F411686

General Info

Members Datasets Scaffolds Average Seq Length
334 195 668 728

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_100020884|Ga0070707_1000208844
Length 815
Sequence MADLSVDYAADFGTLPPSGESRYVTAGGISVTRTATPFEPGRLAEVTRQADRRRGGTFSSGMEYPGRYSRWHMGYVDPCLELTATGRELTATALTERGAVILPAVGAALRRAGEEIGSGPVPDGASGAVTVRVPEAAGFVPEEERSRRPTVFSAVREVIALFAGPDEHLGLYGAFGYDLAFQFEPLRLRHDRRDTGGAGXXXXARRRRDLVLHLPDELYVIDRKRETALRYGYEFAVGGRTTADLDRRAPWPAPGAAGESGQGAFVGTDQVPPDPEPGAYARVVEQARERFAAGDLFEVVPSHEFWARCGSPAAFYERLRRRNPAPYEFFLNLGEDEYLVGASPEMYVRVTGDRVETCPIAGTVARGADALADAENIRALLTSPKEESELTMCTDVDRNDKSRICVPGSVRVIGRRQIELYSRVIHTVDHVEGRLRPGFDALDAFLTHMWAVTVTGAPKAWAMQFIEDHEASPRGWYGGAVGVLGFDGSMNTGLTLRTAHIRGGVASVRTGATLLFDSDPAAEETETRLKARALLEVLAETAADPLAAGKDRQAQRTSRGGSPGRAPVSAEAGPPGAGMRVLLVDHQDSFVHTLAGYFARHGASVTTLRYGFEPARLDEYAPDLVVLSPGPGRPADFGCSRLLDELDARNLAALGVCLGLQAMVEHAGGTLSLLATPAHGKPAAVRVTGGDLFAGLPAEFTAGRYHSLHTTPDQAGAGFAVTAVTSDGGRAANGSAAGREVVMAIENPAAGRWGVQFHPESILTASDDVGAAIIANVLGLCRARNIMVDNSGKQRDSTSAISNTGAFSNTWLRST

