F411764

General Info

Members Datasets Scaffolds Average Seq Length
334 215 668 337

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10037417|Ga0114129_100374175
Length 401
Sequence MTEAFVPVRWGILSTANIAVKKVIPAMQRSPLTQVVGIASRDSNRAQEVAVALGVPRAYGSYDDLLADDEIEAIYNPLPNHLHVPWSIRAADAGKHVLCEKPLALSATQANELLAACRRTGVTIGEAFMVRSHPQWLKVLELVHSNAIGELKLVTGHFSYFKRDPEDIRSHVEYGGGALMDIGCYPITLSRWLFNSEPEEVVGLIERDPDMQVDRLTSAMLRFPNGQATFACGGQLVPYQRMQVFGTRARIEVEIPFNAPPDRPCRVFVDSGRDLSGSDVQTIEFPVVDQYTIQGDRFSQAVRGWGSVPVGLDDAVANMAVIDALFRSAETKRWERPADFVQSRAAEVAAPYSFVRGDAKPPTPRRVDQPSVAAVPLASPPGAQSRQQVVPLAARGFDRKG

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
52 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
53 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
57 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
85 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
127 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
128 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
129 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
130 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
131 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
132 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
133 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
134 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
135 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
136 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
137 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
138 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
139 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
140 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
141 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
142 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
143 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
144 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
145 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
146 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
147 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
148 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
149 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
150 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
151 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
152 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
153 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
154 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
155 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
156 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
157 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
158 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
159 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
160 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
161 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
162 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
163 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
164 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
165 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
166 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
167 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
168 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
169 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
170 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
171 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
172 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
173 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
174 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
175 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
176 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
177 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
178 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
179 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
180 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
181 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
182 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
183 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
184 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
