F411686
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 334 | 195 | 668 | 728 |
Family's Representative Sequence
| Representative Sequence | 3300005468|Ga0070707_100020884|Ga0070707_1000208844 |
| Length | 815 |
| Sequence | MADLSVDYAADFGTLPPSGESRYVTAGGISVTRTATPFEPGRLAEVTRQADRRRGGTFSSGMEYPGRYSRWHMGYVDPCLELTATGRELTATALTERGAVILPAVGAALRRAGEEIGSGPVPDGASGAVTVRVPEAAGFVPEEERSRRPTVFSAVREVIALFAGPDEHLGLYGAFGYDLAFQFEPLRLRHDRRDTGGAGXXXXARRRRDLVLHLPDELYVIDRKRETALRYGYEFAVGGRTTADLDRRAPWPAPGAAGESGQGAFVGTDQVPPDPEPGAYARVVEQARERFAAGDLFEVVPSHEFWARCGSPAAFYERLRRRNPAPYEFFLNLGEDEYLVGASPEMYVRVTGDRVETCPIAGTVARGADALADAENIRALLTSPKEESELTMCTDVDRNDKSRICVPGSVRVIGRRQIELYSRVIHTVDHVEGRLRPGFDALDAFLTHMWAVTVTGAPKAWAMQFIEDHEASPRGWYGGAVGVLGFDGSMNTGLTLRTAHIRGGVASVRTGATLLFDSDPAAEETETRLKARALLEVLAETAADPLAAGKDRQAQRTSRGGSPGRAPVSAEAGPPGAGMRVLLVDHQDSFVHTLAGYFARHGASVTTLRYGFEPARLDEYAPDLVVLSPGPGRPADFGCSRLLDELDARNLAALGVCLGLQAMVEHAGGTLSLLATPAHGKPAAVRVTGGDLFAGLPAEFTAGRYHSLHTTPDQAGAGFAVTAVTSDGGRAANGSAAGREVVMAIENPAAGRWGVQFHPESILTASDDVGAAIIANVLGLCRARNIMVDNSGKQRDSTSAISNTGAFSNTWLRST |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 2 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 3 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 6 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 8 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 10 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 11 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 22 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 23 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 25 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 26 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 27 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 31 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 32 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 33 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 34 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 35 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 36 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 46 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 47 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 48 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 49 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 74 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 76 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 77 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 78 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 79 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 80 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 81 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 82 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 83 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 84 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 85 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 86 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 87 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 88 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 89 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 90 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 91 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 92 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 93 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 94 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 95 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 96 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 97 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 98 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 99 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 100 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 101 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 102 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 103 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 104 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 105 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 106 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 107 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 108 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 109 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 110 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 111 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 112 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 113 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 154 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 155 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 156 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 157 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 158 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 159 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 160 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 161 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 162 