F411800

General Info

Members Datasets Scaffolds Average Seq Length
334 225 668 220

Family's Representative Sequence

Representative Sequence 3300013308|Ga0157375_10005629|Ga0157375_1000562912
Length 259
Sequence MTSETFLQILDLIGTFVFAISGAQAAVDRRLDIFGILVLSFVAGNFGGIFRDLLIGAVPPSALSTTRYLLVSILAGLITFFWYAGVDRLRSPVLMFDAAGLSLFAVSGAQKALDFGLNPMMAALLGMLTGVGGGMTRDVLLAEIPQILRSDLYAVAALAGAAVVVIGNMVDVHYGVSAFIGAALCFGLRFMAIRHGWPCRPLIFPRGRGLKKGRMISAGAHNERSNLAGRIIVMGRNSTNDIRPDCCQSMPFLAVDQPL

Samples

Sample ID Description Type Environment
1 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
2 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
85 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
130 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
133 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
134 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
135 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
136 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
137 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
138 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
139 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
140 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
141 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
142 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
143 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
144 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
145 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
148 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
149 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
150 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
151 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
152 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
153 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
154 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
155 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
156 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
157 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
158 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
159 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
160 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
161 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
162 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
163 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
164 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
165 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
166 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
167 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
168 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
169 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
170 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
171 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
172 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
173 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
174 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
175 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
176 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
177 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
178 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
179 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
180 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
181 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
182 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
183 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
184 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
185 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
186 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
187 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
188 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
189 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
190 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
191 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
192 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
193 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
194 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
