F411671

General Info

Members Datasets Scaffolds Average Seq Length
334 161 668 139

Family's Representative Sequence

Representative Sequence 3300005444|Ga0070694_100016499|Ga0070694_1000164995
Length 153
Sequence VQWWQWLLISLGVILVIYASFLAWLVIRGRREDARAFATFIPDCIVLVTRLVRDPRVPRRRKLLLIALVAYLSLPFDLVPDFIPVAGQLDDAIIVALVLRYFVRAGGEPMIRELWPGPQQSLALILRLARAWWPSARTRPDRLTSRRVPSRVR

Samples

Sample ID Description Type Environment
1 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
43 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
107 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
108 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
112 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
113 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
114 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
115 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
116 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
117 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
118 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
119 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
120 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
121 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
122 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
123 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
124 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
125 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
126 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
127 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
128 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
129 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
130 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
131 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
132 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
133 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
134 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
135 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
136 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
137 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
138 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
139 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
140 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
141 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
142 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
143 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
144 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
145 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
146 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
147 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
148 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
149 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
150 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
151 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
152 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
154 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
155 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
156 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
157 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
158 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
159 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
160 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
161 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.9
Nodule 0
Rhizoplane 14.67
Rhizosphere 84.43
Stem 0
Stem Tuber 0
Unclassified 29.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070694_100016499 3300005444 Bacteria 4647
2 JGI24744J21845_10003355 3300002077 Unclassified 3289
3 Ga0070658_11043409 3300005327 Bacteria 711
4 Ga0068869_100710283 3300005334 Unclassified 858
5 Ga0070666_10154831 3300005335 Unclassified 1600
6 Ga0070682_100003597 3300005337 Bacteria 8587
7 Ga0070682_100204533 3300005337 Bacteria 1395
8 Ga0070682_100528788 3300005337 Unclassified 919
9 Ga0070682_101063061 3300005337 Unclassified 675
10 Ga0068868_100175754 3300005338 Bacteria 1774
11 Ga0070660_100220092 3300005339 Bacteria 1543
12 Ga0070691_10253831 3300005341 Unclassified 944
13 Ga0070692_10555556 3300005345 Bacteria 753
14 Ga0070668_100049954 3300005347 Bacteria 3219
15 Ga0070668_100208916 3300005347 Bacteria 1605
16 Ga0070688_100202818 3300005365 Unclassified 1388
17 Ga0070659_100429888 3300005366 Bacteria 1118
18 Ga0070703_10069189 3300005406 Unclassified 1175
19 Ga0070709_10013091 3300005434 Bacteria 4656
20 Ga0070709_10043160 3300005434 Bacteria 2787
21 Ga0070709_10136588 3300005434 Bacteria 1680
22 Ga0070714_100247484 3300005435 Bacteria 1647
23 Ga0070710_10019458 3300005437 Bacteria 3508
24 Ga0070701_10047995 3300005438 Unclassified 2201
25 Ga0070701_10512654 3300005438 Bacteria 781
26 Ga0070711_100118865 3300005439 Unclassified 1951
27 Ga0070711_100502780 3300005439 Bacteria 999
28 Ga0070705_100396548 3300005440 Bacteria 1021
29 Ga0070694_100151399 3300005444 Bacteria 1694
30 Ga0070694_100398298 3300005444 Bacteria 1077
31 Ga0070663_100098926 3300005455 Bacteria 2173
32 Ga0070663_100765924 3300005455 Bacteria 825
33 Ga0070678_100002170 3300005456 Bacteria 10653
34 Ga0070678_100052080 3300005456 Bacteria 2970
35 Ga0070678_100121633 3300005456 Bacteria 2059
36 Ga0070678_101249313 3300005456 Bacteria 690
37 Ga0070662_100031998 3300005457 Bacteria 3696
38 Ga0070662_100512707 3300005457 Bacteria 1001
39 Ga0070662_100743816 3300005457 Bacteria 831
40 Ga0070662_101055447 3300005457 Unclassified 696
41 Ga0068867_100005814 3300005459 Bacteria 8749
42 Ga0068867_100593817 3300005459 Unclassified 965
43 Ga0068867_100664169 3300005459 Bacteria 916
44 Ga0070685_10011884 3300005466 Bacteria 4564
45 Ga0070679_100657415 3300005530 Unclassified 991
46 Ga0070684_100012499 3300005535 Bacteria 6806
47 Ga0070684_100135310 3300005535 Bacteria 2225
48 Ga0070684_101309867 3300005535 Bacteria 682
49 Ga0070697_101460172 3300005536 Bacteria 611
50 Ga0068853_100105038 3300005539 Unclassified 2501
51 Ga0068853_100549932 3300005539 Unclassified 1093
52 Ga0070686_100343803 3300005544 Unclassified 1119
53 Ga0070695_100287866 3300005545 Bacteria 1210
54 Ga0070695_100413155 3300005545 Unclassified 1026
55 Ga0070696_100029381 3300005546 Bacteria 3757