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 163 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 164 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 165 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 166 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 167 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 168 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 169 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 170 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 171 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 172 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 173 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 174 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 175 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 176 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 177 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 181 | 2675903060 | Nonomuraea wenchangensis CGMCC 4.5598 | Isolate | Rhizosphere |
| 182 | 2856741275 | Microbispora triticiradicis NEAU-HRDPA2-9 | Isolate | Unclassified |
| 183 | 2861520306 | Phytomonospora endophytica DSM 45386 | Isolate | Unclassified |
| 184 | 2873314349 | Sphaerisporangium siamense DSM 45784 | Isolate | Rhizosphere |
| 185 | 2884693830 | Nonomuraea phyllanthi WYY166 | Isolate | Unclassified |
| 186 | 2891395885 | Microbispora catharanthi CR1-09 | Isolate | Unclassified |
| 187 | 2891554331 | Microbispora sp. CL1-1 | Isolate | Unclassified |
| 188 | 2891562705 | Microbispora tritici MT50 | Isolate | Unclassified |
| 189 | 2895427314 | Nonomuraea sp. PA05 | Isolate | Unclassified |
| 190 | 2895442618 | Nonomuraea phyllanthi PA1-10 | Isolate | Unclassified |
| 191 | 8053945823 | Actinomadura terrae OS3-83 | Isolate | Rhizosphere |
| 192 | 8055066027 | Sphaerisporangium corydalis NEAU-YHS15 | Isolate | Unclassified |
| 193 | 8055172936 | Sphaerisporangium perillae NEAU-ZS1 | Isolate | Unclassified |
| 194 | 8056060235 | Nocardiopsis endophytica RSe5-2 | Isolate | Unclassified |
| 195 | 8057568493 | Actinorhabdospora filicis NBRC 111898 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.91 |
| Metatranscriptomes | 0.6 |
| Isolates | 4.49 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.3 |
| Nodule | 0 |
| Rhizoplane | 5.39 |
| Rhizosphere | 87.72 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070707_100020884 | 3300005468 | Bacteria | 6181 |
| 2 | Ga0068868_100083294 | 3300005338 | Bacteria | 2567 |
| 3 | Ga0070660_100008647 | 3300005339 | Bacteria | 7130 |
| 4 | Ga0070660_100067199 | 3300005339 | Bacteria | 2792 |
| 5 | Ga0070661_100048354 | 3300005344 | Bacteria | 3113 |
| 6 | Ga0070692_10023803 | 3300005345 | Bacteria | 3004 |
| 7 | Ga0070673_100084366 | 3300005364 | Bacteria | 2583 |
| 8 | Ga0070709_10000275 | 3300005434 | Bacteria | 32988 |
| 9 | Ga0070714_100000637 | 3300005435 | Bacteria | 24962 |
| 10 | Ga0070714_100001636 | 3300005435 | Bacteria | 16298 |
| 11 | Ga0070714_100009433 | 3300005435 | Bacteria | 7674 |
| 12 | Ga0070714_100010392 | 3300005435 | Bacteria | 7358 |
| 13 | Ga0070713_100036083 | 3300005436 | Bacteria | 3987 |
| 14 | Ga0070713_100055391 | 3300005436 | Bacteria | 3295 |
| 15 | Ga0070710_10000036 | 3300005437 | Bacteria | 61426 |
| 16 | Ga0070710_10000421 | 3300005437 | Bacteria | 19958 |
| 17 | Ga0070711_100002524 | 3300005439 | Bacteria | 10463 |
| 18 | Ga0070708_100008639 | 3300005445 | Bacteria | 8185 |
| 19 | Ga0070663_100017439 | 3300005455 | Bacteria | 4686 |
| 20 | Ga0070663_100041779 | 3300005455 | Bacteria | 3219 |
| 21 | Ga0070685_10049240 | 3300005466 | Bacteria | 2430 |
| 22 | Ga0070706_100000827 | 3300005467 | Bacteria | 34214 |
| 23 | Ga0070706_100000837 | 3300005467 | Bacteria | 34046 |
| 24 | Ga0070706_100012874 | 3300005467 | Bacteria | 7743 |
| 25 | Ga0070706_100038735 | 3300005467 | Bacteria | 4399 |
| 26 | Ga0070706_100085173 | 3300005467 | Bacteria | 2928 |
| 27 | Ga0070707_100000884 | 3300005468 | Bacteria | 29741 |
| 28 | Ga0070707_100005124 | 3300005468 | Bacteria | 12280 |
| 29 | Ga0070707_100069482 | 3300005468 | Bacteria | 3391 |
| 30 | Ga0070698_100000449 | 3300005471 | Bacteria | 43773 |
| 31 | Ga0070698_100000835 | 3300005471 | Bacteria | 33687 |
| 32 | Ga0070698_100002668 | 3300005471 | Bacteria | 19683 |
| 33 | Ga0070698_100009354 | 3300005471 | Bacteria | 10508 |
| 34 | Ga0070698_100011209 | 3300005471 | Bacteria | 9525 |
| 35 | Ga0070698_100043080 | 3300005471 | Bacteria | 4629 |
| 36 | Ga0070699_100000709 | 3300005518 | Bacteria | 30905 |
| 37 | Ga0070699_100016803 | 3300005518 | Bacteria | 6282 |
| 38 | Ga0070679_100026959 | 3300005530 | Bacteria | 5650 |
| 39 | Ga0070684_100020605 | 3300005535 | Bacteria | 5468 |
| 40 | Ga0070684_100039098 | 3300005535 | Bacteria | 4080 |
| 41 | Ga0070704_100011039 | 3300005549 | Bacteria | 5514 |
| 42 | Ga0068854_100027187 | 3300005578 | Bacteria | 3940 |
| 43 | Ga0068856_100094144 | 3300005614 | Bacteria | 2982 |
| 44 | Ga0070702_100015315 | 3300005615 | Bacteria | 3913 |