195 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
196 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
197 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
198 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
199 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
200 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
201 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
205 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
206 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
207 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
208 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
209 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
210 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
211 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
212 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
213 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
214 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
215 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
216 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
217 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
218 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
219 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
220 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
221 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
222 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
223 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
224 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
225 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.2
Metatranscriptomes 1.2
Isolates 0.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.2
Nodule 0
Rhizoplane 2.4
Rhizosphere 94.91
Stem 0
Stem Tuber 0
Unclassified 6.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157375_10005629 3300013308 Bacteria 10908
2 JGI25165J46597_1000129 3300003214 Bacteria 127064
3 JGI25165J46597_1001402 3300003214 Bacteria 13123
4 Ga0070658_10003556 3300005327 Bacteria 12800
5 Ga0070658_10229250 3300005327 Bacteria 1572
6 Ga0070683_100018031 3300005329 Bacteria 6244
7 Ga0070690_100267491 3300005330 Unclassified 1215
8 Ga0070670_100017731 3300005331 Bacteria 6108
9 Ga0068869_100341593 3300005334 Bacteria 1218
10 Ga0070680_100026609 3300005336 Bacteria 4626
11 Ga0070680_100035886 3300005336 Bacteria 4004
12 Ga0070680_100103449 3300005336 Bacteria 2366
13 Ga0070680_100240690 3300005336 Bacteria 1529
14 Ga0068868_100204752 3300005338 Bacteria 1647
15 Ga0068868_100806950 3300005338 Unclassified 847
16 Ga0070660_100107856 3300005339 Bacteria 2213
17 Ga0070660_100194835 3300005339 Bacteria 1642
18 Ga0070660_100483940 3300005339 Bacteria 1028
19 Ga0070660_100913456 3300005339 Unclassified 740
20 Ga0070689_100058977 3300005340 Unclassified 2982
21 Ga0070691_10028069 3300005341 Bacteria 2627
22 Ga0070687_100289667 3300005343 Bacteria 1034
23 Ga0070668_100008146 3300005347 Bacteria 7786
24 Ga0070668_100236572 3300005347 Bacteria 1512
25 Ga0070668_100657636 3300005347 Bacteria 921
26 Ga0070669_100025403 3300005353 Bacteria 4254
27 Ga0070669_100224765 3300005353 Bacteria 1485
28 Ga0070675_100497783 3300005354 Bacteria 1098
29 Ga0070671_100197879 3300005355 Bacteria 1704
30 Ga0070674_100957867 3300005356 Bacteria 749
31 Ga0070673_100045304 3300005364 Bacteria 3410
32 Ga0070673_100644465 3300005364 Bacteria 969
33 Ga0070688_100080087 3300005365 Bacteria 2112
34 Ga0070667_100019110 3300005367 Bacteria 5682
35 Ga0070709_10061754 3300005434 Bacteria 2386
36 Ga0070709_10303150 3300005434 Bacteria 1167
37 Ga0070714_100298268 3300005435 Bacteria 1502
38 Ga0070710_10157254 3300005437 Bacteria 1406
39 Ga0070711_100267466 3300005439 Bacteria 1348
40 Ga0070663_100079889 3300005455 Bacteria 2401
41 Ga0070663_100080790 3300005455 Bacteria 2388
42 Ga0070663_100085464 3300005455 Bacteria 2328
43 Ga0070663_100424587 3300005455 Bacteria 1091
44 Ga0070663_100616633 3300005455 Bacteria 914
45 Ga0070662_100078971 3300005457 Bacteria 2446
46 Ga0070662_100099839 3300005457 Bacteria 2195
47 Ga0070681_10022423 3300005458 Bacteria 6340
48 Ga0070681_10023773 3300005458 Bacteria 6169
49 Ga0070681_10210701 3300005458 Unclassified 1859
50 Ga0070681_10229012 3300005458 Bacteria 1773
51 Ga0068867_100015396 3300005459 Bacteria 5423