185 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
186 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
187 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
188 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
189 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
190 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
198 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
200 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
201 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
202 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
203 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
204 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
205 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
206 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
207 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
208 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
209 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
210 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
211 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
212 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
213 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
214 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
215 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.7
Metatranscriptomes 0
Isolates 0.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.39
Nodule 0
Rhizoplane 1.5
Rhizosphere 90.72
Stem 0
Stem Tuber 0
Unclassified 2.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10037417 3300009147 Bacteria 6850
2 rootH1_10119946 3300003323 Bacteria 2486
3 Ga0070658_10020393 3300005327 Bacteria 5312
4 Ga0070683_100001076 3300005329 Bacteria 20516
5 Ga0070683_100003542 3300005329 Bacteria 12706
6 Ga0070683_100043844 3300005329 Bacteria 4123
7 Ga0070683_100054770 3300005329 Bacteria 3699
8 Ga0070683_100124184 3300005329 Bacteria 2439
9 Ga0070683_100135956 3300005329 Bacteria 2328
10 Ga0070690_100220941 3300005330 Bacteria 1327
11 Ga0070670_100001873 3300005331 Bacteria 17147
12 Ga0068869_100006163 3300005334 Bacteria 7593
13 Ga0070680_100001234 3300005336 Bacteria 18412
14 Ga0070680_100003147 3300005336 Bacteria 12259
15 Ga0070682_100072930 3300005337 Bacteria 2201
16 Ga0068868_100014294 3300005338 Bacteria 5848
17 Ga0070660_100253386 3300005339 Bacteria 1436
18 Ga0070689_100117008 3300005340 Bacteria 2126
19 Ga0070687_100032433 3300005343 Bacteria 2570
20 Ga0070661_100010512 3300005344 Bacteria 6436
21 Ga0070692_10037944 3300005345 Bacteria 2452
22 Ga0070675_100015245 3300005354 Bacteria 6071
23 Ga0070673_100072790 3300005364 Bacteria 2765
24 Ga0070688_100056932 3300005365 Bacteria 2456
25 Ga0070659_100014637 3300005366 Bacteria 5866
26 Ga0070667_100142307 3300005367 Bacteria 2101
27 Ga0070713_100001130 3300005436 Bacteria 17054
28 Ga0070711_100053522 3300005439 Bacteria 2782
29 Ga0070711_100056752 3300005439 Bacteria 2709
30 Ga0070694_100262058 3300005444 Bacteria 1311
31 Ga0070708_100000075 3300005445 Bacteria 63574
32 Ga0070663_100328674 3300005455 Bacteria 1232
33 Ga0070662_100014875 3300005457 Bacteria 5203
34 Ga0070681_10000825 3300005458 Bacteria 25873
35 Ga0070681_10029007 3300005458 Bacteria 5557
36 Ga0070681_10104336 3300005458 Bacteria 2777
37 Ga0070681_10131214 3300005458 Bacteria 2438
38 Ga0068867_100078325 3300005459 Bacteria 2486
39 Ga0070685_10048143 3300005466 Bacteria 2454
40 Ga0070699_100058283 3300005518 Bacteria 3345
41 Ga0070699_100095801 3300005518 Bacteria 2599
42 Ga0070679_100000638 3300005530 Bacteria 29762
43 Ga0070679_100001921 3300005530 Bacteria 18651
44 Ga0070679_100092972 3300005530 Bacteria 3003
45 Ga0070684_100002202 3300005535 Bacteria 14374
46 Ga0070684_100031554 3300005535 Bacteria 4511
47 Ga0070684_100075449 3300005535 Bacteria 2974
48 Ga0070684_100119762 3300005535 Bacteria 2367
49 Ga0070684_100132599 3300005535 Bacteria 2248
50 Ga0070684_100309356 3300005535 Bacteria 1451
51 Ga0068853_100083779 3300005539 Bacteria 2794
52 Ga0070672_100121258 3300005543 Bacteria 2140
53 Ga0070672_100151817 3300005543 Bacteria 1917
54 Ga0070672_100179772 3300005543 Bacteria 1762
55 Ga0070672_100188655 3300005543 Bacteria 1720
56 Ga0070686_100087972 3300005544 Bacteria 2072