Samples

Sample ID Description Type Environment
1 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
2 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
3 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
4 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
5 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
6 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
29 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
30 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
31 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
32 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
33 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
39 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
40 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
41 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
42 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
43 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
44 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
45 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
47 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
49 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
74 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
76 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
77 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
78 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
79 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
80 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
81 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
82 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
83 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
84 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
85 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
86 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
87 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
88 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
89 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
90 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
91 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
92 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
93 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
94 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
95 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
96 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
97 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
98 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
99 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
100 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
101 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
102 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
103 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
104 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
105 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
106 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
107 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
108 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
109 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
110 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
111 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
112 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
113 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
114 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
115 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
116 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
117 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
118 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
119 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
120 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
121 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
122 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
123 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
124 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
125 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
126 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
127 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
128 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
129 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
130 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
131 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
132 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
133 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
134 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
135 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
136 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
137 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
138 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
139 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
140 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
141 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
142 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
143 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
144 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
145 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
146 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
147 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
148 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
149 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
150 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
151 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
152 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
153 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
154 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
155 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
156 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
157 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
158 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
159 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
160 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
161 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
162 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
163 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
164 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
165 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
166 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
172 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
173 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
174 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
175 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
176 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
177 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
178 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
179 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
180 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
181 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
182 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
183 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
184 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
185 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
186 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
187 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
188 2891562705 Microbispora tritici MT50 Isolate Unclassified
189 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
190 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
191 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
192 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
193 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
194 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified
195 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.91
Metatranscriptomes 0.6
Isolates 4.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.3
Nodule 0
Rhizoplane 5.39
Rhizosphere 87.72
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070707_100020884 3300005468 Bacteria 6181
2 Ga0068868_100083294 3300005338 Bacteria 2567
3 Ga0070660_100008647 3300005339 Bacteria 7130
4 Ga0070660_100067199 3300005339 Bacteria 2792
5 Ga0070661_100048354 3300005344 Bacteria 3113
6 Ga0070692_10023803 3300005345 Bacteria 3004
7 Ga0070673_100084366 3300005364 Bacteria 2583
8 Ga0070709_10000275 3300005434 Bacteria 32988
9 Ga0070714_100000637 3300005435 Bacteria 24962
10 Ga0070714_100001636 3300005435 Bacteria 16298
11 Ga0070714_100009433 3300005435 Bacteria 7674
12 Ga0070714_100010392 3300005435 Bacteria 7358
13 Ga0070713_100036083 3300005436 Bacteria 3987
14 Ga0070713_100055391 3300005436 Bacteria 3295
15 Ga0070710_10000036 3300005437 Bacteria 61426
16 Ga0070710_10000421 3300005437 Bacteria 19958
17 Ga0070711_100002524 3300005439 Bacteria 10463
18 Ga0070708_100008639 3300005445 Bacteria 8185
19 Ga0070663_100017439 3300005455 Bacteria 4686
20 Ga0070663_100041779 3300005455 Bacteria 3219
21 Ga0070685_10049240 3300005466 Bacteria 2430
22 Ga0070706_100000827 3300005467 Bacteria 34214
23 Ga0070706_100000837 3300005467 Bacteria 34046
24 Ga0070706_100012874 3300005467 Bacteria 7743
25 Ga0070706_100038735 3300005467 Bacteria 4399
26 Ga0070706_100085173 3300005467 Bacteria 2928
27 Ga0070707_100000884 3300005468 Bacteria 29741
28 Ga0070707_100005124 3300005468 Bacteria 12280
29 Ga0070707_100069482 3300005468 Bacteria 3391
30 Ga0070698_100000449 3300005471 Bacteria 43773
31 Ga0070698_100000835 3300005471 Bacteria 33687
32 Ga0070698_100002668 3300005471 Bacteria 19683
33 Ga0070698_100009354 3300005471 Bacteria 10508
34 Ga0070698_100011209 3300005471 Bacteria 9525
35 Ga0070698_100043080 3300005471 Bacteria 4629
36 Ga0070699_100000709 3300005518 Bacteria 30905
37 Ga0070699_100016803 3300005518 Bacteria 6282
38 Ga0070679_100026959 3300005530 Bacteria 5650
39 Ga0070684_100020605 3300005535 Bacteria 5468
40 Ga0070684_100039098 3300005535 Bacteria 4080
41 Ga0070704_100011039 3300005549 Bacteria 5514
42 Ga0068854_100027187 3300005578 Bacteria 3940
43 Ga0068856_100094144 3300005614 Bacteria 2982
44 Ga0070702_100015315 3300005615 Bacteria 3913
45 Ga0068859_100073031 3300005617 Bacteria 3468
46 Ga0068858_100107891 3300005842 Bacteria 2599
47 Ga0081540_1000004 3300005983 Bacteria 231552
48 Ga0081540_1005697 3300005983 Bacteria 9245
49 Ga0070717_10011664 3300006028 Bacteria 6682
50 Ga0070717_10025832 3300006028 Bacteria 4678