52 Ga0068867_100076560 3300005459 Bacteria 2512
53 Ga0070706_100413105 3300005467 Bacteria 1256
54 Ga0070698_100001563 3300005471 Bacteria 25431
55 Ga0070679_100019368 3300005530 Bacteria 6614
56 Ga0070679_100037498 3300005530 Bacteria 4816
57 Ga0070679_100047311 3300005530 Bacteria 4288
58 Ga0070679_100051835 3300005530 Bacteria 4088
59 Ga0070679_100086935 3300005530 Bacteria 3113
60 Ga0070679_100230039 3300005530 Bacteria 1814
61 Ga0070679_100282293 3300005530 Bacteria 1613
62 Ga0070684_100067044 3300005535 Bacteria 3151
63 Ga0070684_101001079 3300005535 Unclassified 784
64 Ga0070697_100569186 3300005536 Bacteria 994
65 Ga0068853_100206889 3300005539 Bacteria 1787
66 Ga0070696_100340237 3300005546 Bacteria 1159
67 Ga0070693_100083030 3300005547 Bacteria 1914
68 Ga0070693_100165498 3300005547 Bacteria 1412
69 Ga0068855_100225167 3300005563 Bacteria 2102
70 Ga0068855_100296134 3300005563 Bacteria 1793
71 Ga0068855_100352675 3300005563 Bacteria 1620
72 Ga0070664_100284768 3300005564 Bacteria 1491
73 Ga0068854_100115438 3300005578 Bacteria 2031
74 Ga0068856_100011137 3300005614 Bacteria 8730
75 Ga0068856_100718898 3300005614 Unclassified 1019
76 Ga0068852_100089818 3300005616 Bacteria 2746
77 Ga0068859_100077429 3300005617 Bacteria 3366
78 Ga0068859_100323876 3300005617 Bacteria 1635
79 Ga0068864_100231304 3300005618 Bacteria 1710
80 Ga0068861_100387113 3300005719 Bacteria 1237
81 Ga0068870_10068093 3300005840 Bacteria 1933
82 Ga0068863_100025845 3300005841 Bacteria 5602
83 Ga0068863_100136998 3300005841 Bacteria 2339
84 Ga0068858_100187862 3300005842 Bacteria 1952
85 Ga0068858_100469694 3300005842 Unclassified 1213
86 Ga0068860_100048494 3300005843 Bacteria 4048
87 Ga0068862_100240806 3300005844 Bacteria 1645
88 Ga0081538_10015772 3300005981 Bacteria 5830
89 Ga0070717_10471883 3300006028 Bacteria 1132
90 Ga0070712_100010278 3300006175 Bacteria 5900
91 Ga0070712_100056778 3300006175 Bacteria 2747
92 Ga0097621_100308579 3300006237 Bacteria 1399
93 Ga0075428_100043638 3300006844 Bacteria 4930
94 Ga0075431_100048686 3300006847 Bacteria 4371
95 Ga0075434_100311487 3300006871 Bacteria 1594
96 Ga0075434_100633096 3300006871 Unclassified 1088
97 Ga0075429_100206784 3300006880 Bacteria 1720
98 Ga0068865_100330231 3300006881 Bacteria 1229
99 Ga0068865_100356630 3300006881 Bacteria 1186
100 Ga0075436_100017687 3300006914 Bacteria 4880
101 Ga0097620_100077436 3300006931 Bacteria 3366
102 Ga0097620_100323895 3300006931 Bacteria 1635
103 Ga0075435_100559523 3300007076 Bacteria 991
104 Ga0105240_10009932 3300009093 Bacteria 13420
105 Ga0105240_10028665 3300009093 Bacteria 7265
106 Ga0111539_10042446 3300009094 Bacteria 5461
107 Ga0105245_10292832 3300009098 Bacteria 1595
108 Ga0105247_10028637 3300009101 Bacteria 3371
109 Ga0105243_10363322 3300009148 Bacteria 1333
110 Ga0105248_10182179 3300009177 Unclassified 2367
111 Ga0105248_10363473 3300009177 Bacteria 1630
112 Ga0105238_10056057 3300009551 Bacteria 3954
113 Ga0105238_10330662 3300009551 Bacteria 1511
114 Ga0105238_10787458 3300009551 Bacteria 966
115 Ga0105249_10795862 3300009553 Unclassified 1009
116 Ga0105239_11029527 3300010375 Bacteria 947
117 Ga0157370_10013437 3300013104 Bacteria 8434
118 Ga0157370_10048435 3300013104 Bacteria 4071
119 Ga0157370_10350355 3300013104 Bacteria 1361
120 Ga0157369_10094095 3300013105 Bacteria 3199
121 Ga0157369_10111632 3300013105 Bacteria 2905
122 Ga0157369_10248814 3300013105 Unclassified 1856
123 Ga0157378_10057452 3300013297 Bacteria 3468
124 Ga0163162_10063235 3300013306 Bacteria 3743
125 Ga0157372_10100400 3300013307 Bacteria 3302
126 Ga0157372_10539543 3300013307 Bacteria 1360
127 Ga0157372_10826217 3300013307 Bacteria 1076
128 Ga0163163_10073485 3300014325 Bacteria 3411
129 Ga0157379_10029813 3300014968 Bacteria 4852
130 Ga0163161_10148871 3300017792 Unclassified 1778
131 Ga0197907_10704936 3300020069 Bacteria 808
132 Ga0206352_10610345 3300020078 Bacteria 2153
133 Ga0206350_10469014 3300020080 Unclassified 1081
134 Ga0224712_10007956 3300022467 Bacteria 3111
135 Ga0209233_1000155 3300025261 Bacteria 167981
136 Ga0209233_1000883 3300025261 Bacteria 13175
137 Ga0207656_10051252 3300025321 Bacteria 1785
138 Ga0207710_10047713 3300025900 Bacteria 1915