56 Ga0070696_100186971 3300005546 Bacteria 1540
57 Ga0070693_100010721 3300005547 Bacteria 4596
58 Ga0070704_100033487 3300005549 Unclassified 3475
59 Ga0068855_100129464 3300005563 Bacteria 2883
60 Ga0068855_100210552 3300005563 Bacteria 2185
61 Ga0068856_100002581 3300005614 Bacteria 18656
62 Ga0068856_100391036 3300005614 Unclassified 1410
63 Ga0070702_100183630 3300005615 Bacteria 1371
64 Ga0070702_100253966 3300005615 Bacteria 1193
65 Ga0070702_100387508 3300005615 Unclassified 996
66 Ga0068866_10071267 3300005718 Unclassified 1837
67 Ga0068866_10585092 3300005718 Bacteria 751
68 Ga0068866_11177990 3300005718 Bacteria 552
69 Ga0068861_100012594 3300005719 Bacteria 5901
70 Ga0068861_100149108 3300005719 Bacteria 1917
71 Ga0068861_100727571 3300005719 Bacteria 925
72 Ga0068860_100826256 3300005843 Bacteria 941
73 Ga0068862_101070581 3300005844 Bacteria 800
74 Ga0081538_10004757 3300005981 Bacteria 12418
75 Ga0081538_10009007 3300005981 Bacteria 8382
76 Ga0075368_10437936 3300006042 Unclassified 578
77 Ga0070712_100396123 3300006175 Bacteria 1139
78 Ga0097621_101581673 3300006237 Unclassified 623
79 Ga0068871_101234669 3300006358 Unclassified 702
80 Ga0075428_100099124 3300006844 Bacteria 3177
81 Ga0075428_100124987 3300006844 Unclassified 2800
82 Ga0075428_101221844 3300006844 Unclassified 792
83 Ga0075431_100353955 3300006847 Unclassified 1476
84 Ga0075433_10024643 3300006852 Bacteria 5081
85 Ga0075433_10316154 3300006852 Bacteria 1382
86 Ga0075433_10365269 3300006852 Bacteria 1275
87 Ga0075433_10515104 3300006852 Bacteria 1052
88 Ga0075434_100108713 3300006871 Bacteria 2783
89 Ga0075434_100127048 3300006871 Bacteria 2566
90 Ga0075434_100143236 3300006871 Bacteria 2410
91 Ga0075434_100166200 3300006871 Bacteria 2226
92 Ga0075434_100453009 3300006871 Bacteria 1304
93 Ga0075434_101263953 3300006871 Unclassified 749
94 Ga0075429_100531174 3300006880 Unclassified 1031
95 Ga0075429_101407933 3300006880 Bacteria 607
96 Ga0068865_100007119 3300006881 Bacteria 6868
97 Ga0068865_100218251 3300006881 Unclassified 1490
98 Ga0075436_100104600 3300006914 Bacteria 1973
99 Ga0075436_100198229 3300006914 Bacteria 1421
100 Ga0075436_100336028 3300006914 Bacteria 1087
101 Ga0075435_100047246 3300007076 Bacteria 3456
102 Ga0075435_100112484 3300007076 Bacteria 2265
103 Ga0075435_100149836 3300007076 Bacteria 1960
104 Ga0075435_100179600 3300007076 Unclassified 1788
105 Ga0075435_100344282 3300007076 Bacteria 1277
106 Ga0075435_100958251 3300007076 Unclassified 747
107 Ga0105244_10284499 3300009036 Bacteria 767
108 Ga0105240_11620404 3300009093 Unclassified 677
109 Ga0111539_10027489 3300009094 Bacteria 6948
110 Ga0111539_10171097 3300009094 Bacteria 2538
111 Ga0111539_10302896 3300009094 Bacteria 1860
112 Ga0111539_10387283 3300009094 Unclassified 1628
113 Ga0111539_12158077 3300009094 Unclassified 646
114 Ga0105245_10015080 3300009098 Bacteria 6733
115 Ga0105245_10173501 3300009098 Bacteria 2055
116 Ga0105245_10199055 3300009098 Unclassified 1923
117 Ga0105245_10360727 3300009098 Bacteria 1442
118 Ga0105245_10456369 3300009098 Bacteria 1287
119 Ga0105245_10693332 3300009098 Bacteria 1051