57 Ga0070686_100225396 3300005544 Bacteria 1357
58 Ga0070695_100009068 3300005545 Bacteria 5914
59 Ga0070693_100008421 3300005547 Bacteria 5083
60 Ga0068855_100009835 3300005563 Bacteria 11535
61 Ga0068855_100169494 3300005563 Bacteria 2473
62 Ga0070664_100022836 3300005564 Bacteria 5160
63 Ga0070664_100048468 3300005564 Bacteria 3591
64 Ga0070664_100106829 3300005564 Bacteria 2439
65 Ga0068857_100003549 3300005577 Bacteria 13044
66 Ga0068857_100066361 3300005577 Bacteria 3211
67 Ga0068857_100083254 3300005577 Bacteria 2858
68 Ga0068857_100179320 3300005577 Bacteria 1928
69 Ga0068856_100122906 3300005614 Bacteria 2598
70 Ga0068856_100265496 3300005614 Unclassified 1732
71 Ga0070702_100010975 3300005615 Bacteria 4489
72 Ga0068852_100008517 3300005616 Bacteria 7564
73 Ga0068852_100045209 3300005616 Bacteria 3744
74 Ga0068859_100140712 3300005617 Bacteria 2486
75 Ga0068864_100002631 3300005618 Bacteria 14816
76 Ga0068864_100050344 3300005618 Bacteria 3585
77 Ga0068861_100262542 3300005719 Bacteria 1479
78 Ga0068870_10182665 3300005840 Bacteria 1260
79 Ga0068863_100030444 3300005841 Bacteria 5153
80 Ga0068862_100173909 3300005844 Bacteria 1929
81 Ga0081539_10047041 3300005985 Bacteria 2467
82 Ga0075365_10006790 3300006038 Bacteria 6338
83 Ga0075368_10060598 3300006042 Bacteria 1515
84 Ga0075364_10007319 3300006051 Bacteria 6551
85 Ga0075364_10024250 3300006051 Bacteria 3849
86 Ga0075364_10059896 3300006051 Bacteria 2496
87 Ga0070716_100094047 3300006173 Bacteria 1821
88 Ga0070712_100068446 3300006175 Bacteria 2530
89 Ga0075362_10005927 3300006177 Bacteria 4516
90 Ga0075367_10266913 3300006178 Bacteria 1075
91 Ga0068871_100037053 3300006358 Unclassified 3887
92 Ga0075430_100095156 3300006846 Bacteria 2490
93 Ga0075431_100124799 3300006847 Unclassified 2657
94 Ga0075434_100590048 3300006871 Bacteria 1130
95 Ga0075429_100096005 3300006880 Bacteria 2586
96 Ga0097620_100140718 3300006931 Bacteria 2486
97 Ga0111539_10087329 3300009094 Bacteria 3664
98 Ga0111539_10291855 3300009094 Bacteria 1898
99 Ga0105245_10012272 3300009098 Bacteria 7455
100 Ga0105245_10152988 3300009098 Bacteria 2183
101 Ga0105243_10541348 3300009148 Bacteria 1111
102 Ga0105241_10002618 3300009174 Bacteria 13479
103 Ga0105242_10024042 3300009176 Bacteria 4809
104 Ga0105248_10004238 3300009177 Bacteria 15867
105 Ga0105248_10067151 3300009177 Bacteria 4026
106 Ga0105248_10163504 3300009177 Bacteria 2510
107 Ga0105248_10355145 3300009177 Bacteria 1650
108 Ga0105238_10005925 3300009551 Bacteria 12116
109 Ga0105238_10020712 3300009551 Bacteria 6697
110 Ga0105249_10077581 3300009553 Bacteria 3081
111 Ga0105239_10024127 3300010375 Bacteria 6699
112 Ga0157373_10027653 3300013100 Bacteria 4092
113 Ga0157371_10040434 3300013102 Bacteria 3330
114 Ga0157370_10000311 3300013104 Bacteria 60937
115 Ga0157369_10496526 3300013105 Bacteria 1263
116 Ga0157374_10129947 3300013296 Bacteria 2437
117 Ga0157378_10078809 3300013297 Bacteria 2973
118 Ga0157378_10517136 3300013297 Bacteria 1195
119 Ga0157372_10001096 3300013307 Bacteria 29445
120 Ga0157372_10008196 3300013307 Bacteria 11104
121 Ga0157372_10041849 3300013307 Bacteria 5065
122 Ga0157372_10120880 3300013307 Bacteria 3008
123 Ga0157375_10016575 3300013308 Bacteria 6625
124 Ga0157375_10043717 3300013308 Bacteria 4347
125 Ga0163163_10019406 3300014325 Bacteria 6386
126 Ga0157377_10003855 3300014745 Bacteria 6825
127 Ga0157376_10123380 3300014969 Bacteria 2300
128 Ga0213876_10001408 3300021384 Bacteria 14984
129 Ga0209564_1013491 3300025295 Bacteria 3465
130 Ga0207642_10105561 3300025899 Bacteria 1424
131 Ga0207699_10002760 3300025906 Bacteria 8300
132 Ga0207699_10162230 3300025906 Bacteria 1489
133 Ga0207645_10161097 3300025907 Bacteria 1468
134 Ga0207643_10021878 3300025908 Bacteria 3518
135 Ga0207705_10104891 3300025909 Bacteria 2083
136 Ga0207684_10089093 3300025910 Bacteria 2629
137 Ga0207707_10000714 3300025912 Bacteria 32936
138 Ga0207707_10020099 3300025912 Bacteria 5828
139 Ga0207707_10056877 3300025912 Bacteria 3404
140 Ga0207707_10092865 3300025912 Bacteria 2636
141 Ga0207693_10061007 3300025915 Bacteria 2954
142 Ga0207660_10006905 3300025917 Bacteria 7348
143 Ga0207660_10048254 3300025917 Bacteria 3013
