:mga00v17_43649_c1
634 nmdc:mga00v17_59454_c1
635 nmdc:mga00v17_618923_c1
636 nmdc:mga00v17_988944_c1
637 nmdc:mga0yw44_10766_c1
638 nmdc:mga0yw44_205045_c1
639 nmdc:mga0yw44_239517_c1
640 nmdc:mga0yw44_40012_c1
641 nmdc:mga0yw44_583622_c1
642 nmdc:mga0yw44_682131_c1
643 nmdc:mga06z11_164380_c1
644 nmdc:mga04h51_69310_c1
645 nmdc:mga07m45_229400_c1
646 nmdc:mga07m45_255471_c1
647 nmdc:mga07m45_50491_c1
648 nmdc:mga07m45_58261_c1
649 nmdc:mga07m45_8318_c1
650 Ga0495655_0006126
651 Ga0500643_016808
652 Ga0500644_0000145
653 Ga0500644_0395238
654 Ga0500593_000367
655 Ga0500593_250878
656 Ga0501084_0000711
657 Ga0501084_0025757
658 Ga0501084_0061592
659 Ga0501082_0006115
660 Ga0501082_1141371
661 2523383786
662 2644092801
663 2644322414
664 2739365215
665 2739365217
666 2833710569
667 2919044767
668 2984553065

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03358

FMN_red

NADPH-dependent FMN reductase

12

151

0.92

PF02525

Flavodoxin_2

Flavodoxin-like fold

12

116

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
3k1y-assembly1.cif.gz_A x-ray structure of oxidoreductase from corynebacterium diphtheriae. orthorombic crystal form, northeast structural genomics consortium target cdr100d 0.8527 4 167
4ltd-assembly1.cif.gz_A crystal structures of nadh:fmn oxidoreductase (emob) - apo form 0.8468 6 167
7qw4-assembly9.cif.gz_I pden_5119 protein 0.8369 7 167
7qw4-assembly5.cif.gz_E pden_5119 protein 0.8244 4 169
7qw4-assembly2.cif.gz_B pden_5119 protein 0.8203 4 165
ID Description Score Start End Superfamily
3k1yA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8325 7 167 3.40.50.360
4ltnA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8208 6 167 3.40.50.360
6dqpA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.7985 7 165 3.40.50.360
4c76B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.7942 6 170 3.40.50.360
3k1yA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.7757 7 167 3.40.50.360
ID Description Score Start End GO Terms
AF-A0A0S9Q8V2-F1-model_v4 NADPH-dependent FMN reductase 0.9986 6 165 GO:0016491
AF-A0A1V4Q2R7-F1-model_v4 NADPH-dependent FMN reductase 0.9982 7 124 GO:0016491
AF-A0A0Q8DUF5-F1-model_v4 NADPH-dependent FMN reductase 0.9943 4 168 GO:0016491
AF-A0A7K0WZ43-F1-model_v4 NADPH-dependent oxidoreductase 0.9922 2 166 GO:0016491
AF-A0A1V4Q2R7-F1-model_v4 NADPH-dependent FMN reductase 0.9816 7 124 GO:0016491

Map