120 Ga0114129_10032511 3300009147 Bacteria 7372
121 Ga0114129_10347019 3300009147 Bacteria 1967
122 Ga0114129_11093667 3300009147 Bacteria 998
123 Ga0114129_12191157 3300009147 Unclassified 665
124 Ga0114129_12510869 3300009147 Bacteria 616
125 Ga0105243_10010894 3300009148 Bacteria 6879
126 Ga0105243_10042444 3300009148 Unclassified 3561
127 Ga0105243_10148693 3300009148 Bacteria 2007
128 Ga0105243_10784726 3300009148 Unclassified 937
129 Ga0105241_10098901 3300009174 Bacteria 2315
130 Ga0105242_10003350 3300009176 Bacteria 12464
131 Ga0105242_10060019 3300009176 Bacteria 3122
132 Ga0105242_10972168 3300009176 Unclassified 855
133 Ga0105242_11981441 3300009176 Bacteria 624
134 Ga0105248_10453480 3300009177 Bacteria 1445
135 Ga0105248_11243673 3300009177 Unclassified 842
136 Ga0105237_10295502 3300009545 Unclassified 1623
137 Ga0105249_10001857 3300009553 Bacteria 18327
138 Ga0105249_10019101 3300009553 Bacteria 6113
139 Ga0105249_10061186 3300009553 Unclassified 3455
140 Ga0105249_10155416 3300009553 Unclassified 2205
141 Ga0105249_10557754 3300009553 Bacteria 1197
142 Ga0105249_10932650 3300009553 Bacteria 936
143 Ga0105239_10340044 3300010375 Bacteria 1694
144 Ga0105239_10946888 3300010375 Bacteria 989
145 Ga0105239_10951438 3300010375 Bacteria 987
146 Ga0105246_10057929 3300011119 Unclassified 2683
147 Ga0105246_10204051 3300011119 Unclassified 1539
148 Ga0157371_10382378 3300013102 Unclassified 1028
149 Ga0157378_10010623 3300013297 Bacteria 8048
150 Ga0163162_10066086 3300013306 Bacteria 3665
151 Ga0163162_10171622 3300013306 Bacteria 2293
152 Ga0157372_10215783 3300013307 Bacteria 2224
153 Ga0157372_13426341 3300013307 Bacteria 504
154 Ga0157375_10036676 3300013308 Unclassified 4692
155 Ga0157375_10260636 3300013308 Bacteria 1895
156 Ga0157375_10711258 3300013308 Bacteria 1158
157 Ga0157375_10791325 3300013308 Unclassified 1097
158 Ga0157375_11188515 3300013308 Unclassified 894
159 Ga0157375_11305846 3300013308 Bacteria 853
160 Ga0163163_10041397 3300014325 Bacteria 4505
161 Ga0157380_10124418 3300014326 Bacteria 2189
162 Ga0182008_10144125 3300014497 Bacteria 1193
163 Ga0182008_10822771 3300014497 Bacteria 541
164 Ga0157376_10488849 3300014969 Bacteria 1207
165 Ga0157376_10677975 3300014969 Bacteria 1034
166 Ga0163161_10315869 3300017792 Unclassified 1234
167 Ga0207642_10066035 3300025899 Unclassified 1702
168 Ga0207688_10055575 3300025901 Bacteria 2222
169 Ga0207647_10634314 3300025904 Unclassified 587
170 Ga0207693_10047720 3300025915 Bacteria 3364
171 Ga0207663_10052349 3300025916 Bacteria 2546
172 Ga0207663_10685805 3300025916 Unclassified 810
173 Ga0207657_10027256 3300025919 Bacteria 5234
174 Ga0207687_10107792 3300025927 Bacteria 2062
175 Ga0207687_10156739 3300025927 Bacteria 1743
176 Ga0207687_10180463 3300025927 Bacteria 1635
177 Ga0207687_10362783 3300025927 Bacteria 1183
178 Ga0207700_10134222 3300025928 Bacteria 2025
179 Ga0207664_10249488 3300025929 Bacteria 1549
180 Ga0207690_10111091 3300025932 Unclassified 1974
181 Ga0207706_10332543 3300025933 Bacteria 1322
182 Ga0207686_11189320 3300025934 Bacteria 624
183 Ga0207709_10027917 3300025935 Bacteria 3258