144 Ga0207660_10059503 3300025917 Bacteria 2743
145 Ga0207662_10008055 3300025918 Bacteria 5753
146 Ga0207657_10008047 3300025919 Bacteria 10750
147 Ga0207657_10069436 3300025919 Bacteria 2990
148 Ga0207649_10010647 3300025920 Bacteria 5057
149 Ga0207649_10037961 3300025920 Bacteria 2913
150 Ga0207649_10217443 3300025920 Bacteria 1359
151 Ga0207649_10282593 3300025920 Bacteria 1207
152 Ga0207652_10000326 3300025921 Bacteria 49276
153 Ga0207652_10123524 3300025921 Bacteria 2305
154 Ga0207652_10347875 3300025921 Bacteria 1338
155 Ga0207646_10170625 3300025922 Bacteria 1964
156 Ga0207694_10022241 3300025924 Bacteria 4809
157 Ga0207650_10038893 3300025925 Bacteria 3476
158 Ga0207650_10201039 3300025925 Bacteria 1596
159 Ga0207659_10014452 3300025926 Bacteria 5092
160 Ga0207700_10038882 3300025928 Bacteria 3457
161 Ga0207644_10055356 3300025931 Bacteria 2859
162 Ga0207690_10109298 3300025932 Bacteria 1989
163 Ga0207706_10235004 3300025933 Bacteria 1603
164 Ga0207670_10046877 3300025936 Bacteria 2874
165 Ga0207665_10025753 3300025939 Bacteria 3881
166 Ga0207691_10029009 3300025940 Bacteria 5177
167 Ga0207691_10157919 3300025940 Bacteria 1991
168 Ga0207691_10191930 3300025940 Bacteria 1781
169 Ga0207691_10214604 3300025940 Bacteria 1670
170 Ga0207711_10046554 3300025941 Unclassified 3706
171 Ga0207711_10055896 3300025941 Bacteria 3390
172 Ga0207689_10001254 3300025942 Bacteria 24465
173 Ga0207661_10003952 3300025944 Bacteria 10354
174 Ga0207661_10006519 3300025944 Bacteria 8252
175 Ga0207661_10070438 3300025944 Bacteria 2855
176 Ga0207661_10107420 3300025944 Bacteria 2354
177 Ga0207661_10146742 3300025944 Bacteria 2036
178 Ga0207679_10000942 3300025945 Bacteria 18631
179 Ga0207679_10206972 3300025945 Bacteria 1643
180 Ga0207667_10116003 3300025949 Bacteria 2760
181 Ga0207677_10022220 3300026023 Bacteria 3894
182 Ga0207677_10034214 3300026023 Unclassified 3289
183 Ga0207703_10420580 3300026035 Bacteria 1243
184 Ga0207639_10035828 3300026041 Bacteria 3673
185 Ga0207639_10105729 3300026041 Bacteria 2284
186 Ga0207678_10051407 3300026067 Bacteria 3558
187 Ga0207702_10207479 3300026078 Unclassified 1820
188 Ga0207676_10001224 3300026095 Bacteria 19141
189 Ga0207674_10000356 3300026116 Bacteria 59208
190 Ga0207674_10026496 3300026116 Bacteria 6153
191 Ga0207674_10038220 3300026116 Bacteria 4986
192 Ga0207674_10094765 3300026116 Bacteria 2971
193 Ga0207675_100333768 3300026118 Bacteria 1483
194 Ga0207683_10316940 3300026121 Bacteria 1428
195 Ga0207698_10013421 3300026142 Bacteria 5404
196 Ga0207698_10019751 3300026142 Bacteria 4621
197 Ga0268264_10066872 3300028381 Bacteria 3032
198 Ga0265338_10036836 3300028800 Bacteria 4672
199 Ga0265338_10052901 3300028800 Bacteria 3638
200 Ga0265332_10012492 3300031238 Bacteria 3768
201 Ga0265325_10000988 3300031241 Bacteria 20421
202 Ga0265325_10003675 3300031241 Bacteria 9933
203 Ga0265325_10062463 3300031241 Bacteria 1887
204 Ga0265339_10000974 3300031249 Bacteria 21956
205 Ga0265339_10067614 3300031249 Bacteria 1911
206 Ga0265331_10000369 3300031250 Bacteria 46797
207 Ga0265331_10034989 3300031250 Bacteria 2474
208 Ga0265316_10156404 3300031344 Bacteria 1706
209 Ga0265313_10000760 3300031595 Bacteria 32857
210 Ga0265314_10000819 3300031711 Bacteria 36997
211 Ga0265314_10028872 3300031711 Bacteria 4128
212 Ga0265342_10010826 3300031712 Bacteria 6279
213 Ga0307410_10073084 3300031852 Bacteria 2384
214 Ga0307410_10238553 3300031852 Bacteria 1408
215 Ga0307409_100061660 3300031995 Bacteria 2932
216 Ga0307409_100098536 3300031995 Bacteria 2418
217 Ga0373934_0006982 3300035086 Bacteria 4188
218 Ga0373934_0009713 3300035086 Bacteria 3609
219 Ga0373953_0010629 3300035117 Bacteria 3210
220 Ga0373954_0027528 3300035118 Bacteria 2610
221 Ga0373956_0039167 3300035119 Bacteria 2100
222 Ga0373957_0070517 3300035120 Bacteria 1366
223 Ga0373955_0009410 3300035172 Bacteria 4571
224 Ga0373955_0141616 3300035172 Bacteria 1410
225 Ga0373931_0024330 3300035691 Bacteria 3067
226 Ga0373927_0016325 3300035695 Bacteria 4900
227 Ga0373927_0034795 3300035695 Bacteria 3276
228 Ga0373933_0031628 3300035724 Bacteria 3070
229 Ga0373947_0013587 3300035725 Bacteria 4665
230 Ga0373937_0000329 3300036401 Bacteria 45063
231 Ga0373937_0011138 3300036401 Bacteria 7882