139 Ga0207688_10530352 3300025901 Bacteria 739
140 Ga0207699_10092729 3300025906 Bacteria 1899
141 Ga0207699_10144006 3300025906 Bacteria 1569
142 Ga0207645_10140690 3300025907 Bacteria 1572
143 Ga0207705_10651291 3300025909 Bacteria 819
144 Ga0207707_10033844 3300025912 Bacteria 4472
145 Ga0207707_10041467 3300025912 Bacteria 4020
146 Ga0207707_10057476 3300025912 Bacteria 3386
147 Ga0207707_10059881 3300025912 Bacteria 3313
148 Ga0207707_10071937 3300025912 Bacteria 3014
149 Ga0207707_10316779 3300025912 Bacteria 1347
150 Ga0207693_10110470 3300025915 Bacteria 2155
151 Ga0207693_10135819 3300025915 Bacteria 1934
152 Ga0207663_10038109 3300025916 Bacteria 2903
153 Ga0207660_10019277 3300025917 Bacteria 4558
154 Ga0207660_10019416 3300025917 Bacteria 4544
155 Ga0207660_10182008 3300025917 Unclassified 1632
156 Ga0207660_10253111 3300025917 Bacteria 1390
157 Ga0207657_10047751 3300025919 Bacteria 3741
158 Ga0207657_10200050 3300025919 Bacteria 1608
159 Ga0207657_10377598 3300025919 Bacteria 1116
160 Ga0207652_10044273 3300025921 Bacteria 3791
161 Ga0207652_10057675 3300025921 Bacteria 3344
162 Ga0207652_10094382 3300025921 Bacteria 2634
163 Ga0207652_10131789 3300025921 Bacteria 2230
164 Ga0207652_10226689 3300025921 Bacteria 1684
165 Ga0207652_10229985 3300025921 Bacteria 1671
166 Ga0207652_10231074 3300025921 Bacteria 1667
167 Ga0207681_10087146 3300025923 Bacteria 2221
168 Ga0207694_10265536 3300025924 Bacteria 1407
169 Ga0207694_10720597 3300025924 Bacteria 841
170 Ga0207650_10095710 3300025925 Unclassified 2276
171 Ga0207687_10236509 3300025927 Bacteria 1445
172 Ga0207700_10121154 3300025928 Bacteria 2121
173 Ga0207700_10459223 3300025928 Bacteria 1123
174 Ga0207664_10269506 3300025929 Bacteria 1491
175 Ga0207664_10452100 3300025929 Unclassified 1147
176 Ga0207644_10173136 3300025931 Bacteria 1687
177 Ga0207644_10488771 3300025931 Bacteria 1014
178 Ga0207690_10379915 3300025932 Bacteria 1122
179 Ga0207706_10092888 3300025933 Bacteria 2654
180 Ga0207706_10100133 3300025933 Bacteria 2550
181 Ga0207709_10219421 3300025935 Unclassified 1370
182 Ga0207669_10638008 3300025937 Bacteria 870
183 Ga0207704_10278685 3300025938 Bacteria 1270
184 Ga0207665_10017890 3300025939 Bacteria 4658
185 Ga0207711_10048249 3300025941 Bacteria 3643
186 Ga0207711_10098365 3300025941 Unclassified 2585
187 Ga0207689_10001685 3300025942 Bacteria 20991
188 Ga0207661_10008781 3300025944 Bacteria 7229
189 Ga0207679_10341236 3300025945 Bacteria 1303
190 Ga0207679_10352642 3300025945 Bacteria 1283
191 Ga0207667_10054221 3300025949 Bacteria 4217
192 Ga0207667_10166270 3300025949 Bacteria 2268
193 Ga0207667_10349355 3300025949 Bacteria 1508
194 Ga0207667_10731972 3300025949 Bacteria 990
195 Ga0207651_10210234 3300025960 Bacteria 1565
196 Ga0207712_10224004 3300025961 Bacteria 1505
197 Ga0207668_10046628 3300025972 Bacteria 2962
198 Ga0207668_10427765 3300025972 Bacteria 1125
199 Ga0207640_10303517 3300025981 Bacteria 1264
200 Ga0207677_10348162 3300026023 Bacteria 1240
201 Ga0207703_10075161 3300026035 Bacteria 2799
202 Ga0207678_10239708 3300026067 Bacteria 1553
203 Ga0207678_10594428 3300026067 Bacteria 970
204 Ga0207702_10020107 3300026078 Bacteria 5532
205 Ga0207641_10189534 3300026088 Bacteria 1889
206 Ga0207648_10010951 3300026089 Bacteria 8567
207 Ga0207648_10100263 3300026089 Bacteria 2537
208 Ga0207676_10037638 3300026095 Bacteria 3688
209 Ga0207676_10149036 3300026095 Bacteria 2013
210 Ga0207674_10057028 3300026116 Bacteria 3962
211 Ga0207675_100001861 3300026118 Bacteria 21131
212 Ga0207683_10346693 3300026121 Bacteria 1363
213 Ga0207428_10501999 3300027907 Bacteria 881
214 Ga0268265_10026983 3300028380 Bacteria 4093
215 Ga0268265_10335524 3300028380 Bacteria 1375
216 Ga0268264_10010622 3300028381 Bacteria 7610
217 Ga0265332_10004495 3300031238 Bacteria 6535
218 Ga0265328_10009616 3300031239 Bacteria 3929
219 Ga0265331_10003965 3300031250 Bacteria 9353
220 Ga0265316_10004529 3300031344 Bacteria 13814
221 Ga0265314_10010253 3300031711 Bacteria 7837
222 Ga0265342_10009822 3300031712 Bacteria 6695
223 Ga0373939_0014332 3300035114 Bacteria 2055
224 Ga0373953_0029649 3300035117 Bacteria 2117
225 Ga0373956_0123616 3300035119 Bacteria 1209
226 Ga0373942_0003880 3300035207 Bacteria 3497
227 Ga0373931_0000344 3300035691 Bacteria 19127