| 45 | Ga0068859_100073031 | 3300005617 | Bacteria | 3468 |
| 46 | Ga0068858_100107891 | 3300005842 | Bacteria | 2599 |
| 47 | Ga0081540_1000004 | 3300005983 | Bacteria | 231552 |
| 48 | Ga0081540_1005697 | 3300005983 | Bacteria | 9245 |
| 49 | Ga0070717_10011664 | 3300006028 | Bacteria | 6682 |
| 50 | Ga0070717_10025832 | 3300006028 | Bacteria | 4678 |
| 51 | Ga0070717_10036076 | 3300006028 | Bacteria | 4008 |
| 52 | Ga0070715_10004563 | 3300006163 | Bacteria | 4560 |
| 53 | Ga0070716_100000065 | 3300006173 | Bacteria | 41076 |
| 54 | Ga0070716_100006540 | 3300006173 | Bacteria | 5696 |
| 55 | Ga0075428_100054998 | 3300006844 | Bacteria | 4362 |
| 56 | Ga0075429_100042906 | 3300006880 | Bacteria | 3935 |
| 57 | Ga0075436_100027840 | 3300006914 | Bacteria | 3890 |
| 58 | Ga0097620_100073029 | 3300006931 | Bacteria | 3468 |
| 59 | Ga0111539_10003709 | 3300009094 | Bacteria | 20094 |
| 60 | Ga0114129_10002729 | 3300009147 | Bacteria | 24610 |
| 61 | Ga0114129_10076855 | 3300009147 | Bacteria | 4647 |
| 62 | Ga0105243_10085394 | 3300009148 | Bacteria | 2587 |
| 63 | Ga0105249_10121086 | 3300009553 | Bacteria | 2487 |
| 64 | Ga0157371_10039687 | 3300013102 | Bacteria | 3366 |
| 65 | Ga0157369_10014369 | 3300013105 | Bacteria | 8940 |
| 66 | Ga0157369_10095854 | 3300013105 | Bacteria | 3165 |
| 67 | Ga0157374_10008687 | 3300013296 | Bacteria | 8688 |
| 68 | Ga0157378_10125523 | 3300013297 | Bacteria | 2370 |
| 69 | Ga0157377_10027265 | 3300014745 | Bacteria | 3066 |
| 70 | Ga0157379_10010743 | 3300014968 | Bacteria | 7980 |
| 71 | Ga0163161_10028575 | 3300017792 | Bacteria | 3961 |
| 72 | Ga0206354_10394616 | 3300020081 | Bacteria | 3575 |
| 73 | Ga0213875_10000242 | 3300021388 | Bacteria | 54644 |
| 74 | Ga0213875_10000557 | 3300021388 | Bacteria | 30393 |
| 75 | Ga0213875_10011916 | 3300021388 | Bacteria | 4311 |
| 76 | Ga0224712_10009860 | 3300022467 | Bacteria | 2897 |
| 77 | Ga0228598_1006665 | 3300024227 | Bacteria | 2382 |
| 78 | Ga0207692_10000092 | 3300025898 | Bacteria | 26547 |
| 79 | Ga0207692_10005639 | 3300025898 | Bacteria | 5026 |
| 80 | Ga0207688_10017705 | 3300025901 | Bacteria | 3876 |
| 81 | Ga0207647_10047490 | 3300025904 | Bacteria | 2670 |
| 82 | Ga0207699_10005363 | 3300025906 | Bacteria | 6145 |
| 83 | Ga0207684_10001051 | 3300025910 | Bacteria | 30865 |
| 84 | Ga0207684_10016626 | 3300025910 | Bacteria | 6316 |
| 85 | Ga0207671_10075830 | 3300025914 | Bacteria | 2516 |
| 86 | Ga0207693_10018977 | 3300025915 | Bacteria | 5474 |
| 87 | Ga0207663_10005069 | 3300025916 | Bacteria | 6614 |
| 88 | Ga0207663_10050435 | 3300025916 | Bacteria | 2586 |
| 89 | Ga0207657_10007929 | 3300025919 | Bacteria | 10828 |
| 90 | Ga0207652_10046166 | 3300025921 | Bacteria | 3715 |
| 91 | Ga0207652_10063621 | 3300025921 | Bacteria | 3191 |
| 92 | Ga0207646_10000437 | 3300025922 | Bacteria | 55790 |
| 93 | Ga0207646_10004933 | 3300025922 | Bacteria | 14273 |
| 94 | Ga0207646_10004957 | 3300025922 | Bacteria | 14225 |
| 95 | Ga0207646_10008588 | 3300025922 | Bacteria | 10209 |
| 96 | Ga0207646_10041079 | 3300025922 | Bacteria | 4159 |
| 97 | Ga0207700_10000317 | 3300025928 | Bacteria | 28228 |
| 98 | Ga0207700_10008827 | 3300025928 | Bacteria | 6264 |
| 99 | Ga0207700_10038864 | 3300025928 | Bacteria | 3458 |
| 100 | Ga0207700_10054269 | 3300025928 | Bacteria | 3007 |
| 101 | Ga0207664_10000137 | 3300025929 | Bacteria | 62759 |
| 102 | Ga0207664_10000603 | 3300025929 | Bacteria | 24856 |
| 103 | Ga0207664_10001441 | 3300025929 | Bacteria | 15638 |
| 104 | Ga0207664_10006530 | 3300025929 | Bacteria | 8028 |
| 105 | Ga0207664_10008695 | 3300025929 | Bacteria | 7098 |
| 106 | Ga0207664_10019073 | 3300025929 | Bacteria | 5062 |
| 107 | Ga0207664_10021825 | 3300025929 | Bacteria | 4770 |
| 108 | Ga0207664_10040395 | 3300025929 | Bacteria | 3627 |
| 109 | Ga0207706_10034910 | 3300025933 | Bacteria | 4473 |
| 110 | Ga0207665_10000254 | 3300025939 | Bacteria | 36877 |
| 111 | Ga0207665_10004874 | 3300025939 | Bacteria | 8936 |
| 112 | Ga0207691_10029764 | 3300025940 | Bacteria | 5107 |
| 113 | Ga0207689_10047602 | 3300025942 | Bacteria | 3539 |
| 114 | Ga0207658_10043003 | 3300025986 | Bacteria | 3282 |
| 115 | Ga0207678_10023030 | 3300026067 | Bacteria | 5450 |
| 116 | Ga0207678_10049232 | 3300026067 | Bacteria | 3642 |
| 117 | Ga0207708_10059627 | 3300026075 | Bacteria | 2913 |
| 118 | Ga0207648_10016530 | 3300026089 | Bacteria | 6738 |
| 119 | Ga0207676_10047053 | 3300026095 | Bacteria | 3341 |
| 120 | Ga0207674_10033124 | 3300026116 | Bacteria | 5411 |
| 121 | Ga0207674_10046347 | 3300026116 | Bacteria | 4464 |
| 122 | Ga0207675_100012094 | 3300026118 | Bacteria | 8064 |
| 123 | Ga0207428_10000283 | 3300027907 | Bacteria | 68603 |
| 124 | Ga0268266_10111664 | 3300028379 | Bacteria | 2422 |
| 125 | Ga0265337_1000514 | 3300028556 | Bacteria | 20617 |
| 126 | Ga0265319_1002615 | 3300028563 | Bacteria | 9704 |
| 127 | Ga0265334_10001236 | 3300028573 | Bacteria | 12482 |
| 128 | Ga0265336_10008342 | 3300028666 | Bacteria | 3637 |