232 Ga0373937_0013661 3300036401 Bacteria 7156
233 Ga0316584_0035903 3300036712 Bacteria 3677
234 Ga0316584_0037063 3300036712 Bacteria 3621
235 Ga0373925_0030152 3300037068 Bacteria 3980
236 Ga0400483_130692 3300039062 Bacteria 2371
237 Ga0400483_152227 3300039062 Bacteria 1682
238 Ga0436365_1041616 3300039437 Bacteria 111595
239 Ga0453683_0005941 3300044673 Bacteria 8422
240 Ga0466963_0078366 3300044694 Bacteria 2234
241 Ga0495592_0054111 3300046454 Bacteria 2975
242 Ga0495629_0010919 3300046459 Bacteria 6606
243 Ga0495629_0014239 3300046459 Bacteria 5728
244 Ga0495629_0109127 3300046459 Bacteria 1930
245 Ga0495651_0008242 3300046462 Bacteria 7987
246 Ga0495651_0019054 3300046462 Bacteria 5317
247 Ga0495653_0025903 3300046463 Bacteria 4706
248 Ga0495580_0057267 3300046472 Bacteria 2743
249 Ga0495582_0014815 3300046473 Bacteria 4284
250 Ga0495594_0001872 3300046499 Bacteria 10948
251 Ga0495594_0039240 3300046499 Bacteria 2589
252 Ga0495628_0048682 3300046516 Bacteria 3359
253 Ga0495628_0065257 3300046516 Bacteria 2848
254 Ga0495628_0137084 3300046516 Bacteria 1869
255 Ga0495648_0063056 3300046524 Bacteria 2191
256 Ga0495652_0001853 3300046529 Bacteria 22468
257 Ga0495652_0112603 3300046529 Bacteria 2186
258 Ga0495665_0039408 3300046531 Bacteria 2517
259 Ga0495665_0041147 3300046531 Bacteria 2460
260 Ga0495587_0000927 3300046536 Bacteria 19295
261 Ga0495587_0003121 3300046536 Bacteria 11084
262 Ga0495645_0000527 3300046543 Bacteria 26354
263 Ga0495645_0021294 3300046543 Bacteria 4685
264 Ga0495645_0040128 3300046543 Bacteria 3415
265 Ga0495667_0002181 3300046559 Bacteria 13083
266 Ga0495667_0034764 3300046559 Bacteria 3369
267 Ga0495635_0031392 3300046663 Bacteria 3689
268 Ga0495599_0001939 3300046678 Bacteria 11986
269 Ga0495599_0030724 3300046678 Bacteria 3372
270 Ga0495623_0030507 3300046679 Bacteria 3468
271 Ga0495646_0040070 3300046680 Bacteria 2886
272 Ga0495658_0026417 3300046683 Bacteria 3112
273 Ga0495613_0073207 3300046689 Bacteria 2497
274 Ga0495624_0006215 3300046690 Bacteria 8488
275 Ga0495600_0029023 3300046809 Bacteria 3581
276 Ga0495600_0033070 3300046809 Bacteria 3357
277 Ga0495581_0090473 3300047315 Bacteria 1775
278 Ga0495604_0009999 3300047317 Bacteria 7510
279 Ga0495674_0014521 3300047319 Bacteria 7369
280 Ga0495674_0053234 3300047319 Bacteria 3559
281 Ga0495674_0053720 3300047319 Bacteria 3540
282 Ga0495672_0020165 3300047320 Bacteria 4376
283 Ga0495675_0003206 3300047444 Bacteria 9835
284 Ga0495675_0016278 3300047444 Bacteria 4704
285 Ga0495675_0086378 3300047444 Bacteria 1972
286 Ga0495684_0009001 3300047471 Bacteria 7708
287 Ga0495684_0023196 3300047471 Bacteria 4771
288 Ga0495593_0007537 3300047673 Bacteria 6363
289 Ga0495602_0006357 3300048088 Bacteria 12388
290 Ga0495602_0343668 3300048088 Bacteria 1079
291 Ga0496100_0073235 3300048903 Bacteria 2292
292 Ga0496108_0426050 3300048911 Bacteria 1159
293 Ga0496112_0003445 3300048915 Bacteria 13068
294 Ga0496112_0019025 3300048915 Bacteria 6474
295 Ga0496113_0012478 3300048916 Bacteria 5711
296 Ga0496117_0002099 3300048920 Bacteria 26226
297 Ga0496121_0187012 3300048924 Bacteria 1489
298 Ga0501032_0047062 3300049569 Bacteria 2914
299 Ga0501033_0165878 3300049570 Bacteria 1588
300 Ga0501036_0045213 3300049572 Bacteria 3731
301 Ga0501037_0040085 3300049573 Bacteria 3447
302 Ga0501037_0176564 3300049573 Bacteria 1517
303 Ga0501038_0057956 3300049574 Bacteria 3323
304 Ga0501046_0062230 3300049580 Bacteria 2917
305 Ga0501047_0017609 3300049581 Bacteria 6846
306 Ga0501047_0075469 3300049581 Bacteria 3244
307 Ga0501047_0149179 3300049581 Bacteria 2215
308 Ga0501257_009018 3300049686 Bacteria 2249
309 Ga0501035_0001580 3300049822 Bacteria 23148
310 Ga0501035_0207449 3300049822 Bacteria 1678
311 Ga0501044_0003256 3300049823 Bacteria 18261
312 Ga0501044_0017096 3300049823 Bacteria 7783
313 Ga0501044_0164755 3300049823 Bacteria 2191
314 nmdc:mga03683_65442_c1 3300050489 Bacteria 1544
315 nmdc:mga03n38_87631_c1 3300050490 Bacteria 1476
316 nmdc:mga00v17_246801_c1 3300050491 Bacteria 1158
317 nmdc:mga00v17_25911_c1 3300050491 Bacteria 3411
318 nmdc:mga00v17_79295_c1 3300050491 Bacteria 2048
319 nmdc:mga0yw44_150574_c1 3300050492 Bacteria 1517
320 nmdc:mga0yw44_21149_c1 3300050492 Bacteria 3625