228 Ga0373933_0060406 3300035724 Bacteria 2285
229 Ga0373933_0339176 3300035724 Bacteria 975
230 Ga0373947_0047944 3300035725 Bacteria 2562
231 Ga0373937_0116603 3300036401 Bacteria 2487
232 Ga0373937_0256534 3300036401 Bacteria 1648
233 Ga0373925_0492113 3300037068 Bacteria 1006
234 Ga0395900_0076322 3300037418 Bacteria 3444
235 Ga0395900_0096514 3300037418 Bacteria 3037
236 Ga0395900_0135174 3300037418 Unclassified 2526
237 Ga0395898_0069557 3300037466 Bacteria 3405
238 Ga0395898_0244934 3300037466 Bacteria 1710
239 Ga0395898_0384499 3300037466 Bacteria 1338
240 Ga0395905_0113116 3300037471 Bacteria 2550
241 Ga0395901_0014365 3300038443 Bacteria 8061
242 Ga0395901_0097857 3300038443 Bacteria 3076
243 Ga0395901_0222411 3300038443 Bacteria 1973
244 Ga0395901_0298186 3300038443 Bacteria 1671
245 Ga0395901_0393142 3300038443 Bacteria 1425
246 Ga0451576_0348520 3300045051 Bacteria 1550
247 Ga0495638_0099342 3300046460 Bacteria 1742
248 Ga0495651_0092909 3300046462 Bacteria 2260
249 Ga0495653_0220474 3300046463 Bacteria 1275
250 Ga0495582_0066140 3300046473 Bacteria 1997
251 Ga0495664_0006203 3300046477 Bacteria 6600
252 Ga0495585_0018361 3300046492 Bacteria 4035
253 Ga0495585_0140311 3300046492 Bacteria 1266
254 Ga0495594_0248454 3300046499 Bacteria 1013
255 Ga0495596_0000015 3300046500 Bacteria 121879
256 Ga0495607_0144916 3300046501 Bacteria 1221
257 Ga0495606_0061171 3300046507 Bacteria 2409
258 Ga0495608_0035039 3300046511 Bacteria 3387
259 Ga0495608_0465030 3300046511 Bacteria 768
260 Ga0495628_0039488 3300046516 Bacteria 3775
261 Ga0495631_0018719 3300046518 Bacteria 3257
262 Ga0495644_0013263 3300046523 Bacteria 3165
263 Ga0495652_0174122 3300046529 Bacteria 1658
264 Ga0495586_0065547 3300046535 Bacteria 1980
265 Ga0495587_0031118 3300046536 Bacteria 3233
266 Ga0495645_0005700 3300046543 Bacteria 8579
267 Ga0495633_0011240 3300046558 Bacteria 4839
268 Ga0495667_0005487 3300046559 Bacteria 8568
269 Ga0495656_0021127 3300046615 Bacteria 2532
270 Ga0495661_0040013 3300046665 Bacteria 2910
271 Ga0495657_0096089 3300046675 Bacteria 1893
272 Ga0495599_0004640 3300046678 Bacteria 8145
273 Ga0495623_0043789 3300046679 Bacteria 2846
274 Ga0495646_0018380 3300046680 Bacteria 4428
275 Ga0495669_0000587 3300046684 Bacteria 16114
276 Ga0495670_0016536 3300046691 Bacteria 3627
277 Ga0495600_0029111 3300046809 Bacteria 3575
278 Ga0495581_0042409 3300047315 Bacteria 2633
279 Ga0495604_0101588 3300047317 Bacteria 2112
280 Ga0495674_0032139 3300047319 Bacteria 4763
281 Ga0495680_0044249 3300047322 Bacteria 3521
282 Ga0495680_0350413 3300047322 Bacteria 1028
283 Ga0495675_0007691 3300047444 Bacteria 6647
284 Ga0495684_0032203 3300047471 Bacteria 4024
285 Ga0495684_0151011 3300047471 Bacteria 1737
286 Ga0495684_0472072 3300047471 Bacteria 868
287 Ga0495593_0025009 3300047673 Bacteria 3304
288 Ga0495602_0013442 3300048088 Bacteria 8368
289 Ga0495614_0024287 3300048089 Bacteria 2618
290 Ga0495614_0281995 3300048089 Bacteria 765
291 Ga0496102_0179412 3300048905 Bacteria 1995
292 Ga0496106_0123057 3300048909 Bacteria 2029
293 Ga0496106_0309193 3300048909 Bacteria 1268
294 Ga0496110_0973985 3300048913 Bacteria 755
295 Ga0496112_0915718 3300048915 Bacteria 798
296 Ga0496113_0481489 3300048916 Bacteria 997
297 Ga0496114_0034082 3300048917 Bacteria 4199
298 Ga0496115_0417413 3300048918 Bacteria 1087
299 Ga0496122_0001273 3300048925 Bacteria 41927
300 Ga0496123_0000482 3300048926 Bacteria 69205
301 Ga0496125_0027298 3300048928 Bacteria 5179
302 Ga0496126_0371942 3300048929 Bacteria 1165
303 Ga0501034_0006528 3300049571 Bacteria 12537
304 Ga0501034_0373807 3300049571 Bacteria 1351
305 Ga0501046_0131985 3300049580 Bacteria 1894
306 Ga0501047_0256227 3300049581 Bacteria 1598
307 Ga0501070_0028516 3300049586 Bacteria 4683
308 Ga0501070_0138571 3300049586 Bacteria 2009
309 Ga0501070_0181988 3300049586 Bacteria 1729
310 Ga0501071_0678321 3300049587 Bacteria 793
311 Ga0501073_0414937 3300049589 Unclassified 930
312 Ga0501074_0062044 3300049590 Bacteria 2693
313 Ga0501075_0053972 3300049591 Bacteria 3022
314 Ga0501076_0294959 3300049592 Bacteria 1329
315 Ga0501079_0002721 3300049741 Bacteria 12883
316 Ga0501080_0005378 3300049742 Bacteria 11419
317 Ga0501080_0524707 3300049742 Bacteria 1056