184 Ga0207669_10018980 3300025937 Bacteria 3570
185 Ga0207669_10252165 3300025937 Unclassified 1315
186 Ga0207704_10004966 3300025938 Bacteria 6119
187 Ga0207704_10222556 3300025938 Bacteria 1397
188 Ga0207704_11723488 3300025938 Bacteria 539
189 Ga0207711_10565769 3300025941 Unclassified 1060
190 Ga0207689_10429306 3300025942 Bacteria 1103
191 Ga0207661_10224838 3300025944 Unclassified 1660
192 Ga0207661_10681294 3300025944 Bacteria 945
193 Ga0207661_11323876 3300025944 Bacteria 662
194 Ga0207661_11398010 3300025944 Unclassified 642
195 Ga0207667_11872078 3300025949 Unclassified 563
196 Ga0207712_10062776 3300025961 Unclassified 2642
197 Ga0207712_10616049 3300025961 Bacteria 940
198 Ga0207668_10330140 3300025972 Bacteria 1269
199 Ga0207668_10787842 3300025972 Bacteria 841
200 Ga0207677_10253424 3300026023 Bacteria 1431
201 Ga0207678_10006708 3300026067 Bacteria 10210
202 Ga0207678_10828392 3300026067 Unclassified 817
203 Ga0207702_10035708 3300026078 Bacteria 4155
204 Ga0207702_10318911 3300026078 Unclassified 1480
205 Ga0207702_10384234 3300026078 Bacteria 1351
206 Ga0207648_10005898 3300026089 Bacteria 12253
207 Ga0207648_10063976 3300026089 Bacteria 3206
208 Ga0207675_100004495 3300026118 Bacteria 13471
209 Ga0207675_100258683 3300026118 Unclassified 1686
210 Ga0207675_101289045 3300026118 Unclassified 751
211 Ga0207683_10000864 3300026121 Bacteria 27760
212 Ga0207683_10597133 3300026121 Bacteria 1022
213 Ga0207683_11253788 3300026121 Bacteria 687
214 Ga0207698_10033525 3300026142 Bacteria 3732
215 Ga0209813_10359620 3300027866 Unclassified 578
216 Ga0207428_10180337 3300027907 Bacteria 1596
217 Ga0207428_10186395 3300027907 Unclassified 1565
218 Ga0268266_10264363 3300028379 Unclassified 1595
219 Ga0268265_10363944 3300028380 Bacteria 1325
220 Ga0268264_11077189 3300028381 Unclassified 812
221 Ga0268264_12190126 3300028381 Unclassified 561
222 Ga0373958_0003311 3300034819 Bacteria 2318
223 Ga0373928_0163769 3300035084 Unclassified 623
224 Ga0373944_0090941 3300035089 Unclassified 1020
225 Ga0373962_0010528 3300035242 Bacteria 2307
226 Ga0395899_0071630 3300037312 Bacteria 2536
227 Ga0395900_0021830 3300037418 Bacteria 6545
228 Ga0395900_0778618 3300037418 Bacteria 886
229 Ga0395900_1763552 3300037418 Bacteria 530
230 Ga0395898_0008805 3300037466 Bacteria 10636
231 Ga0395898_0376289 3300037466 Bacteria 1354
232 Ga0395898_0461217 3300037466 Bacteria 1210
233 Ga0395898_0736544 3300037466 Bacteria 927
234 Ga0395905_0012901 3300037471 Bacteria 8033
235 Ga0395905_0777930 3300037471 Unclassified 860
236 Ga0395901_0087291 3300038443 Bacteria 3261
237 Ga0395901_0276073 3300038443 Bacteria 1747
238 Ga0395901_0838086 3300038443 Bacteria 906
239 Ga0466969_0079765 3300044656 Bacteria 1564
240 Ga0466972_0600509 3300044658 Unclassified 520
241 Ga0466961_0435310 3300044693 Bacteria 794
242 Ga0466968_0040420 3300044735 Bacteria 1966
243 Ga0466959_0055915 3300045049 Bacteria 2880
244 Ga0466958_0016732 3300045836 Bacteria 4228
245 Ga0466967_1242326 3300045976 Bacteria 742
246 Ga0466967_1252783 3300045976 Bacteria 739
247 Ga0495603_0043665 3300046455 Bacteria 2676
248 Ga0495603_0434412 3300046455 Unclassified 752