| 129 | Ga0265338_10000997 | 3300028800 | Bacteria | 47663 |
| 130 | Ga0265338_10001906 | 3300028800 | Bacteria | 32587 |
| 131 | Ga0265324_10015301 | 3300029957 | Bacteria | 2823 |
| 132 | Ga0265332_10005904 | 3300031238 | Bacteria | 5599 |
| 133 | Ga0265320_10028030 | 3300031240 | Bacteria | 2928 |
| 134 | Ga0265325_10031414 | 3300031241 | Bacteria | 2842 |
| 135 | Ga0265314_10011503 | 3300031711 | Bacteria | 7299 |
| 136 | Ga0265342_10003816 | 3300031712 | Bacteria | 12126 |
| 137 | Ga0373934_0000035 | 3300035086 | Bacteria | 43876 |
| 138 | Ga0373934_0001477 | 3300035086 | Bacteria | 8618 |
| 139 | Ga0373934_0023664 | 3300035086 | Bacteria | 2373 |
| 140 | Ga0373940_0005793 | 3300035088 | Bacteria | 2700 |
| 141 | Ga0373951_0006971 | 3300035091 | Bacteria | 2579 |
| 142 | Ga0373923_0003006 | 3300035111 | Bacteria | 5327 |
| 143 | Ga0373923_0005591 | 3300035111 | Bacteria | 4278 |
| 144 | Ga0373923_0012912 | 3300035111 | Bacteria | 3102 |
| 145 | Ga0373936_0000928 | 3300035113 | Bacteria | 10456 |
| 146 | Ga0373936_0007252 | 3300035113 | Bacteria | 4170 |
| 147 | Ga0373941_0001312 | 3300035115 | Bacteria | 5234 |
| 148 | Ga0373945_0000161 | 3300035116 | Bacteria | 17395 |
| 149 | Ga0373953_0000048 | 3300035117 | Bacteria | 30836 |
| 150 | Ga0373953_0001216 | 3300035117 | Bacteria | 7336 |
| 151 | Ga0373954_0021793 | 3300035118 | Bacteria | 2903 |
| 152 | Ga0373956_0003348 | 3300035119 | Bacteria | 6449 |
| 153 | Ga0373956_0005993 | 3300035119 | Bacteria | 4864 |
| 154 | Ga0373956_0035452 | 3300035119 | Bacteria | 2200 |
| 155 | Ga0373957_0000003 | 3300035120 | Bacteria | 67097 |
| 156 | Ga0373957_0003160 | 3300035120 | Bacteria | 4822 |
| 157 | Ga0373943_0001371 | 3300035170 | Bacteria | 10965 |
| 158 | Ga0373943_0013423 | 3300035170 | Bacteria | 3699 |
| 159 | Ga0373946_0000157 | 3300035171 | Bacteria | 20583 |
| 160 | Ga0373946_0003327 | 3300035171 | Bacteria | 5709 |
| 161 | Ga0373955_0000083 | 3300035172 | Bacteria | 38356 |
| 162 | Ga0373955_0002916 | 3300035172 | Bacteria | 7509 |
| 163 | Ga0373942_0003554 | 3300035207 | Bacteria | 3657 |
| 164 | Ga0373924_0000124 | 3300035410 | Bacteria | 22351 |
| 165 | Ga0373924_0000249 | 3300035410 | Bacteria | 16483 |
| 166 | Ga0373935_0008791 | 3300035692 | Bacteria | 6049 |
| 167 | Ga0373927_0034946 | 3300035695 | Bacteria | 3268 |
| 168 | Ga0373933_0000001 | 3300035724 | Bacteria | 228234 |
| 169 | Ga0373933_0004513 | 3300035724 | Bacteria | 7632 |
| 170 | Ga0373947_0000001 | 3300035725 | Bacteria | 510932 |
| 171 | Ga0373947_0000869 | 3300035725 | Bacteria | 18266 |
| 172 | Ga0373947_0002445 | 3300035725 | Bacteria | 11194 |
| 173 | Ga0373937_0000033 | 3300036401 | Bacteria | 120102 |
| 174 | Ga0373937_0020581 | 3300036401 | Bacteria | 5914 |
| 175 | Ga0373937_0021887 | 3300036401 | Bacteria | 5740 |
| 176 | Ga0373925_0000009 | 3300037068 | Bacteria | 243099 |
| 177 | Ga0373925_0005533 | 3300037068 | Bacteria | 9404 |
| 178 | Ga0373925_0053674 | 3300037068 | Bacteria | 3013 |
| 179 | Ga0373925_0061070 | 3300037068 | Bacteria | 2830 |
| 180 | Ga0436364_0651483 | 3300037853 | Bacteria | 14071 |
| 181 | Ga0436364_0757195 | 3300037853 | Bacteria | 96239 |
| 182 | Ga0436364_0956908 | 3300037853 | Bacteria | 4465 |
| 183 | Ga0436364_1282495 | 3300037853 | Bacteria | 2457 |
| 184 | Ga0436364_1299779 | 3300037853 | Bacteria | 159755 |
| 185 | Ga0436363_1596727 | 3300039450 | Bacteria | 2521 |
| 186 | Ga0466966_0004274 | 3300044684 | Bacteria | 9418 |
| 187 | Ga0466966_0026113 | 3300044684 | Bacteria | 3814 |
| 188 | Ga0466963_0019595 | 3300044694 | Bacteria | 4246 |
| 189 | Ga0466959_0010646 | 3300045049 | Bacteria | 6587 |
| 190 | Ga0495592_0000002 | 3300046454 | Bacteria | 209491 |
| 191 | Ga0495592_0004474 | 3300046454 | Bacteria | 10224 |
| 192 | Ga0495592_0015064 | 3300046454 | Bacteria | 5871 |
| 193 | Ga0495603_0006862 | 3300046455 | Bacteria | 6830 |
| 194 | Ga0495629_0001025 | 3300046459 | Bacteria | 22416 |
| 195 | Ga0495629_0024715 | 3300046459 | Bacteria | 4276 |
| 196 | Ga0495629_0044787 | 3300046459 | Bacteria | 3105 |
| 197 | Ga0495651_0000002 | 3300046462 | Bacteria | 209492 |
| 198 | Ga0495651_0004163 | 3300046462 | Bacteria | 11077 |
| 199 | Ga0495651_0005979 | 3300046462 | Bacteria | 9286 |
| 200 | Ga0495651_0006347 | 3300046462 | Bacteria | 9045 |
| 201 | Ga0495651_0006863 | 3300046462 | Bacteria | 8700 |
| 202 | Ga0495651_0007461 | 3300046462 | Bacteria | 8363 |
| 203 | Ga0495651_0016894 | 3300046462 | Bacteria | 5652 |
| 204 | Ga0495653_0004963 | 3300046463 | Bacteria | 10799 |
| 205 | Ga0495653_0009655 | 3300046463 | Bacteria | 7892 |
| 206 | Ga0495653_0015481 | 3300046463 | Bacteria | 6216 |
| 207 | Ga0495653_0030530 | 3300046463 | Bacteria | 4291 |
| 208 | Ga0495653_0054159 | 3300046463 | Bacteria | 3066 |
| 209 | Ga0495580_0007398 | 3300046472 | Bacteria | 8831 |
| 210 | Ga0495582_0003247 | 3300046473 | Bacteria | 9127 |
| 211 | Ga0495639_0000178 | 3300046475 | Bacteria | 33506 |
| 212 | Ga0495639_0010567 | 3300046475 | Bacteria | 3976 |