321 nmdc:mga0yw44_8334_c1 3300050492 Bacteria 5155
322 nmdc:mga06z11_33196_c2 3300050494 Bacteria 1819
323 nmdc:mga06z11_42856_c1 3300050494 Bacteria 2273
324 nmdc:mga09592_226674_c1 3300050508 Bacteria 1619
325 nmdc:mga0qj67_150860_c1 3300050509 Bacteria 1886
326 nmdc:mga06r32_600190_c1 3300050510 Bacteria 1072
327 nmdc:mga08y16_96171_c1 3300050511 Bacteria 3084
328 nmdc:mga0n895_522693_c1 3300050512 Bacteria 1194
329 Ga0495601_0032639 3300053077 Bacteria 3242
330 Ga0495612_0046643 3300053078 Bacteria 1775
331 Ga0495595_0025593 3300053084 Bacteria 2617
332 Ga0495619_0053481 3300053085 Bacteria 2671
333 Ga0501084_0148523 3300054114 Unclassified 1975
334 2894817732 2894817345 Bacteria 4892941
335 Ga0114129_10037417
336 rootH1_10119946
337 Ga0070658_10020393
338 Ga0070683_100001076
339 Ga0070683_100003542
340 Ga0070683_100043844
341 Ga0070683_100054770
342 Ga0070683_100124184
343 Ga0070683_100135956
344 Ga0070690_100220941
345 Ga0070670_100001873
346 Ga0068869_100006163
347 Ga0070680_100001234
348 Ga0070680_100003147
349 Ga0070682_100072930
350 Ga0068868_100014294
351 Ga0070660_100253386
352 Ga0070689_100117008
353 Ga0070687_100032433
354 Ga0070661_100010512
355 Ga0070692_10037944
356 Ga0070675_100015245
357 Ga0070673_100072790
358 Ga0070688_100056932
359 Ga0070659_100014637
360 Ga0070667_100142307
361 Ga0070713_100001130
362 Ga0070711_100053522
363 Ga0070711_100056752
364 Ga0070694_100262058
365 Ga0070708_100000075
366 Ga0070663_100328674
367 Ga0070662_100014875
368 Ga0070681_10000825
369 Ga0070681_10029007
370 Ga0070681_10104336
371 Ga0070681_10131214
372 Ga0068867_100078325
373 Ga0070685_10048143
374 Ga0070699_100058283
375 Ga0070699_100095801
376 Ga0070679_100000638
377 Ga0070679_100001921
378 Ga0070679_100092972
379 Ga0070684_100002202
380 Ga0070684_100031554
381 Ga0070684_100075449
382 Ga0070684_100119762
383 Ga0070684_100132599
384 Ga0070684_100309356
385 Ga0068853_100083779
386 Ga0070672_100121258
387 Ga0070672_100151817
388 Ga0070672_100179772
389 Ga0070672_100188655
390 Ga0070686_100087972
391 Ga0070686_100225396
392 Ga0070695_100009068
393 Ga0070693_100008421
394 Ga0068855_100009835
395 Ga0068855_100169494
396 Ga0070664_100022836
397 Ga0070664_100048468
398 Ga0070664_100106829
399 Ga0068857_100003549
400 Ga0068857_100066361
401 Ga0068857_100083254
402 Ga0068857_100179320
403 Ga0068856_100122906
404 Ga0068856_100265496
405 Ga0070702_100010975
406 Ga0068852_100008517
407 Ga0068852_100045209
408 Ga0068859_100140712
409 Ga0068864_100002631
410 Ga0068864_100050344
411 Ga0068861_100262542
412 Ga0068870_10182665
413 Ga0068863_100030444
414 Ga0068862_100173909
415 Ga0081539_10047041
416 Ga0075365_10006790
417 Ga0075368_10060598
418 Ga0075364_10007319
419 Ga0075364_10024250
420 Ga0075364_10059896
421 Ga0070716_100094047
422 Ga0070712_100068446
423 Ga0075362_10005927
424 Ga0075367_10266913
425 Ga0068871_100037053
426 Ga0075430_100095156
427 Ga0075431_100124799
428 Ga0075434_100590048
429 Ga0075429_100096005
430 Ga0097620_100140718
431 Ga0111539_10087329
432 Ga0111539_10291855
433 Ga0105245_10012272
434 Ga0105245_10152988
435 Ga0105243_10541348
436 Ga0105241_10002618
437 Ga0105242_10024042
438 Ga0105248_10004238
439 Ga0105248_10067151
440 Ga0105248_10163504
441 Ga0105248_10355145
442 Ga0105238_10005925
443 Ga0105238_10020712
444 Ga0105249_10077581
445 Ga0105239_10024127
446 Ga0157373_10027653
447 Ga0157371_10040434
448 Ga0157370_10000311
449 Ga0157369_10496526
450 Ga0157374_10129947
451 Ga0157378_10078809
452 Ga0157378_10517136
453 Ga0157372_10001096
454 Ga0157372_10008196
455 Ga0157372_10041849
456 Ga0157372_10120880
457 Ga0157375_10016575
458 Ga0157375_10043717
459 Ga0163163_10019406
460 Ga0157377_10003855
461 Ga0157376_10123380
462 Ga0213876_10001408
463 Ga0209564_1013491
464 Ga0207642_10105561
465 Ga0207699_10002760
466 Ga0207699_10162230
467 Ga0207645_10161097
468 Ga0207643_10021878
469 Ga0207705_10104891
470 Ga0207684_10089093
471 Ga0207707_10000714
472 Ga0207707_10020099
473 Ga0207707_10056877
474 Ga0207707_10092865
475 Ga0207693_10061007
476 Ga0207660_10006905
477 Ga0207660_10048254
478 Ga0207660_10059503
479 Ga0207662_10008055
480 Ga0207657_10008047
481 Ga0207657_10069436
482 Ga0207649_10010647
483 Ga0207649_10037961