249 Ga0495641_0256908 3300046461 Bacteria 786
250 Ga0495594_0019170 3300046499 Bacteria 3634
251 Ga0495642_0364583 3300046528 Bacteria 636
252 Ga0495656_0069547 3300046615 Bacteria 1560
253 Ga0495659_0062525 3300046664 Bacteria 1378
254 Ga0495659_0178199 3300046664 Bacteria 865
255 Ga0495647_0017085 3300046681 Bacteria 2563
256 Ga0495658_0039739 3300046683 Bacteria 2612
257 Ga0495676_0665909 3300047321 Bacteria 675
258 Ga0496100_0005844 3300048903 Bacteria 6658
259 Ga0496100_0057576 3300048903 Bacteria 2546
260 Ga0496100_0060285 3300048903 Unclassified 2497
261 Ga0496100_0334880 3300048903 Bacteria 1140
262 Ga0496100_1382317 3300048903 Unclassified 556
263 Ga0496101_0032575 3300048904 Bacteria 3670
264 Ga0496101_0035104 3300048904 Unclassified 3546
265 Ga0496101_0677484 3300048904 Bacteria 814
266 Ga0496101_0883242 3300048904 Unclassified 704
267 Ga0496102_0005960 3300048905 Bacteria 10381
268 Ga0496102_0424363 3300048905 Bacteria 1249
269 Ga0496103_0004656 3300048906 Bacteria 8308
270 Ga0496103_1060582 3300048906 Unclassified 502
271 Ga0496104_0002706 3300048907 Bacteria 15255
272 Ga0496104_0162025 3300048907 Bacteria 2145
273 Ga0496104_0561766 3300048907 Bacteria 1052
274 Ga0496104_1627694 3300048907 Unclassified 548
275 Ga0496105_0000426 3300048908 Bacteria 27682
276 Ga0496105_0034112 3300048908 Unclassified 4184
277 Ga0496106_0073343 3300048909 Bacteria 2618
278 Ga0496106_0357817 3300048909 Bacteria 1173
279 Ga0496106_0402579 3300048909 Bacteria 1100
280 Ga0496106_0482270 3300048909 Bacteria 996
281 Ga0496106_0722019 3300048909 Unclassified 793
282 Ga0496107_0003820 3300048910 Bacteria 10117
283 Ga0496107_0025343 3300048910 Bacteria 4199
284 Ga0496107_0219091 3300048910 Bacteria 1416
285 Ga0496108_0298170 3300048911 Bacteria 1404
286 Ga0496109_0012277 3300048912 Bacteria 7394
287 Ga0496109_0042963 3300048912 Bacteria 4097
288 Ga0496109_0466282 3300048912 Bacteria 1193
289 Ga0496110_0003957 3300048913 Bacteria 11395
290 Ga0496110_0754489 3300048913 Bacteria 876
291 Ga0496110_1266804 3300048913 Unclassified 646
292 Ga0496111_0000307 3300048914 Bacteria 24046
293 Ga0496111_0056416 3300048914 Bacteria 2842
294 Ga0496112_0469492 3300048915 Unclassified 1195
295 Ga0496112_0857532 3300048915 Bacteria 831
296 Ga0496113_0001067 3300048916 Bacteria 14809
297 Ga0496114_0005191 3300048917 Bacteria 10165
298 Ga0496114_0022805 3300048917 Bacteria 5102
299 Ga0496114_0216006 3300048917 Unclassified 1683
300 Ga0496114_0809130 3300048917 Unclassified 816
301 Ga0496114_0986899 3300048917 Unclassified 725
302 Ga0496115_0007822 3300048918 Bacteria 7880
303 Ga0496115_0021275 3300048918 Bacteria 5009
304 Ga0496115_0190334 3300048918 Unclassified 1695
305 Ga0496115_0363987 3300048918 Bacteria 1178
306 Ga0496115_0620063 3300048918 Bacteria 858
307 Ga0501042_0734466 3300049578 Bacteria 718
308 Ga0501076_1139043 3300049592 Bacteria 642
309 nmdc:mga04h51_396497_c1 3300050495 Unclassified 577
310 nmdc:mga05p37_346574_c1 3300050507 Unclassified 1750
311 nmdc:mga05p37_42022_c1 3300050507 Bacteria 5615
312 nmdc:mga05p37_73017_c1 3300050507 Bacteria 4222
313 nmdc:mga06r32_34736_c1 3300050510 Unclassified 4755