| 213 | Ga0495662_0000896 | 3300046476 | Bacteria | 14545 |
| 214 | Ga0495664_0007037 | 3300046477 | Bacteria | 6230 |
| 215 | Ga0495608_0000027 | 3300046511 | Bacteria | 152979 |
| 216 | Ga0495608_0001626 | 3300046511 | Bacteria | 16124 |
| 217 | Ga0495608_0005385 | 3300046511 | Bacteria | 9143 |
| 218 | Ga0495618_0001032 | 3300046514 | Bacteria | 19076 |
| 219 | Ga0495628_0001429 | 3300046516 | Bacteria | 21908 |
| 220 | Ga0495628_0018685 | 3300046516 | Bacteria | 5736 |
| 221 | Ga0495628_0025453 | 3300046516 | Bacteria | 4834 |
| 222 | Ga0495630_0001021 | 3300046517 | Bacteria | 19378 |
| 223 | Ga0495630_0022569 | 3300046517 | Bacteria | 4648 |
| 224 | Ga0495666_0001034 | 3300046526 | Bacteria | 13204 |
| 225 | Ga0495652_0002179 | 3300046529 | Bacteria | 20593 |
| 226 | Ga0495652_0003958 | 3300046529 | Bacteria | 14356 |
| 227 | Ga0495652_0014759 | 3300046529 | Bacteria | 7003 |
| 228 | Ga0495652_0048654 | 3300046529 | Bacteria | 3631 |
| 229 | Ga0495665_0000624 | 3300046531 | Bacteria | 18026 |
| 230 | Ga0495640_0007437 | 3300046533 | Bacteria | 8607 |
| 231 | Ga0495640_0009620 | 3300046533 | Bacteria | 7519 |
| 232 | Ga0495640_0012150 | 3300046533 | Bacteria | 6592 |
| 233 | Ga0495586_0004433 | 3300046535 | Bacteria | 7498 |
| 234 | Ga0495587_0000013 | 3300046536 | Bacteria | 195619 |
| 235 | Ga0495587_0004563 | 3300046536 | Bacteria | 9092 |
| 236 | Ga0495587_0008911 | 3300046536 | Bacteria | 6437 |
| 237 | Ga0495587_0011394 | 3300046536 | Bacteria | 5636 |
| 238 | Ga0495645_0005027 | 3300046543 | Bacteria | 9062 |
| 239 | Ga0495645_0007474 | 3300046543 | Bacteria | 7606 |
| 240 | Ga0495645_0061711 | 3300046543 | Bacteria | 2716 |
| 241 | Ga0495667_0000016 | 3300046559 | Bacteria | 195635 |
| 242 | Ga0495667_0002000 | 3300046559 | Bacteria | 13503 |
| 243 | Ga0495667_0010865 | 3300046559 | Bacteria | 6155 |
| 244 | Ga0495667_0030370 | 3300046559 | Bacteria | 3631 |
| 245 | Ga0495634_0000635 | 3300046642 | Bacteria | 34152 |
| 246 | Ga0495635_0027094 | 3300046663 | Bacteria | 3987 |
| 247 | Ga0495635_0050309 | 3300046663 | Bacteria | 2873 |
| 248 | Ga0495657_0000014 | 3300046675 | Bacteria | 195574 |
| 249 | Ga0495657_0020994 | 3300046675 | Bacteria | 4692 |
| 250 | Ga0495599_0000006 | 3300046678 | Bacteria | 283487 |
| 251 | Ga0495599_0043129 | 3300046678 | Bacteria | 2831 |
| 252 | Ga0495599_0045495 | 3300046678 | Bacteria | 2752 |
| 253 | Ga0495623_0000042 | 3300046679 | Bacteria | 78088 |
| 254 | Ga0495623_0022062 | 3300046679 | Bacteria | 4113 |
| 255 | Ga0495646_0008859 | 3300046680 | Bacteria | 6390 |
| 256 | Ga0495646_0029765 | 3300046680 | Bacteria | 3411 |
| 257 | Ga0495613_0007686 | 3300046689 | Bacteria | 8020 |
| 258 | Ga0495624_0004976 | 3300046690 | Bacteria | 9627 |
| 259 | Ga0495624_0035246 | 3300046690 | Bacteria | 3231 |
| 260 | Ga0495600_0000498 | 3300046809 | Bacteria | 20349 |
| 261 | Ga0495600_0015256 | 3300046809 | Bacteria | 4855 |
| 262 | Ga0495581_0000108 | 3300047315 | Bacteria | 34596 |
| 263 | Ga0495604_0000015 | 3300047317 | Bacteria | 195635 |
| 264 | Ga0495604_0003632 | 3300047317 | Bacteria | 12306 |
| 265 | Ga0495604_0003706 | 3300047317 | Bacteria | 12171 |
| 266 | Ga0495604_0004559 | 3300047317 | Bacteria | 10977 |
| 267 | Ga0495676_0000849 | 3300047321 | Bacteria | 25619 |
| 268 | Ga0495680_0000009 | 3300047322 | Bacteria | 146021 |
| 269 | Ga0495680_0004307 | 3300047322 | Bacteria | 13651 |
| 270 | Ga0495680_0018291 | 3300047322 | Bacteria | 5954 |
| 271 | Ga0495675_0002183 | 3300047444 | Bacteria | 11665 |
| 272 | Ga0495675_0017996 | 3300047444 | Bacteria | 4479 |
| 273 | Ga0495684_0004367 | 3300047471 | Bacteria | 11045 |
| 274 | Ga0495684_0011655 | 3300047471 | Bacteria | 6787 |
| 275 | Ga0495684_0013956 | 3300047471 | Bacteria | 6179 |
| 276 | Ga0495593_0000581 | 3300047673 | Bacteria | 20813 |
| 277 | Ga0495593_0016761 | 3300047673 | Bacteria | 4127 |
| 278 | Ga0495602_0000013 | 3300048088 | Bacteria | 195591 |
| 279 | Ga0495602_0028869 | 3300048088 | Bacteria | 5300 |
| 280 | Ga0495614_0004184 | 3300048089 | Bacteria | 6503 |
| 281 | Ga0496101_0036694 | 3300048904 | Bacteria | 3472 |
| 282 | Ga0496102_0039437 | 3300048905 | Bacteria | 4268 |
| 283 | Ga0496102_0043781 | 3300048905 | Bacteria | 4060 |
| 284 | Ga0496103_0017098 | 3300048906 | Bacteria | 4336 |
| 285 | Ga0496104_0001661 | 3300048907 | Bacteria | 19218 |
| 286 | Ga0496104_0067823 | 3300048907 | Bacteria | 3389 |
| 287 | Ga0496105_0000697 | 3300048908 | Bacteria | 22678 |
| 288 | Ga0496105_0017549 | 3300048908 | Bacteria | 5741 |
| 289 | Ga0496105_0021197 | 3300048908 | Bacteria | 5258 |
| 290 | Ga0496106_0062167 | 3300048909 | Bacteria | 2834 |
| 291 | Ga0496108_0008242 | 3300048911 | Bacteria | 8458 |
| 292 | Ga0496108_0013255 | 3300048911 | Bacteria | 6718 |
| 293 | Ga0496111_0009286 | 3300048914 | Bacteria | 6554 |
| 294 | Ga0496112_0000365 | 3300048915 | Bacteria | 29514 |
| 295 | Ga0496112_0120875 | 3300048915 | Bacteria | 2589 |
| 296 | Ga0496113_0069226 | 3300048916 | Bacteria | 2680 |