318 Ga0501083_0045929 3300049744 Bacteria 2954
319 Ga0501044_0014293 3300049823 Bacteria 8571
320 Ga0501044_0510891 3300049823 Bacteria 1102
321 nmdc:mga06r32_523511_c1 3300050510 Bacteria 1161
322 nmdc:mga08y16_171698_c1 3300050511 Bacteria 2252
323 nmdc:mga0rr50_430433_c1 3300050513 Bacteria 1117
324 nmdc:mga08x19_39817_c1 3300050514 Bacteria 2989
325 nmdc:mga08x19_574392_c1 3300050514 Bacteria 798
326 Ga0495601_0007148 3300053077 Bacteria 6545
327 Ga0495612_0014055 3300053078 Bacteria 3223
328 Ga0495595_0023248 3300053084 Bacteria 2727
329 Ga0495619_0042954 3300053085 Bacteria 2962
330 Ga0495619_0169515 3300053085 Bacteria 1509
331 Ga0501084_0500806 3300054114 Bacteria 1026
332 Ga0501082_0127435 3300060353 Bacteria 2208
333 2923518063 2923516293 Bacteria 3716336
334 2987607183 2987605356 Bacteria 4187822
335 Ga0157375_10005629
336 JGI25165J46597_1000129
337 JGI25165J46597_1001402
338 Ga0070658_10003556
339 Ga0070658_10229250
340 Ga0070683_100018031
341 Ga0070690_100267491
342 Ga0070670_100017731
343 Ga0068869_100341593
344 Ga0070680_100026609
345 Ga0070680_100035886
346 Ga0070680_100103449
347 Ga0070680_100240690
348 Ga0068868_100204752
349 Ga0068868_100806950
350 Ga0070660_100107856
351 Ga0070660_100194835
352 Ga0070660_100483940
353 Ga0070660_100913456
354 Ga0070689_100058977
355 Ga0070691_10028069
356 Ga0070687_100289667
357 Ga0070668_100008146
358 Ga0070668_100236572
359 Ga0070668_100657636
360 Ga0070669_100025403
361 Ga0070669_100224765
362 Ga0070675_100497783
363 Ga0070671_100197879
364 Ga0070674_100957867
365 Ga0070673_100045304
366 Ga0070673_100644465
367 Ga0070688_100080087
368 Ga0070667_100019110
369 Ga0070709_10061754
370 Ga0070709_10303150
371 Ga0070714_100298268
372 Ga0070710_10157254
373 Ga0070711_100267466
374 Ga0070663_100079889
375 Ga0070663_100080790
376 Ga0070663_100085464
377 Ga0070663_100424587
378 Ga0070663_100616633
379 Ga0070662_100078971
380 Ga0070662_100099839
381 Ga0070681_10022423
382 Ga0070681_10023773
383 Ga0070681_10210701
384 Ga0070681_10229012
385 Ga0068867_100015396
386 Ga0068867_100076560
387 Ga0070706_100413105
388 Ga0070698_100001563
389 Ga0070679_100019368
390 Ga0070679_100037498
391 Ga0070679_100047311
392 Ga0070679_100051835
393 Ga0070679_100086935
394 Ga0070679_100230039
395 Ga0070679_100282293
396 Ga0070684_100067044
397 Ga0070684_101001079
398 Ga0070697_100569186
399 Ga0068853_100206889
400 Ga0070696_100340237
401 Ga0070693_100083030
402 Ga0070693_100165498
403 Ga0068855_100225167
404 Ga0068855_100296134
405 Ga0068855_100352675
406 Ga0070664_100284768
407 Ga0068854_100115438
408 Ga0068856_100011137
409 Ga0068856_100718898
410 Ga0068852_100089818
411 Ga0068859_100077429
412 Ga0068859_100323876
413 Ga0068864_100231304
414 Ga0068861_100387113
415 Ga0068870_10068093
416 Ga0068863_100025845
417 Ga0068863_100136998
418 Ga0068858_100187862
419 Ga0068858_100469694
420 Ga0068860_100048494
421 Ga0068862_100240806
422 Ga0081538_10015772
423 Ga0070717_10471883
424 Ga0070712_100010278
425 Ga0070712_100056778
426 Ga0097621_100308579
427 Ga0075428_100043638
428 Ga0075431_100048686
429 Ga0075434_100311487
430 Ga0075434_100633096
431 Ga0075429_100206784
432 Ga0068865_100330231
433 Ga0068865_100356630
434 Ga0075436_100017687
435 Ga0097620_100077436
436 Ga0097620_100323895
437 Ga0075435_100559523
438 Ga0105240_10009932
439 Ga0105240_10028665
440 Ga0111539_10042446
441 Ga0105245_10292832
442 Ga0105247_10028637
443 Ga0105243_10363322
444 Ga0105248_10182179
445 Ga0105248_10363473
446 Ga0105238_10056057
447 Ga0105238_10330662
448 Ga0105238_10787458
449 Ga0105249_10795862
450 Ga0105239_11029527
451 Ga0157370_10013437
452 Ga0157370_10048435
453 Ga0157370_10350355
454 Ga0157369_10094095
455 Ga0157369_10111632
456 Ga0157369_10248814
457 Ga0157378_10057452
458 Ga0163162_10063235
459 Ga0157372_10100400
460 Ga0157372_10539543
461 Ga0157372_10826217
462 Ga0163163_10073485
463 Ga0157379_10029813
464 Ga0163161_10148871
465 Ga0197907_10704936
466 Ga0206352_10610345
467 Ga0206350_10469014
468 Ga0224712_10007956
469 Ga0209233_1000155
470 Ga0209233_1000883
471 Ga0207656_10051252
472 Ga0207710_10047713
473 Ga0207688_10530352
474 Ga0207699_10092729
475 Ga0207699_10144006
476 Ga0207645_10140690
477 Ga0207705_10651291
478 Ga0207707_10033844
479 Ga0207707_10041467