314 nmdc:mga08y16_372680_c1 3300050511 Unclassified 1464
315 nmdc:mga08y16_400279_c1 3300050511 Bacteria 1405
316 nmdc:mga08y16_480174_c1 3300050511 Bacteria 1265
317 nmdc:mga08y16_7228_c1 3300050511 Bacteria 11652
318 nmdc:mga0n895_314238_c1 3300050512 Bacteria 1588
319 nmdc:mga0n895_53137_c1 3300050512 Unclassified 3980
320 nmdc:mga0n895_549255_c1 3300050512 Bacteria 1161
321 nmdc:mga0n895_57978_c1 3300050512 Bacteria 3818
322 nmdc:mga0n895_992426_c1 3300050512 Bacteria 821
323 nmdc:mga0rr50_158865_c1 3300050513 Bacteria 1833
324 nmdc:mga0rr50_450886_c1 3300050513 Bacteria 1091
325 nmdc:mga0rr50_495456_c1 3300050513 Bacteria 1039
326 nmdc:mga0rr50_57190_c1 3300050513 Unclassified 2917
327 nmdc:mga0rr50_769614_c1 3300050513 Unclassified 822
328 nmdc:mga0rr50_80794_c1 3300050513 Plasmid 2507
329 nmdc:mga08x19_148049_c1 3300050514 Bacteria 1589
330 nmdc:mga08x19_228147_c1 3300050514 Archaea 1281
331 nmdc:mga0a205_1196261_c1 3300050515 Unclassified 608
332 nmdc:mga0a205_165242_c1 3300050515 Bacteria 2109
333 nmdc:mga0a205_222885_c1 3300050515 Bacteria 1771
334 nmdc:mga0a205_259478_c1 3300050515 Bacteria 1616
335 Ga0070694_100016499
336 JGI24744J21845_10003355
337 Ga0070658_11043409
338 Ga0068869_100710283
339 Ga0070666_10154831
340 Ga0070682_100003597
341 Ga0070682_100204533
342 Ga0070682_100528788
343 Ga0070682_101063061
344 Ga0068868_100175754
345 Ga0070660_100220092
346 Ga0070691_10253831
347 Ga0070692_10555556
348 Ga0070668_100049954
349 Ga0070668_100208916
350 Ga0070688_100202818
351 Ga0070659_100429888
352 Ga0070703_10069189
353 Ga0070709_10013091
354 Ga0070709_10043160
355 Ga0070709_10136588
356 Ga0070714_100247484
357 Ga0070710_10019458
358 Ga0070701_10047995
359 Ga0070701_10512654
360 Ga0070711_100118865
361 Ga0070711_100502780
362 Ga0070705_100396548
363 Ga0070694_100151399
364 Ga0070694_100398298
365 Ga0070663_100098926
366 Ga0070663_100765924
367 Ga0070678_100002170
368 Ga0070678_100052080
369 Ga0070678_100121633
370 Ga0070678_101249313
371 Ga0070662_100031998
372 Ga0070662_100512707
373 Ga0070662_100743816
374 Ga0070662_101055447
375 Ga0068867_100005814
376 Ga0068867_100593817
377 Ga0068867_100664169
378 Ga0070685_10011884
379 Ga0070679_100657415
380 Ga0070684_100012499
381 Ga0070684_100135310
382 Ga0070684_101309867
383 Ga0070697_101460172
384 Ga0068853_100105038
385 Ga0068853_100549932
386 Ga0070686_100343803
387 Ga0070695_100287866
388 Ga0070695_100413155
389 Ga0070696_100029381
390 Ga0070696_100186971
391 Ga0070693_100010721
392 Ga0070704_100033487
393 Ga0068855_100129464
394 Ga0068855_100210552
395 Ga0068856_100002581
396 Ga0068856_100391036
397 Ga0070702_100183630
398 Ga0070702_100253966
399 Ga0070702_100387508
400 Ga0068866_10071267
401 Ga0068866_10585092
402 Ga0068866_11177990
403 Ga0068861_100012594
404 Ga0068861_100149108
405 Ga0068861_100727571
406 Ga0068860_100826256
407 Ga0068862_101070581
408 Ga0081538_10004757
409 Ga0081538_10009007
410 Ga0075368_10437936
411 Ga0070712_100396123
412 Ga0097621_101581673
413 Ga0068871_101234669
414 Ga0075428_100099124
415 Ga0075428_100124987
416 Ga0075428_101221844
417 Ga0075431_100353955
418 Ga0075433_10024643
419 Ga0075433_10316154