484 Ga0207649_10217443
485 Ga0207649_10282593
486 Ga0207652_10000326
487 Ga0207652_10123524
488 Ga0207652_10347875
489 Ga0207646_10170625
490 Ga0207694_10022241
491 Ga0207650_10038893
492 Ga0207650_10201039
493 Ga0207659_10014452
494 Ga0207700_10038882
495 Ga0207644_10055356
496 Ga0207690_10109298
497 Ga0207706_10235004
498 Ga0207670_10046877
499 Ga0207665_10025753
500 Ga0207691_10029009
501 Ga0207691_10157919
502 Ga0207691_10191930
503 Ga0207691_10214604
504 Ga0207711_10046554
505 Ga0207711_10055896
506 Ga0207689_10001254
507 Ga0207661_10003952
508 Ga0207661_10006519
509 Ga0207661_10070438
510 Ga0207661_10107420
511 Ga0207661_10146742
512 Ga0207679_10000942
513 Ga0207679_10206972
514 Ga0207667_10116003
515 Ga0207677_10022220
516 Ga0207677_10034214
517 Ga0207703_10420580
518 Ga0207639_10035828
519 Ga0207639_10105729
520 Ga0207678_10051407
521 Ga0207702_10207479
522 Ga0207676_10001224
523 Ga0207674_10000356
524 Ga0207674_10026496
525 Ga0207674_10038220
526 Ga0207674_10094765
527 Ga0207675_100333768
528 Ga0207683_10316940
529 Ga0207698_10013421
530 Ga0207698_10019751
531 Ga0268264_10066872
532 Ga0265338_10036836
533 Ga0265338_10052901
534 Ga0265332_10012492
535 Ga0265325_10000988
536 Ga0265325_10003675
537 Ga0265325_10062463
538 Ga0265339_10000974
539 Ga0265339_10067614
540 Ga0265331_10000369
541 Ga0265331_10034989
542 Ga0265316_10156404
543 Ga0265313_10000760
544 Ga0265314_10000819
545 Ga0265314_10028872
546 Ga0265342_10010826
547 Ga0307410_10073084
548 Ga0307410_10238553
549 Ga0307409_100061660
550 Ga0307409_100098536
551 Ga0373934_0006982
552 Ga0373934_0009713
553 Ga0373953_0010629
554 Ga0373954_0027528
555 Ga0373956_0039167
556 Ga0373957_0070517
557 Ga0373955_0009410
558 Ga0373955_0141616
559 Ga0373931_0024330
560 Ga0373927_0016325
561 Ga0373927_0034795
562 Ga0373933_0031628
563 Ga0373947_0013587
564 Ga0373937_0000329
565 Ga0373937_0011138
566 Ga0373937_0013661
567 Ga0316584_0035903
568 Ga0316584_0037063
569 Ga0373925_0030152
570 Ga0400483_130692
571 Ga0400483_152227
572 Ga0436365_1041616
573 Ga0453683_0005941
574 Ga0466963_0078366
575 Ga0495592_0054111
576 Ga0495629_0010919
577 Ga0495629_0014239
578 Ga0495629_0109127
579 Ga0495651_0008242
580 Ga0495651_0019054
581 Ga0495653_0025903
582 Ga0495580_0057267
583 Ga0495582_0014815
584 Ga0495594_0001872
585 Ga0495594_0039240
586 Ga0495628_0048682
587 Ga0495628_0065257
588 Ga0495628_0137084
589 Ga0495648_0063056
590 Ga0495652_0001853
591 Ga0495652_0112603
592 Ga0495665_0039408
593 Ga0495665_0041147
594 Ga0495587_0000927
595 Ga0495587_0003121
596 Ga0495645_0000527
597 Ga0495645_0021294
598 Ga0495645_0040128
599 Ga0495667_0002181
600 Ga0495667_0034764
601 Ga0495635_0031392
602 Ga0495599_0001939
603 Ga0495599_0030724
604 Ga0495623_0030507
605 Ga0495646_0040070
606 Ga0495658_0026417
607 Ga0495613_0073207
608 Ga0495624_0006215
609 Ga0495600_0029023
610 Ga0495600_0033070
611 Ga0495581_0090473
612 Ga0495604_0009999
613 Ga0495674_0014521
614 Ga0495674_0053234
615 Ga0495674_0053720
616 Ga0495672_0020165
617 Ga0495675_0003206
618 Ga0495675_0016278
619 Ga0495675_0086378
620 Ga0495684_0009001
621 Ga0495684_0023196
622 Ga0495593_0007537
623 Ga0495602_0006357
624 Ga0495602_0343668
625 Ga0496100_0073235
626 Ga0496108_0426050
627 Ga0496112_0003445
628 Ga0496112_0019025
629 Ga0496113_0012478
630 Ga0496117_0002099
631 Ga0496121_0187012
632 Ga0501032_0047062
633 Ga0501033_0165878
634 Ga0501036_0045213
635 Ga0501037_0040085
636 Ga0501037_0176564
637 Ga0501038_0057956
638 Ga0501046_0062230
639 Ga0501047_0017609
640 Ga0501047_0075469
641 Ga0501047_0149179
642 Ga0501257_009018
643 Ga0501035_0001580
644 Ga0501035_0207449
645 Ga0501044_0003256
646 Ga0501044_0017096
647 Ga0501044_0164755
648 nmdc:mga03683_65442_c1
649 nmdc:mga03n38_87631_c1
650 nmdc:mga00v17_246801_c1
651 nmdc:mga00v17_25911_c1
652 nmdc:mga00v17_79295_c1
653 nmdc:mga0yw44_150574_c1
654 nmdc:mga0yw44_21149_c1
655 nmdc:mga0yw44_8334_c1
656 nmdc:mga06z11_33196_c2
657 nmdc:mga06z11_42856_c1
658 nmdc:mga09592_226674_c1
659 nmdc:mga0qj67_150860_c1
660 nmdc:mga06r32_600190_c1
661 nmdc:mga08y16_96171_c1
662 nmdc:mga0n895_522693_c1
663 Ga0495601_0032639
664 Ga0495612_0046643
665 Ga0495595_0025593
666 Ga0495619_0053481
667 Ga0501084_0148523
668 2894817732