480 Ga0207707_10057476
481 Ga0207707_10059881
482 Ga0207707_10071937
483 Ga0207707_10316779
484 Ga0207693_10110470
485 Ga0207693_10135819
486 Ga0207663_10038109
487 Ga0207660_10019277
488 Ga0207660_10019416
489 Ga0207660_10182008
490 Ga0207660_10253111
491 Ga0207657_10047751
492 Ga0207657_10200050
493 Ga0207657_10377598
494 Ga0207652_10044273
495 Ga0207652_10057675
496 Ga0207652_10094382
497 Ga0207652_10131789
498 Ga0207652_10226689
499 Ga0207652_10229985
500 Ga0207652_10231074
501 Ga0207681_10087146
502 Ga0207694_10265536
503 Ga0207694_10720597
504 Ga0207650_10095710
505 Ga0207687_10236509
506 Ga0207700_10121154
507 Ga0207700_10459223
508 Ga0207664_10269506
509 Ga0207664_10452100
510 Ga0207644_10173136
511 Ga0207644_10488771
512 Ga0207690_10379915
513 Ga0207706_10092888
514 Ga0207706_10100133
515 Ga0207709_10219421
516 Ga0207669_10638008
517 Ga0207704_10278685
518 Ga0207665_10017890
519 Ga0207711_10048249
520 Ga0207711_10098365
521 Ga0207689_10001685
522 Ga0207661_10008781
523 Ga0207679_10341236
524 Ga0207679_10352642
525 Ga0207667_10054221
526 Ga0207667_10166270
527 Ga0207667_10349355
528 Ga0207667_10731972
529 Ga0207651_10210234
530 Ga0207712_10224004
531 Ga0207668_10046628
532 Ga0207668_10427765
533 Ga0207640_10303517
534 Ga0207677_10348162
535 Ga0207703_10075161
536 Ga0207678_10239708
537 Ga0207678_10594428
538 Ga0207702_10020107
539 Ga0207641_10189534
540 Ga0207648_10010951
541 Ga0207648_10100263
542 Ga0207676_10037638
543 Ga0207676_10149036
544 Ga0207674_10057028
545 Ga0207675_100001861
546 Ga0207683_10346693
547 Ga0207428_10501999
548 Ga0268265_10026983
549 Ga0268265_10335524
550 Ga0268264_10010622
551 Ga0265332_10004495
552 Ga0265328_10009616
553 Ga0265331_10003965
554 Ga0265316_10004529
555 Ga0265314_10010253
556 Ga0265342_10009822
557 Ga0373939_0014332
558 Ga0373953_0029649
559 Ga0373956_0123616
560 Ga0373942_0003880
561 Ga0373931_0000344
562 Ga0373933_0060406
563 Ga0373933_0339176
564 Ga0373947_0047944
565 Ga0373937_0116603
566 Ga0373937_0256534
567 Ga0373925_0492113
568 Ga0395900_0076322
569 Ga0395900_0096514
570 Ga0395900_0135174
571 Ga0395898_0069557
572 Ga0395898_0244934
573 Ga0395898_0384499
574 Ga0395905_0113116
575 Ga0395901_0014365
576 Ga0395901_0097857
577 Ga0395901_0222411
578 Ga0395901_0298186
579 Ga0395901_0393142
580 Ga0451576_0348520
581 Ga0495638_0099342
582 Ga0495651_0092909
583 Ga0495653_0220474
584 Ga0495582_0066140
585 Ga0495664_0006203
586 Ga0495585_0018361
587 Ga0495585_0140311
588 Ga0495594_0248454
589 Ga0495596_0000015
590 Ga0495607_0144916
591 Ga0495606_0061171
592 Ga0495608_0035039
593 Ga0495608_0465030
594 Ga0495628_0039488
595 Ga0495631_0018719
596 Ga0495644_0013263
597 Ga0495652_0174122
598 Ga0495586_0065547
599 Ga0495587_0031118
600 Ga0495645_0005700
601 Ga0495633_0011240
602 Ga0495667_0005487
603 Ga0495656_0021127
604 Ga0495661_0040013
605 Ga0495657_0096089
606 Ga0495599_0004640
607 Ga0495623_0043789
608 Ga0495646_0018380
609 Ga0495669_0000587
610 Ga0495670_0016536
611 Ga0495600_0029111
612 Ga0495581_0042409
613 Ga0495604_0101588
614 Ga0495674_0032139
615 Ga0495680_0044249
616 Ga0495680_0350413
617 Ga0495675_0007691
618 Ga0495684_0032203
619 Ga0495684_0151011
620 Ga0495684_0472072
621 Ga0495593_0025009
622 Ga0495602_0013442
623 Ga0495614_0024287
624 Ga0495614_0281995
625 Ga0496102_0179412
626 Ga0496106_0123057
627 Ga0496106_0309193
628 Ga0496110_0973985
629 Ga0496112_0915718
630 Ga0496113_0481489
631 Ga0496114_0034082
632 Ga0496115_0417413
633 Ga0496122_0001273
634 Ga0496123_0000482
635 Ga0496125_0027298
636 Ga0496126_0371942
637 Ga0501034_0006528
638 Ga0501034_0373807
639 Ga0501046_0131985
640 Ga0501047_0256227
641 Ga0501070_0028516
642 Ga0501070_0138571
643 Ga0501070_0181988
644 Ga0501071_0678321
645 Ga0501073_0414937
646 Ga0501074_0062044
647 Ga0501075_0053972
648 Ga0501076_0294959
649 Ga0501079_0002721
650 Ga0501080_0005378
651 Ga0501080_0524707
652 Ga0501083_0045929
653 Ga0501044_0014293
654 Ga0501044_0510891
655 nmdc:mga06r32_523511_c1
656 nmdc:mga08y16_171698_c1
657 nmdc:mga0rr50_430433_c1
658 nmdc:mga08x19_39817_c1
659 nmdc:mga08x19_574392_c1
660 Ga0495601_0007148
661 Ga0495612_0014055
662 Ga0495595_0023248
663 Ga0495619_0042954
664 Ga0495619_0169515
665 Ga0501084_0500806
666 Ga0501082_0127435
667 2923518063
668 2987607183