51 Ga0070717_10036076 3300006028 Bacteria 4008
52 Ga0070715_10004563 3300006163 Bacteria 4560
53 Ga0070716_100000065 3300006173 Bacteria 41076
54 Ga0070716_100006540 3300006173 Bacteria 5696
55 Ga0075428_100054998 3300006844 Bacteria 4362
56 Ga0075429_100042906 3300006880 Bacteria 3935
57 Ga0075436_100027840 3300006914 Bacteria 3890
58 Ga0097620_100073029 3300006931 Bacteria 3468
59 Ga0111539_10003709 3300009094 Bacteria 20094
60 Ga0114129_10002729 3300009147 Bacteria 24610
61 Ga0114129_10076855 3300009147 Bacteria 4647
62 Ga0105243_10085394 3300009148 Bacteria 2587
63 Ga0105249_10121086 3300009553 Bacteria 2487
64 Ga0157371_10039687 3300013102 Bacteria 3366
65 Ga0157369_10014369 3300013105 Bacteria 8940
66 Ga0157369_10095854 3300013105 Bacteria 3165
67 Ga0157374_10008687 3300013296 Bacteria 8688
68 Ga0157378_10125523 3300013297 Bacteria 2370
69 Ga0157377_10027265 3300014745 Bacteria 3066
70 Ga0157379_10010743 3300014968 Bacteria 7980
71 Ga0163161_10028575 3300017792 Bacteria 3961
72 Ga0206354_10394616 3300020081 Bacteria 3575
73 Ga0213875_10000242 3300021388 Bacteria 54644
74 Ga0213875_10000557 3300021388 Bacteria 30393
75 Ga0213875_10011916 3300021388 Bacteria 4311
76 Ga0224712_10009860 3300022467 Bacteria 2897
77 Ga0228598_1006665 3300024227 Bacteria 2382
78 Ga0207692_10000092 3300025898 Bacteria 26547
79 Ga0207692_10005639 3300025898 Bacteria 5026
80 Ga0207688_10017705 3300025901 Bacteria 3876
81 Ga0207647_10047490 3300025904 Bacteria 2670
82 Ga0207699_10005363 3300025906 Bacteria 6145
83 Ga0207684_10001051 3300025910 Bacteria 30865
84 Ga0207684_10016626 3300025910 Bacteria 6316
85 Ga0207671_10075830 3300025914 Bacteria 2516
86 Ga0207693_10018977 3300025915 Bacteria 5474
87 Ga0207663_10005069 3300025916 Bacteria 6614
88 Ga0207663_10050435 3300025916 Bacteria 2586
89 Ga0207657_10007929 3300025919 Bacteria 10828
90 Ga0207652_10046166 3300025921 Bacteria 3715
91 Ga0207652_10063621 3300025921 Bacteria 3191
92 Ga0207646_10000437 3300025922 Bacteria 55790
93 Ga0207646_10004933 3300025922 Bacteria 14273
94 Ga0207646_10004957 3300025922 Bacteria 14225
95 Ga0207646_10008588 3300025922 Bacteria 10209
96 Ga0207646_10041079 3300025922 Bacteria 4159
97 Ga0207700_10000317 3300025928 Bacteria 28228
98 Ga0207700_10008827 3300025928 Bacteria 6264
99 Ga0207700_10038864 3300025928 Bacteria 3458
100 Ga0207700_10054269 3300025928 Bacteria 3007
101 Ga0207664_10000137 3300025929 Bacteria 62759
102 Ga0207664_10000603 3300025929 Bacteria 24856
103 Ga0207664_10001441 3300025929 Bacteria 15638
104 Ga0207664_10006530 3300025929 Bacteria 8028
105 Ga0207664_10008695 3300025929 Bacteria 7098
106 Ga0207664_10019073 3300025929 Bacteria 5062
107 Ga0207664_10021825 3300025929 Bacteria 4770
108 Ga0207664_10040395 3300025929 Bacteria 3627
109 Ga0207706_10034910 3300025933 Bacteria 4473
110 Ga0207665_10000254 3300025939 Bacteria 36877
111 Ga0207665_10004874 3300025939 Bacteria 8936
112 Ga0207691_10029764 3300025940 Bacteria 5107
113 Ga0207689_10047602 3300025942 Bacteria 3539
114 Ga0207658_10043003 3300025986 Bacteria 3282
115 Ga0207678_10023030 3300026067 Bacteria 5450
116 Ga0207678_10049232 3300026067 Bacteria 3642
117 Ga0207708_10059627 3300026075 Bacteria 2913
118 Ga0207648_10016530 3300026089 Bacteria 6738
119 Ga0207676_10047053 3300026095 Bacteria 3341
120 Ga0207674_10033124 3300026116 Bacteria 5411
121 Ga0207674_10046347 3300026116 Bacteria 4464
122 Ga0207675_100012094 3300026118 Bacteria 8064
123 Ga0207428_10000283 3300027907 Bacteria 68603
124 Ga0268266_10111664 3300028379 Bacteria 2422
125 Ga0265337_1000514 3300028556 Bacteria 20617
126 Ga0265319_1002615 3300028563 Bacteria 9704
127 Ga0265334_10001236 3300028573 Bacteria 12482
128 Ga0265336_10008342 3300028666 Bacteria 3637
129 Ga0265338_10000997 3300028800 Bacteria 47663
130 Ga0265338_10001906 3300028800 Bacteria 32587
131 Ga0265324_10015301 3300029957 Bacteria 2823
132 Ga0265332_10005904 3300031238 Bacteria 5599
133 Ga0265320_10028030 3300031240 Bacteria 2928
134 Ga0265325_10031414 3300031241 Bacteria 2842
135 Ga0265314_10011503 3300031711 Bacteria 7299
136 Ga0265342_10003816 3300031712 Bacteria 12126
137 Ga0373934_0000035 3300035086 Bacteria 43876
138 Ga0373934_0001477 3300035086 Bacteria 8618
139 Ga0373934_0023664 3300035086 Bacteria 2373
140 Ga0373940_0005793 3300035088 Bacteria 2700
141 Ga0373951_0006971 3300035091 Bacteria 2579
142 Ga0373923_0003006 3300035111 Bacteria 5327
143 Ga0373923_0005591 3300035111 Bacteria 4278
144 Ga0373923_0012912 3300035111 Bacteria 3102
145 Ga0373936_0000928 3300035113 Bacteria 10456
146 Ga0373936_0007252 3300035113 Bacteria 4170
147 Ga0373941_0001312 3300035115 Bacteria 5234
148 Ga0373945_0000161 3300035116 Bacteria 17395
149 Ga0373953_0000048 3300035117 Bacteria 30836
150 Ga0373953_0001216 3300035117 Bacteria 7336
151 Ga0373954_0021793 3300035118 Bacteria 2903
152 Ga0373956_0003348 3300035119 Bacteria 6449
153 Ga0373956_0005993 3300035119 Bacteria 4864
154 Ga0373956_0035452 3300035119 Bacteria 2200
155 Ga0373957_0000003 3300035120 Bacteria 67097
156 Ga0373957_0003160 3300035120 Bacteria 4822
157 Ga0373943_0001371 3300035170 Bacteria 10965
158 Ga0373943_0013423 3300035170 Bacteria 3699
159 Ga0373946_0000157 3300035171 Bacteria 20583