| 297 | Ga0496115_0021386 | 3300048918 | Bacteria | 4998 |
| 298 | Ga0496115_0050900 | 3300048918 | Bacteria | 3320 |
| 299 | Ga0496121_0010579 | 3300048924 | Bacteria | 10371 |
| 300 | Ga0496126_0092945 | 3300048929 | Bacteria | 2649 |
| 301 | Ga0501034_0021699 | 3300049571 | Bacteria | 6542 |
| 302 | Ga0501036_0006434 | 3300049572 | Bacteria | 9540 |
| 303 | Ga0501043_0001199 | 3300049579 | Bacteria | 22819 |
| 304 | Ga0501047_0072181 | 3300049581 | Bacteria | 3322 |
| 305 | Ga0501048_0007951 | 3300049582 | Bacteria | 8033 |
| 306 | Ga0501074_0011389 | 3300049590 | Bacteria | 6465 |
| 307 | nmdc:mga05p37_49155_c1 | 3300050507 | Bacteria | 5188 |
| 308 | nmdc:mga0qj67_18504_c1 | 3300050509 | Bacteria | 5310 |
| 309 | nmdc:mga08y16_2960_c1 | 3300050511 | Bacteria | 17504 |
| 310 | nmdc:mga0n895_37634_c1 | 3300050512 | Bacteria | 4682 |
| 311 | nmdc:mga0a205_10179_c1 | 3300050515 | Bacteria | 8638 |
| 312 | Ga0495601_0000533 | 3300053077 | Bacteria | 20122 |
| 313 | Ga0495601_0017979 | 3300053077 | Bacteria | 4297 |
| 314 | Ga0495595_0008363 | 3300053084 | Bacteria | 4247 |
| 315 | Ga0495595_0012839 | 3300053084 | Bacteria | 3531 |
| 316 | Ga0495619_0017595 | 3300053085 | Bacteria | 4527 |
| 317 | Ga0495619_0026302 | 3300053085 | Bacteria | 3742 |
| 318 | Ga0495619_0026773 | 3300053085 | Bacteria | 3712 |
| 319 | Ga0500641_0002978 | 3300053096 | Bacteria | 5998 |
| 320 | 2676492144 | 2675903060 | Bacteria | 10051191 |
| 321 | 2856745410 | 2856741275 | Bacteria | 8096094 |
| 322 | 2861521038 | 2861520306 | Bacteria | 8348283 |
| 323 | 2873320011 | 2873314349 | Bacteria | 8512634 |
| 324 | 2884698277 | 2884693830 | Bacteria | 11273186 |
| 325 | 2891397515 | 2891395885 | Bacteria | 9251614 |
| 326 | 2891561362 | 2891554331 | Bacteria | 8812224 |
| 327 | 2891569031 | 2891562705 | Bacteria | 8039471 |
| 328 | 2895427348 | 2895427314 | Bacteria | 13147766 |
| 329 | 2895450868 | 2895442618 | Bacteria | 11027144 |
| 330 | 8053952958 | 8053945823 | Bacteria | 8962862 |
| 331 | 8055066065 | 8055066027 | Bacteria | 9479577 |
| 332 | 8055175337 | 8055172936 | Bacteria | 9305943 |
| 333 | 8056065110 | 8056060235 | Bacteria | 7259403 |
| 334 | 8057575085 | 8057568493 | Bacteria | 7221719 |
| 335 | Ga0070707_100020884 | |||
| 336 | Ga0068868_100083294 | |||
| 337 | Ga0070660_100008647 | |||
| 338 | Ga0070660_100067199 | |||
| 339 | Ga0070661_100048354 | |||
| 340 | Ga0070692_10023803 | |||
| 341 | Ga0070673_100084366 | |||
| 342 | Ga0070709_10000275 | |||
| 343 | Ga0070714_100000637 | |||
| 344 | Ga0070714_100001636 | |||
| 345 | Ga0070714_100009433 | |||
| 346 | Ga0070714_100010392 | |||
| 347 | Ga0070713_100036083 | |||
| 348 | Ga0070713_100055391 | |||
| 349 | Ga0070710_10000036 | |||
| 350 | Ga0070710_10000421 | |||
| 351 | Ga0070711_100002524 | |||
| 352 | Ga0070708_100008639 | |||
| 353 | Ga0070663_100017439 | |||
| 354 | Ga0070663_100041779 | |||
| 355 | Ga0070685_10049240 | |||
| 356 | Ga0070706_100000827 | |||
| 357 | Ga0070706_100000837 | |||
| 358 | Ga0070706_100012874 | |||
| 359 | Ga0070706_100038735 | |||
| 360 | Ga0070706_100085173 | |||
| 361 | Ga0070707_100000884 | |||
| 362 | Ga0070707_100005124 | |||
| 363 | Ga0070707_100069482 | |||
| 364 | Ga0070698_100000449 | |||
| 365 | Ga0070698_100000835 | |||
| 366 | Ga0070698_100002668 | |||
| 367 | Ga0070698_100009354 | |||
| 368 | Ga0070698_100011209 | |||
| 369 | Ga0070698_100043080 | |||
| 370 | Ga0070699_100000709 | |||
| 371 | Ga0070699_100016803 | |||
| 372 | Ga0070679_100026959 | |||
| 373 | Ga0070684_100020605 | |||
| 374 | Ga0070684_100039098 | |||
| 375 | Ga0070704_100011039 | |||
| 376 | Ga0068854_100027187 | |||
| 377 | Ga0068856_100094144 | |||
| 378 | Ga0070702_100015315 | |||
| 379 | Ga0068859_100073031 | |||
| 380 | Ga0068858_100107891 | |||
| 381 | Ga0081540_1000004 | |||
| 382 | Ga0081540_1005697 | |||
| 383 | Ga0070717_10011664 | |||
| 384 | Ga0070717_10025832 | |||
| 385 | Ga0070717_10036076 | |||
| 386 | Ga0070715_10004563 | |||
| 387 | Ga0070716_100000065 | |||
| 388 | Ga0070716_100006540 | |||
| 389 | Ga0075428_100054998 | |||
| 390 | Ga0075429_100042906 | |||
| 391 | Ga0075436_100027840 | |||
| 392 | Ga0097620_100073029 | |||
| 393 | Ga0111539_10003709 | |||
| 394 | Ga0114129_10002729 | |||
| 395 | Ga0114129_10076855 | |||
| 396 | Ga0105243_10085394 | |||
| 397 | Ga0105249_10121086 | |||
| 398 | Ga0157371_10039687 | |||
| 399 | Ga0157369_10014369 | |||
| 400 | Ga0157369_10095854 | |||
| 401 | Ga0157374_10008687 | |||
| 402 | Ga0157378_10125523 | |||
| 403 | Ga0157377_10027265 | |||
| 404 | Ga0157379_10010743 | |||
| 405 | Ga0163161_10028575 | |||
| 406 | Ga0206354_10394616 | |||
| 407 | Ga0213875_10000242 | |||
| 408 | Ga0213875_10000557 | |||
| 409 | Ga0213875_10011916 | |||
| 410 | Ga0224712_10009860 | |||
| 411 | Ga0228598_1006665 | |||
| 412 | Ga0207692_10000092 | |||
| 413 | Ga0207692_10005639 | |||
| 414 | Ga0207688_10017705 | |||
| 415 | Ga0207647_10047490 | |||
| 416 | Ga0207699_10005363 | |||
| 417 | Ga0207684_10001051 | |||
| 418 | Ga0207684_10016626 | |||