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03458

Gly_transporter

Glycine transporter

94

169

0.96

PF03458

Gly_transporter

Glycine transporter

8

84

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5h36-assembly1.cif.gz_E crystal structures of the tric trimeric intracellular cation channel orthologue from rhodobacter sphaeroides 0.9542 6 198
5wuf-assembly1.cif.gz_A structural basis for conductance through tric cation channels 0.9525 9 201
5h36-assembly1.cif.gz_E crystal structures of the tric trimeric intracellular cation channel orthologue from rhodobacter sphaeroides 0.9447 6 198
5wuf-assembly1.cif.gz_A structural basis for conductance through tric cation channels 0.9383 9 201
5wtr-assembly2.cif.gz_F crystal structure of a prokaryotic tric channel in 0.5 m kcl 0.9337 4 197
ID Description Score Start End Superfamily
af_P0AFP0_4_80_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.9555 11 81 1.10.10.1740
af_P0AFP0_91_166_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.9465 98 169 1.10.10.1740
af_P0AGM2_4_80_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.9058 10 81 1.10.10.1740
af_P0AFP0_91_166_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.8879 98 169 1.10.10.1740
af_P0AGM2_90_165_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.8741 98 170 1.10.10.1740
ID Description Score Start End GO Terms
AF-A0A535GVG5-F1-model_v4 Trimeric intracellular cation channel family protein 0.9837 4 203 GO:0005886
AF-A0A562VBC5-F1-model_v4 Putative membrane protein YeiH 0.9791 5 202 GO:0005886
AF-A0A3A8K3R2-F1-model_v4 Trimeric intracellular cation channel family protein 0.9775 5 202 GO:0005886
AF-A0A2W6SFX8-F1-model_v4 Glycine transporter domain-containing protein 0.9771 8 202 GO:0005886
AF-A0A370FXM1-F1-model_v4 Putative membrane protein YeiH 0.9771 5 202 GO:0005886

Map