160 Ga0373946_0003327 3300035171 Bacteria 5709
161 Ga0373955_0000083 3300035172 Bacteria 38356
162 Ga0373955_0002916 3300035172 Bacteria 7509
163 Ga0373942_0003554 3300035207 Bacteria 3657
164 Ga0373924_0000124 3300035410 Bacteria 22351
165 Ga0373924_0000249 3300035410 Bacteria 16483
166 Ga0373935_0008791 3300035692 Bacteria 6049
167 Ga0373927_0034946 3300035695 Bacteria 3268
168 Ga0373933_0000001 3300035724 Bacteria 228234
169 Ga0373933_0004513 3300035724 Bacteria 7632
170 Ga0373947_0000001 3300035725 Bacteria 510932
171 Ga0373947_0000869 3300035725 Bacteria 18266
172 Ga0373947_0002445 3300035725 Bacteria 11194
173 Ga0373937_0000033 3300036401 Bacteria 120102
174 Ga0373937_0020581 3300036401 Bacteria 5914
175 Ga0373937_0021887 3300036401 Bacteria 5740
176 Ga0373925_0000009 3300037068 Bacteria 243099
177 Ga0373925_0005533 3300037068 Bacteria 9404
178 Ga0373925_0053674 3300037068 Bacteria 3013
179 Ga0373925_0061070 3300037068 Bacteria 2830
180 Ga0436364_0651483 3300037853 Bacteria 14071
181 Ga0436364_0757195 3300037853 Bacteria 96239
182 Ga0436364_0956908 3300037853 Bacteria 4465
183 Ga0436364_1282495 3300037853 Bacteria 2457
184 Ga0436364_1299779 3300037853 Bacteria 159755
185 Ga0436363_1596727 3300039450 Bacteria 2521
186 Ga0466966_0004274 3300044684 Bacteria 9418
187 Ga0466966_0026113 3300044684 Bacteria 3814
188 Ga0466963_0019595 3300044694 Bacteria 4246
189 Ga0466959_0010646 3300045049 Bacteria 6587
190 Ga0495592_0000002 3300046454 Bacteria 209491
191 Ga0495592_0004474 3300046454 Bacteria 10224
192 Ga0495592_0015064 3300046454 Bacteria 5871
193 Ga0495603_0006862 3300046455 Bacteria 6830
194 Ga0495629_0001025 3300046459 Bacteria 22416
195 Ga0495629_0024715 3300046459 Bacteria 4276
196 Ga0495629_0044787 3300046459 Bacteria 3105
197 Ga0495651_0000002 3300046462 Bacteria 209492
198 Ga0495651_0004163 3300046462 Bacteria 11077
199 Ga0495651_0005979 3300046462 Bacteria 9286
200 Ga0495651_0006347 3300046462 Bacteria 9045
201 Ga0495651_0006863 3300046462 Bacteria 8700
202 Ga0495651_0007461 3300046462 Bacteria 8363
203 Ga0495651_0016894 3300046462 Bacteria 5652
204 Ga0495653_0004963 3300046463 Bacteria 10799
205 Ga0495653_0009655 3300046463 Bacteria 7892
206 Ga0495653_0015481 3300046463 Bacteria 6216
207 Ga0495653_0030530 3300046463 Bacteria 4291
208 Ga0495653_0054159 3300046463 Bacteria 3066
209 Ga0495580_0007398 3300046472 Bacteria 8831
210 Ga0495582_0003247 3300046473 Bacteria 9127
211 Ga0495639_0000178 3300046475 Bacteria 33506
212 Ga0495639_0010567 3300046475 Bacteria 3976
213 Ga0495662_0000896 3300046476 Bacteria 14545
214 Ga0495664_0007037 3300046477 Bacteria 6230
215 Ga0495608_0000027 3300046511 Bacteria 152979
216 Ga0495608_0001626 3300046511 Bacteria 16124
217 Ga0495608_0005385 3300046511 Bacteria 9143
218 Ga0495618_0001032 3300046514 Bacteria 19076
219 Ga0495628_0001429 3300046516 Bacteria 21908
220 Ga0495628_0018685 3300046516 Bacteria 5736
221 Ga0495628_0025453 3300046516 Bacteria 4834
222 Ga0495630_0001021 3300046517 Bacteria 19378
223 Ga0495630_0022569 3300046517 Bacteria 4648
224 Ga0495666_0001034 3300046526 Bacteria 13204
225 Ga0495652_0002179 3300046529 Bacteria 20593
226 Ga0495652_0003958 3300046529 Bacteria 14356
227 Ga0495652_0014759 3300046529 Bacteria 7003
228 Ga0495652_0048654 3300046529 Bacteria 3631
229 Ga0495665_0000624 3300046531 Bacteria 18026
230 Ga0495640_0007437 3300046533 Bacteria 8607
231 Ga0495640_0009620 3300046533 Bacteria 7519
232 Ga0495640_0012150 3300046533 Bacteria 6592
233 Ga0495586_0004433 3300046535 Bacteria 7498
234 Ga0495587_0000013 3300046536 Bacteria 195619
235 Ga0495587_0004563 3300046536 Bacteria 9092
236 Ga0495587_0008911 3300046536 Bacteria 6437
237 Ga0495587_0011394 3300046536 Bacteria 5636
238 Ga0495645_0005027 3300046543 Bacteria 9062
239 Ga0495645_0007474 3300046543 Bacteria 7606
240 Ga0495645_0061711 3300046543 Bacteria 2716
241 Ga0495667_0000016 3300046559 Bacteria 195635
242 Ga0495667_0002000 3300046559 Bacteria 13503
243 Ga0495667_0010865 3300046559 Bacteria 6155
244 Ga0495667_0030370 3300046559 Bacteria 3631
245 Ga0495634_0000635 3300046642 Bacteria 34152
246 Ga0495635_0027094 3300046663 Bacteria 3987
247 Ga0495635_0050309 3300046663 Bacteria 2873
248 Ga0495657_0000014 3300046675 Bacteria 195574
249 Ga0495657_0020994 3300046675 Bacteria 4692
250 Ga0495599_0000006 3300046678 Bacteria 283487
251 Ga0495599_0043129 3300046678 Bacteria 2831
252 Ga0495599_0045495 3300046678 Bacteria 2752
253 Ga0495623_0000042 3300046679 Bacteria 78088
254 Ga0495623_0022062 3300046679 Bacteria 4113
255 Ga0495646_0008859 3300046680 Bacteria 6390
256 Ga0495646_0029765 3300046680 Bacteria 3411
257 Ga0495613_0007686 3300046689 Bacteria 8020
258 Ga0495624_0004976 3300046690 Bacteria 9627
259 Ga0495624_0035246 3300046690 Bacteria 3231
260 Ga0495600_0000498 3300046809 Bacteria 20349
261 Ga0495600_0015256 3300046809 Bacteria 4855
262 Ga0495581_0000108 3300047315 Bacteria 34596
263 Ga0495604_0000015 3300047317 Bacteria 195635
264 Ga0495604_0003632 3300047317 Bacteria 12306
265 Ga0495604_0003706 3300047317 Bacteria 12171
266 Ga0495604_0004559 3300047317 Bacteria 10977
267 Ga0495676_0000849 3300047321 Bacteria 25619
268 Ga0495680_0000009 3300047322 Bacteria 146021
269 Ga0495680_0004307 3300047322 Bacteria 13651