| 419 | Ga0207671_10075830 | |||
| 420 | Ga0207693_10018977 | |||
| 421 | Ga0207663_10005069 | |||
| 422 | Ga0207663_10050435 | |||
| 423 | Ga0207657_10007929 | |||
| 424 | Ga0207652_10046166 | |||
| 425 | Ga0207652_10063621 | |||
| 426 | Ga0207646_10000437 | |||
| 427 | Ga0207646_10004933 | |||
| 428 | Ga0207646_10004957 | |||
| 429 | Ga0207646_10008588 | |||
| 430 | Ga0207646_10041079 | |||
| 431 | Ga0207700_10000317 | |||
| 432 | Ga0207700_10008827 | |||
| 433 | Ga0207700_10038864 | |||
| 434 | Ga0207700_10054269 | |||
| 435 | Ga0207664_10000137 | |||
| 436 | Ga0207664_10000603 | |||
| 437 | Ga0207664_10001441 | |||
| 438 | Ga0207664_10006530 | |||
| 439 | Ga0207664_10008695 | |||
| 440 | Ga0207664_10019073 | |||
| 441 | Ga0207664_10021825 | |||
| 442 | Ga0207664_10040395 | |||
| 443 | Ga0207706_10034910 | |||
| 444 | Ga0207665_10000254 | |||
| 445 | Ga0207665_10004874 | |||
| 446 | Ga0207691_10029764 | |||
| 447 | Ga0207689_10047602 | |||
| 448 | Ga0207658_10043003 | |||
| 449 | Ga0207678_10023030 | |||
| 450 | Ga0207678_10049232 | |||
| 451 | Ga0207708_10059627 | |||
| 452 | Ga0207648_10016530 | |||
| 453 | Ga0207676_10047053 | |||
| 454 | Ga0207674_10033124 | |||
| 455 | Ga0207674_10046347 | |||
| 456 | Ga0207675_100012094 | |||
| 457 | Ga0207428_10000283 | |||
| 458 | Ga0268266_10111664 | |||
| 459 | Ga0265337_1000514 | |||
| 460 | Ga0265319_1002615 | |||
| 461 | Ga0265334_10001236 | |||
| 462 | Ga0265336_10008342 | |||
| 463 | Ga0265338_10000997 | |||
| 464 | Ga0265338_10001906 | |||
| 465 | Ga0265324_10015301 | |||
| 466 | Ga0265332_10005904 | |||
| 467 | Ga0265320_10028030 | |||
| 468 | Ga0265325_10031414 | |||
| 469 | Ga0265314_10011503 | |||
| 470 | Ga0265342_10003816 | |||
| 471 | Ga0373934_0000035 | |||
| 472 | Ga0373934_0001477 | |||
| 473 | Ga0373934_0023664 | |||
| 474 | Ga0373940_0005793 | |||
| 475 | Ga0373951_0006971 | |||
| 476 | Ga0373923_0003006 | |||
| 477 | Ga0373923_0005591 | |||
| 478 | Ga0373923_0012912 | |||
| 479 | Ga0373936_0000928 | |||
| 480 | Ga0373936_0007252 | |||
| 481 | Ga0373941_0001312 | |||
| 482 | Ga0373945_0000161 | |||
| 483 | Ga0373953_0000048 | |||
| 484 | Ga0373953_0001216 | |||
| 485 | Ga0373954_0021793 | |||
| 486 | Ga0373956_0003348 | |||
| 487 | Ga0373956_0005993 | |||
| 488 | Ga0373956_0035452 | |||
| 489 | Ga0373957_0000003 | |||
| 490 | Ga0373957_0003160 | |||
| 491 | Ga0373943_0001371 | |||
| 492 | Ga0373943_0013423 | |||
| 493 | Ga0373946_0000157 | |||
| 494 | Ga0373946_0003327 | |||
| 495 | Ga0373955_0000083 | |||
| 496 | Ga0373955_0002916 | |||
| 497 | Ga0373942_0003554 | |||
| 498 | Ga0373924_0000124 | |||
| 499 | Ga0373924_0000249 | |||
| 500 | Ga0373935_0008791 | |||
| 501 | Ga0373927_0034946 | |||
| 502 | Ga0373933_0000001 | |||
| 503 | Ga0373933_0004513 | |||
| 504 | Ga0373947_0000001 | |||
| 505 | Ga0373947_0000869 | |||
| 506 | Ga0373947_0002445 | |||
| 507 | Ga0373937_0000033 | |||
| 508 | Ga0373937_0020581 | |||
| 509 | Ga0373937_0021887 | |||
| 510 | Ga0373925_0000009 | |||
| 511 | Ga0373925_0005533 | |||
| 512 | Ga0373925_0053674 | |||
| 513 | Ga0373925_0061070 | |||
| 514 | Ga0436364_0651483 | |||
| 515 | Ga0436364_0757195 | |||
| 516 | Ga0436364_0956908 | |||
| 517 | Ga0436364_1282495 | |||
| 518 | Ga0436364_1299779 | |||
| 519 | Ga0436363_1596727 | |||
| 520 | Ga0466966_0004274 | |||
| 521 | Ga0466966_0026113 | |||
| 522 | Ga0466963_0019595 | |||
| 523 | Ga0466959_0010646 | |||
| 524 | Ga0495592_0000002 | |||
| 525 | Ga0495592_0004474 | |||
| 526 | Ga0495592_0015064 | |||
| 527 | Ga0495603_0006862 | |||
| 528 | Ga0495629_0001025 | |||
| 529 | Ga0495629_0024715 | |||
| 530 | Ga0495629_0044787 | |||
| 531 | Ga0495651_0000002 | |||
| 532 | Ga0495651_0004163 | |||
| 533 | Ga0495651_0005979 | |||
| 534 | Ga0495651_0006347 | |||
| 535 | Ga0495651_0006863 | |||
| 536 | Ga0495651_0007461 | |||
| 537 | Ga0495651_0016894 | |||
| 538 | Ga0495653_0004963 | |||
| 539 | Ga0495653_0009655 | |||
| 540 | Ga0495653_0015481 | |||
| 541 | Ga0495653_0030530 | |||
| 542 | Ga0495653_0054159 | |||
| 543 | Ga0495580_0007398 | |||
| 544 | Ga0495582_0003247 | |||
| 545 | Ga0495639_0000178 | |||
| 546 | Ga0495639_0010567 | |||
| 547 | Ga0495662_0000896 | |||
| 548 | Ga0495664_0007037 | |||
| 549 | Ga0495608_0000027 | |||
| 550 | Ga0495608_0001626 | |||
| 551 | Ga0495608_0005385 | |||
| 552 | Ga0495618_0001032 | |||
| 553 | Ga0495628_0001429 | |||
| 554 | Ga0495628_0018685 | |||
| 555 | Ga0495628_0025453 | |||
| 556 | Ga0495630_0001021 | |||
| 557 | Ga0495630_0022569 | |||
| 558 | Ga0495666_0001034 | |||
| 559 | Ga0495652_0002179 | |||
| 560 | Ga0495652_0003958 | |||
| 561 | Ga0495652_0014759 | |||
| 562 | Ga0495652_0048654 | |||
| 563 | Ga0495665_0000624 | |||
| 564 | Ga0495640_0007437 | |||
| 565 | Ga0495640_0009620 | |||
| 566 | Ga0495640_0012150 | |||
| 567 | Ga0495586_0004433 | |||
| 568 | Ga0495587_0000013 | |||
| 569 | Ga0495587_0004563 | |||
| 570 | Ga0495587_0008911 | |||
| 571 | Ga0495587_0011394 | |||
| 572 | Ga0495645_0005027 | |||
| 573 | Ga0495645_0007474 | |||