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22725

GFO_IDH_MocA_C3

GFO/IDH/MocA C-terminal domain

136

252

0.93

PF01408

GFO_IDH_MocA

Oxidoreductase family, NAD-binding Rossmann fold

8

128

0.9

PF02894

GFO_IDH_MocA_C

Oxidoreductase family, C-terminal alpha/beta domain

140

336

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4had-assembly1.cif.gz_D crystal structure of probable oxidoreductase protein from rhizobium etli cfn 42 0.9681 5 334
4had-assembly1.cif.gz_C crystal structure of probable oxidoreductase protein from rhizobium etli cfn 42 0.968 5 334
4had-assembly1.cif.gz_C crystal structure of probable oxidoreductase protein from rhizobium etli cfn 42 0.962 5 334
4had-assembly1.cif.gz_D crystal structure of probable oxidoreductase protein from rhizobium etli cfn 42 0.962 5 334
3evn-assembly1.cif.gz_A crystal structure of putative oxidoreductase from streptococcus agalactiae 2603v/r 0.9355 5 325
ID Description Score Start End Superfamily
af_D4A903_1_122_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9581 5 123 3.40.50.720
3e9mA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9548 4 122 3.40.50.720
3rbvA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9488 5 126 3.40.50.720
4hadB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9456 5 121 3.40.50.720
4hadD02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.945 124 334 3.30.360.10
ID Description Score Start End GO Terms
AF-A0A659YI87-F1-model_v4 deleted 0.9826 43 233
AF-A0A659YI87-F1-model_v4 deleted 0.9725 43 233
AF-A0A351MHT5-F1-model_v4 Dehydrogenase 0.9664 4 133 GO:0000166
GO:0016491
AF-A0A7C5JT62-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9581 1 227 GO:0000166
GO:0016491
AF-A0A529TBE7-F1-model_v4 deleted 0.9573 59 334

Map