270 Ga0495680_0018291 3300047322 Bacteria 5954
271 Ga0495675_0002183 3300047444 Bacteria 11665
272 Ga0495675_0017996 3300047444 Bacteria 4479
273 Ga0495684_0004367 3300047471 Bacteria 11045
274 Ga0495684_0011655 3300047471 Bacteria 6787
275 Ga0495684_0013956 3300047471 Bacteria 6179
276 Ga0495593_0000581 3300047673 Bacteria 20813
277 Ga0495593_0016761 3300047673 Bacteria 4127
278 Ga0495602_0000013 3300048088 Bacteria 195591
279 Ga0495602_0028869 3300048088 Bacteria 5300
280 Ga0495614_0004184 3300048089 Bacteria 6503
281 Ga0496101_0036694 3300048904 Bacteria 3472
282 Ga0496102_0039437 3300048905 Bacteria 4268
283 Ga0496102_0043781 3300048905 Bacteria 4060
284 Ga0496103_0017098 3300048906 Bacteria 4336
285 Ga0496104_0001661 3300048907 Bacteria 19218
286 Ga0496104_0067823 3300048907 Bacteria 3389
287 Ga0496105_0000697 3300048908 Bacteria 22678
288 Ga0496105_0017549 3300048908 Bacteria 5741
289 Ga0496105_0021197 3300048908 Bacteria 5258
290 Ga0496106_0062167 3300048909 Bacteria 2834
291 Ga0496108_0008242 3300048911 Bacteria 8458
292 Ga0496108_0013255 3300048911 Bacteria 6718
293 Ga0496111_0009286 3300048914 Bacteria 6554
294 Ga0496112_0000365 3300048915 Bacteria 29514
295 Ga0496112_0120875 3300048915 Bacteria 2589
296 Ga0496113_0069226 3300048916 Bacteria 2680
297 Ga0496115_0021386 3300048918 Bacteria 4998
298 Ga0496115_0050900 3300048918 Bacteria 3320
299 Ga0496121_0010579 3300048924 Bacteria 10371
300 Ga0496126_0092945 3300048929 Bacteria 2649
301 Ga0501034_0021699 3300049571 Bacteria 6542
302 Ga0501036_0006434 3300049572 Bacteria 9540
303 Ga0501043_0001199 3300049579 Bacteria 22819
304 Ga0501047_0072181 3300049581 Bacteria 3322
305 Ga0501048_0007951 3300049582 Bacteria 8033
306 Ga0501074_0011389 3300049590 Bacteria 6465
307 nmdc:mga05p37_49155_c1 3300050507 Bacteria 5188
308 nmdc:mga0qj67_18504_c1 3300050509 Bacteria 5310
309 nmdc:mga08y16_2960_c1 3300050511 Bacteria 17504
310 nmdc:mga0n895_37634_c1 3300050512 Bacteria 4682
311 nmdc:mga0a205_10179_c1 3300050515 Bacteria 8638
312 Ga0495601_0000533 3300053077 Bacteria 20122
313 Ga0495601_0017979 3300053077 Bacteria 4297
314 Ga0495595_0008363 3300053084 Bacteria 4247
315 Ga0495595_0012839 3300053084 Bacteria 3531
316 Ga0495619_0017595 3300053085 Bacteria 4527
317 Ga0495619_0026302 3300053085 Bacteria 3742
318 Ga0495619_0026773 3300053085 Bacteria 3712
319 Ga0500641_0002978 3300053096 Bacteria 5998
320 2676492144 2675903060 Bacteria 10051191
321 2856745410 2856741275 Bacteria 8096094
322 2861521038 2861520306 Bacteria 8348283
323 2873320011 2873314349 Bacteria 8512634
324 2884698277 2884693830 Bacteria 11273186
325 2891397515 2891395885 Bacteria 9251614
326 2891561362 2891554331 Bacteria 8812224
327 2891569031 2891562705 Bacteria 8039471
328 2895427348 2895427314 Bacteria 13147766
329 2895450868 2895442618 Bacteria 11027144
330 8053952958 8053945823 Bacteria 8962862
331 8055066065 8055066027 Bacteria 9479577
332 8055175337 8055172936 Bacteria 9305943
333 8056065110 8056060235 Bacteria 7259403
334 8057575085 8057568493 Bacteria 7221719
335 Ga0070707_100020884
336 Ga0068868_100083294
337 Ga0070660_100008647
338 Ga0070660_100067199
339 Ga0070661_100048354
340 Ga0070692_10023803
341 Ga0070673_100084366
342 Ga0070709_10000275
343 Ga0070714_100000637
344 Ga0070714_100001636
345 Ga0070714_100009433
346 Ga0070714_100010392
347 Ga0070713_100036083
348 Ga0070713_100055391
349 Ga0070710_10000036
350 Ga0070710_10000421
351 Ga0070711_100002524
352 Ga0070708_100008639
353 Ga0070663_100017439
354 Ga0070663_100041779
355 Ga0070685_10049240
356 Ga0070706_100000827
357 Ga0070706_100000837
358 Ga0070706_100012874
359 Ga0070706_100038735
360 Ga0070706_100085173
361 Ga0070707_100000884
362 Ga0070707_100005124
363 Ga0070707_100069482
364 Ga0070698_100000449
365 Ga0070698_100000835
366 Ga0070698_100002668
367 Ga0070698_100009354
368 Ga0070698_100011209
369 Ga0070698_100043080
370 Ga0070699_100000709
371 Ga0070699_100016803
372 Ga0070679_100026959
373 Ga0070684_100020605
374 Ga0070684_100039098
375 Ga0070704_100011039
376 Ga0068854_100027187
377 Ga0068856_100094144
378 Ga0070702_100015315
379 Ga0068859_100073031
380 Ga0068858_100107891
381 Ga0081540_1000004
382 Ga0081540_1005697
383 Ga0070717_10011664
384 Ga0070717_10025832
385 Ga0070717_10036076
386 Ga0070715_10004563
387 Ga0070716_100000065
388 Ga0070716_100006540
389 Ga0075428_100054998
390 Ga0075429_100042906
391 Ga0075436_100027840
392 Ga0097620_100073029
393 Ga0111539_10003709
394 Ga0114129_10002729
395 Ga0114129_10076855
396 Ga0105243_10085394
397 Ga0105249_10121086
398 Ga0157371_10039687
399 Ga0157369_10014369
400 Ga0157369_10095854
401 Ga0157374_10008687
402 Ga0157378_10125523
403 Ga0157377_10027265
404 Ga0157379_10010743
405 Ga0163161_10028575
406 Ga0206354_10394616
407 Ga0213875_10000242
408 Ga0213875_10000557
409 Ga0213875_10011916
410 Ga0224712_10009860
411 Ga0228598_1006665
412 Ga0207692_10000092
413 Ga0207692_10005639
414 Ga0207688_10017705
415 Ga0207647_10047490
416 Ga0207699_10005363
417 Ga0207684_10001051
418 Ga0207684_10016626
419 Ga0207671_10075830
420 Ga0207693_10018977
421 Ga0207663_10005069
422 Ga0207663_10050435
423 Ga0207657_10007929
424 Ga0207652_10046166
425 Ga0207652_10063621
426 Ga0207646_10000437
427 Ga0207646_10004933
428 Ga0207646_10004957