| 574 | Ga0495645_0061711 | |||
| 575 | Ga0495667_0000016 | |||
| 576 | Ga0495667_0002000 | |||
| 577 | Ga0495667_0010865 | |||
| 578 | Ga0495667_0030370 | |||
| 579 | Ga0495634_0000635 | |||
| 580 | Ga0495635_0027094 | |||
| 581 | Ga0495635_0050309 | |||
| 582 | Ga0495657_0000014 | |||
| 583 | Ga0495657_0020994 | |||
| 584 | Ga0495599_0000006 | |||
| 585 | Ga0495599_0043129 | |||
| 586 | Ga0495599_0045495 | |||
| 587 | Ga0495623_0000042 | |||
| 588 | Ga0495623_0022062 | |||
| 589 | Ga0495646_0008859 | |||
| 590 | Ga0495646_0029765 | |||
| 591 | Ga0495613_0007686 | |||
| 592 | Ga0495624_0004976 | |||
| 593 | Ga0495624_0035246 | |||
| 594 | Ga0495600_0000498 | |||
| 595 | Ga0495600_0015256 | |||
| 596 | Ga0495581_0000108 | |||
| 597 | Ga0495604_0000015 | |||
| 598 | Ga0495604_0003632 | |||
| 599 | Ga0495604_0003706 | |||
| 600 | Ga0495604_0004559 | |||
| 601 | Ga0495676_0000849 | |||
| 602 | Ga0495680_0000009 | |||
| 603 | Ga0495680_0004307 | |||
| 604 | Ga0495680_0018291 | |||
| 605 | Ga0495675_0002183 | |||
| 606 | Ga0495675_0017996 | |||
| 607 | Ga0495684_0004367 | |||
| 608 | Ga0495684_0011655 | |||
| 609 | Ga0495684_0013956 | |||
| 610 | Ga0495593_0000581 | |||
| 611 | Ga0495593_0016761 | |||
| 612 | Ga0495602_0000013 | |||
| 613 | Ga0495602_0028869 | |||
| 614 | Ga0495614_0004184 | |||
| 615 | Ga0496101_0036694 | |||
| 616 | Ga0496102_0039437 | |||
| 617 | Ga0496102_0043781 | |||
| 618 | Ga0496103_0017098 | |||
| 619 | Ga0496104_0001661 | |||
| 620 | Ga0496104_0067823 | |||
| 621 | Ga0496105_0000697 | |||
| 622 | Ga0496105_0017549 | |||
| 623 | Ga0496105_0021197 | |||
| 624 | Ga0496106_0062167 | |||
| 625 | Ga0496108_0008242 | |||
| 626 | Ga0496108_0013255 | |||
| 627 | Ga0496111_0009286 | |||
| 628 | Ga0496112_0000365 | |||
| 629 | Ga0496112_0120875 | |||
| 630 | Ga0496113_0069226 | |||
| 631 | Ga0496115_0021386 | |||
| 632 | Ga0496115_0050900 | |||
| 633 | Ga0496121_0010579 | |||
| 634 | Ga0496126_0092945 | |||
| 635 | Ga0501034_0021699 | |||
| 636 | Ga0501036_0006434 | |||
| 637 | Ga0501043_0001199 | |||
| 638 | Ga0501047_0072181 | |||
| 639 | Ga0501048_0007951 | |||
| 640 | Ga0501074_0011389 | |||
| 641 | nmdc:mga05p37_49155_c1 | |||
| 642 | nmdc:mga0qj67_18504_c1 | |||
| 643 | nmdc:mga08y16_2960_c1 | |||
| 644 | nmdc:mga0n895_37634_c1 | |||
| 645 | nmdc:mga0a205_10179_c1 | |||
| 646 | Ga0495601_0000533 | |||
| 647 | Ga0495601_0017979 | |||
| 648 | Ga0495595_0008363 | |||
| 649 | Ga0495595_0012839 | |||
| 650 | Ga0495619_0017595 | |||
| 651 | Ga0495619_0026302 | |||
| 652 | Ga0495619_0026773 | |||
| 653 | Ga0500641_0002978 | |||
| 654 | 2676492144 | |||
| 655 | 2856745410 | |||
| 656 | 2861521038 | |||
| 657 | 2873320011 | |||
| 658 | 2884698277 | |||
| 659 | 2891397515 | |||
| 660 | 2891561362 | |||
| 661 | 2891569031 | |||
| 662 | 2895427348 | |||
| 663 | 2895450868 | |||
| 664 | 8053952958 | |||
| 665 | 8055066065 | |||
| 666 | 8055175337 | |||
| 667 | 8056065110 | |||
| 668 | 8057575085 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1wl8-assembly1.cif.gz_A | crystal structure of ph1346 protein from pyrococcus horikoshii | 0.9187 | 523 | 712 |
| 2d7j-assembly1.cif.gz_A | crystal structure analysis of glutamine amidotransferase from pyrococcus horikoshii ot3 | 0.914 | 524 | 713 |
| 1wl8-assembly1.cif.gz_A | crystal structure of ph1346 protein from pyrococcus horikoshii | 0.9001 | 523 | 712 |
| 1qdl-assembly1.cif.gz_B-2 | the crystal structure of anthranilate synthase from sulfolobus solfataricus | 0.8988 | 522 | 710 |
| 2ywb-assembly3.cif.gz_A | crystal structure of gmp synthetase from thermus thermophilus | 0.8986 | 524 | 713 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G099_1_189_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9296 | 524 | 710 | 3.40.50.880 |
| 1wl8A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9189 | 523 | 712 | 3.40.50.880 |
| af_Q57690_3_195_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9179 | 521 | 710 | 3.40.50.880 |
| af_P00903_1_187_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9177 | 524 | 710 | 3.40.50.880 |
| af_Q2G0Y6_3_196_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9152 | 518 | 713 | 3.40.50.880 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6B1PHU7-F1-model_v4 | deleted | 0.9693 | 542 | 709 |
|
| AF-A0A354Q5A3-F1-model_v4 | Anthranilate synthase component I | 0.962 | 522 | 722 |
GO:0000162
GO:0004049 GO:0005829 GO:0006541 |
| AF-A0A0G0BJG9-F1-model_v4 | Multifunctional fusion protein [Includes: Indole-3-glycerol phosphate synthase (IGPS) (EC 4.1.1.48); Anthranilate phosphoribosyltransferase (EC 2.4.2.18)] | 0.9609 | 522 | 709 |
GO:0000162
GO:0000287 GO:0004048 GO:0004049 GO:0004425 GO:0005829 GO:0006541 GO:0006568 |
| AF-A0A527GRA3-F1-model_v4 | Anthranilate synthase component I (EC 4.1.3.27) | 0.955 | 555 | 718 |
GO:0000162
GO:0004049 GO:0005829 GO:0006541 |
| AF-D5RU04-F1-model_v4 | Glutamine amidotransferase, class I (EC 4.1.3.27) | 0.9532 | 523 | 714 |
GO:0000162
GO:0004049 GO:0005829 GO:0006541 GO:0016740 |