429 Ga0207646_10008588
430 Ga0207646_10041079
431 Ga0207700_10000317
432 Ga0207700_10008827
433 Ga0207700_10038864
434 Ga0207700_10054269
435 Ga0207664_10000137
436 Ga0207664_10000603
437 Ga0207664_10001441
438 Ga0207664_10006530
439 Ga0207664_10008695
440 Ga0207664_10019073
441 Ga0207664_10021825
442 Ga0207664_10040395
443 Ga0207706_10034910
444 Ga0207665_10000254
445 Ga0207665_10004874
446 Ga0207691_10029764
447 Ga0207689_10047602
448 Ga0207658_10043003
449 Ga0207678_10023030
450 Ga0207678_10049232
451 Ga0207708_10059627
452 Ga0207648_10016530
453 Ga0207676_10047053
454 Ga0207674_10033124
455 Ga0207674_10046347
456 Ga0207675_100012094
457 Ga0207428_10000283
458 Ga0268266_10111664
459 Ga0265337_1000514
460 Ga0265319_1002615
461 Ga0265334_10001236
462 Ga0265336_10008342
463 Ga0265338_10000997
464 Ga0265338_10001906
465 Ga0265324_10015301
466 Ga0265332_10005904
467 Ga0265320_10028030
468 Ga0265325_10031414
469 Ga0265314_10011503
470 Ga0265342_10003816
471 Ga0373934_0000035
472 Ga0373934_0001477
473 Ga0373934_0023664
474 Ga0373940_0005793
475 Ga0373951_0006971
476 Ga0373923_0003006
477 Ga0373923_0005591
478 Ga0373923_0012912
479 Ga0373936_0000928
480 Ga0373936_0007252
481 Ga0373941_0001312
482 Ga0373945_0000161
483 Ga0373953_0000048
484 Ga0373953_0001216
485 Ga0373954_0021793
486 Ga0373956_0003348
487 Ga0373956_0005993
488 Ga0373956_0035452
489 Ga0373957_0000003
490 Ga0373957_0003160
491 Ga0373943_0001371
492 Ga0373943_0013423
493 Ga0373946_0000157
494 Ga0373946_0003327
495 Ga0373955_0000083
496 Ga0373955_0002916
497 Ga0373942_0003554
498 Ga0373924_0000124
499 Ga0373924_0000249
500 Ga0373935_0008791
501 Ga0373927_0034946
502 Ga0373933_0000001
503 Ga0373933_0004513
504 Ga0373947_0000001
505 Ga0373947_0000869
506 Ga0373947_0002445
507 Ga0373937_0000033
508 Ga0373937_0020581
509 Ga0373937_0021887
510 Ga0373925_0000009
511 Ga0373925_0005533
512 Ga0373925_0053674
513 Ga0373925_0061070
514 Ga0436364_0651483
515 Ga0436364_0757195
516 Ga0436364_0956908
517 Ga0436364_1282495
518 Ga0436364_1299779
519 Ga0436363_1596727
520 Ga0466966_0004274
521 Ga0466966_0026113
522 Ga0466963_0019595
523 Ga0466959_0010646
524 Ga0495592_0000002
525 Ga0495592_0004474
526 Ga0495592_0015064
527 Ga0495603_0006862
528 Ga0495629_0001025
529 Ga0495629_0024715
530 Ga0495629_0044787
531 Ga0495651_0000002
532 Ga0495651_0004163
533 Ga0495651_0005979
534 Ga0495651_0006347
535 Ga0495651_0006863
536 Ga0495651_0007461
537 Ga0495651_0016894
538 Ga0495653_0004963
539 Ga0495653_0009655
540 Ga0495653_0015481
541 Ga0495653_0030530
542 Ga0495653_0054159
543 Ga0495580_0007398
544 Ga0495582_0003247
545 Ga0495639_0000178
546 Ga0495639_0010567
547 Ga0495662_0000896
548 Ga0495664_0007037
549 Ga0495608_0000027
550 Ga0495608_0001626
551 Ga0495608_0005385
552 Ga0495618_0001032
553 Ga0495628_0001429
554 Ga0495628_0018685
555 Ga0495628_0025453
556 Ga0495630_0001021
557 Ga0495630_0022569
558 Ga0495666_0001034
559 Ga0495652_0002179
560 Ga0495652_0003958
561 Ga0495652_0014759
562 Ga0495652_0048654
563 Ga0495665_0000624
564 Ga0495640_0007437
565 Ga0495640_0009620
566 Ga0495640_0012150
567 Ga0495586_0004433
568 Ga0495587_0000013
569 Ga0495587_0004563
570 Ga0495587_0008911
571 Ga0495587_0011394
572 Ga0495645_0005027
573 Ga0495645_0007474
574 Ga0495645_0061711
575 Ga0495667_0000016
576 Ga0495667_0002000
577 Ga0495667_0010865
578 Ga0495667_0030370
579 Ga0495634_0000635
580 Ga0495635_0027094
581 Ga0495635_0050309
582 Ga0495657_0000014
583 Ga0495657_0020994
584 Ga0495599_0000006
585 Ga0495599_0043129
586 Ga0495599_0045495
587 Ga0495623_0000042
588 Ga0495623_0022062
589 Ga0495646_0008859
590 Ga0495646_0029765
591 Ga0495613_0007686
592 Ga0495624_0004976
593 Ga0495624_0035246
594 Ga0495600_0000498
595 Ga0495600_0015256
596 Ga0495581_0000108
597 Ga0495604_0000015
598 Ga0495604_0003632
599 Ga0495604_0003706
600 Ga0495604_0004559
601 Ga0495676_0000849
602 Ga0495680_0000009
603 Ga0495680_0004307
604 Ga0495680_0018291
605 Ga0495675_0002183
606 Ga0495675_0017996
607 Ga0495684_0004367
608 Ga0495684_0011655
609 Ga0495684_0013956
610 Ga0495593_0000581
611 Ga0495593_0016761
612 Ga0495602_0000013
613 Ga0495602_0028869
614 Ga0495614_0004184
615 Ga0496101_0036694
616 Ga0496102_0039437
617 Ga0496102_0043781
618 Ga0496103_0017098
619 Ga0496104_0001661
620 Ga0496104_0067823
621 Ga0496105_0000697
622 Ga0496105_0017549
623 Ga0496105_0021197
624 Ga0496106_0062167
625 Ga0496108_0008242
626 Ga0496108_0013255
627 Ga0496111_0009286
628 Ga0496112_0000365
629 Ga0496112_0120875
630 Ga0496113_0069226
631 Ga0496115_0021386
632 Ga0496115_0050900
633 Ga0496121_0010579
634 Ga0496126_0092945
635 Ga0501034_0021699
636 Ga0501036_0006434
637 Ga0501043_0001199
638 Ga0501047_0072181
639 Ga0501048_0007951
640 Ga0501074_0011389
641 nmdc:mga05p37_49155_c1
642 nmdc:mga0qj67_18504_c1
643 nmdc:mga08y16_2960_c1
644 nmdc:mga0n895_37634_c1
645 nmdc:mga0a205_10179_c1
646 Ga0495601_0000533
647 Ga0495601_0017979
648 Ga0495595_0008363
649 Ga0495595_0012839
650 Ga0495619_0017595
651 Ga0495619_0026302
652 Ga0495619_0026773
653 Ga0500641_0002978
654 2676492144
655 2856745410
656 2861521038
657 2873320011
658 2884698277
659 2891397515
660 2891561362
661 2891569031
662 2895427348
663 2895450868
664 8053952958
665 8055066065
666 8055175337
667 8056065110
668 8057575085

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00425

Chorismate_bind

chorismate binding enzyme

276

530

0.98

PF00117

GATase

Glutamine amidotransferase class-I

582

776

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wl8-assembly1.cif.gz_A crystal structure of ph1346 protein from pyrococcus horikoshii 0.9187 523 712
2d7j-assembly1.cif.gz_A crystal structure analysis of glutamine amidotransferase from pyrococcus horikoshii ot3 0.914 524 713
1wl8-assembly1.cif.gz_A crystal structure of ph1346 protein from pyrococcus horikoshii 0.9001 523 712
1qdl-assembly1.cif.gz_B-2 the crystal structure of anthranilate synthase from sulfolobus solfataricus 0.8988 522 710
2ywb-assembly3.cif.gz_A crystal structure of gmp synthetase from thermus thermophilus 0.8986 524 713
ID Description Score Start End Superfamily
af_Q2G099_1_189_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9296 524 710 3.40.50.880
1wl8A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9189 523 712 3.40.50.880
af_Q57690_3_195_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9179 521 710 3.40.50.880
af_P00903_1_187_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9177 524 710 3.40.50.880
af_Q2G0Y6_3_196_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9152 518 713 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A6B1PHU7-F1-model_v4 deleted 0.9693 542 709
AF-A0A354Q5A3-F1-model_v4 Anthranilate synthase component I 0.962 522 722 GO:0000162
GO:0004049
GO:0005829
GO:0006541
AF-A0A0G0BJG9-F1-model_v4 Multifunctional fusion protein [Includes: Indole-3-glycerol phosphate synthase (IGPS) (EC 4.1.1.48); Anthranilate phosphoribosyltransferase (EC 2.4.2.18)] 0.9609 522 709 GO:0000162
GO:0000287
GO:0004048
GO:0004049
GO:0004425
GO:0005829
GO:0006541
GO:0006568
AF-A0A527GRA3-F1-model_v4 Anthranilate synthase component I (EC 4.1.3.27) 0.955 555 718 GO:0000162
GO:0004049
GO:0005829
GO:0006541
AF-D5RU04-F1-model_v4 Glutamine amidotransferase, class I (EC 4.1.3.27) 0.9532 523 714 GO:0000162
GO:0004049
GO:0005829
GO:0006541
GO:0016740

Map