420 Ga0075433_10365269
421 Ga0075433_10515104
422 Ga0075434_100108713
423 Ga0075434_100127048
424 Ga0075434_100143236
425 Ga0075434_100166200
426 Ga0075434_100453009
427 Ga0075434_101263953
428 Ga0075429_100531174
429 Ga0075429_101407933
430 Ga0068865_100007119
431 Ga0068865_100218251
432 Ga0075436_100104600
433 Ga0075436_100198229
434 Ga0075436_100336028
435 Ga0075435_100047246
436 Ga0075435_100112484
437 Ga0075435_100149836
438 Ga0075435_100179600
439 Ga0075435_100344282
440 Ga0075435_100958251
441 Ga0105244_10284499
442 Ga0105240_11620404
443 Ga0111539_10027489
444 Ga0111539_10171097
445 Ga0111539_10302896
446 Ga0111539_10387283
447 Ga0111539_12158077
448 Ga0105245_10015080
449 Ga0105245_10173501
450 Ga0105245_10199055
451 Ga0105245_10360727
452 Ga0105245_10456369
453 Ga0105245_10693332
454 Ga0114129_10032511
455 Ga0114129_10347019
456 Ga0114129_11093667
457 Ga0114129_12191157
458 Ga0114129_12510869
459 Ga0105243_10010894
460 Ga0105243_10042444
461 Ga0105243_10148693
462 Ga0105243_10784726
463 Ga0105241_10098901
464 Ga0105242_10003350
465 Ga0105242_10060019
466 Ga0105242_10972168
467 Ga0105242_11981441
468 Ga0105248_10453480
469 Ga0105248_11243673
470 Ga0105237_10295502
471 Ga0105249_10001857
472 Ga0105249_10019101
473 Ga0105249_10061186
474 Ga0105249_10155416
475 Ga0105249_10557754
476 Ga0105249_10932650
477 Ga0105239_10340044
478 Ga0105239_10946888
479 Ga0105239_10951438
480 Ga0105246_10057929
481 Ga0105246_10204051
482 Ga0157371_10382378
483 Ga0157378_10010623
484 Ga0163162_10066086
485 Ga0163162_10171622
486 Ga0157372_10215783
487 Ga0157372_13426341
488 Ga0157375_10036676
489 Ga0157375_10260636
490 Ga0157375_10711258
491 Ga0157375_10791325
492 Ga0157375_11188515
493 Ga0157375_11305846
494 Ga0163163_10041397
495 Ga0157380_10124418
496 Ga0182008_10144125
497 Ga0182008_10822771
498 Ga0157376_10488849
499 Ga0157376_10677975
500 Ga0163161_10315869
501 Ga0207642_10066035
502 Ga0207688_10055575
503 Ga0207647_10634314
504 Ga0207693_10047720
505 Ga0207663_10052349
506 Ga0207663_10685805
507 Ga0207657_10027256
508 Ga0207687_10107792
509 Ga0207687_10156739
510 Ga0207687_10180463
511 Ga0207687_10362783
512 Ga0207700_10134222
513 Ga0207664_10249488
514 Ga0207690_10111091
515 Ga0207706_10332543
516 Ga0207686_11189320
517 Ga0207709_10027917
518 Ga0207669_10018980
519 Ga0207669_10252165
520 Ga0207704_10004966
521 Ga0207704_10222556
522 Ga0207704_11723488
523 Ga0207711_10565769
524 Ga0207689_10429306
525 Ga0207661_10224838
526 Ga0207661_10681294
527 Ga0207661_11323876
528 Ga0207661_11398010
529 Ga0207667_11872078
530 Ga0207712_10062776
531 Ga0207712_10616049
532 Ga0207668_10330140
533 Ga0207668_10787842
534 Ga0207677_10253424
535 Ga0207678_10006708
536 Ga0207678_10828392
537 Ga0207702_10035708
538 Ga0207702_10318911
539 Ga0207702_10384234
540 Ga0207648_10005898
541 Ga0207648_10063976
542 Ga0207675_100004495
543 Ga0207675_100258683
544 Ga0207675_101289045
545 Ga0207683_10000864
546 Ga0207683_10597133
547 Ga0207683_11253788
548 Ga0207698_10033525
549 Ga0209813_10359620
550 Ga0207428_10180337
551 Ga0207428_10186395
552 Ga0268266_10264363
553 Ga0268265_10363944
554 Ga0268264_11077189
555 Ga0268264_12190126
556 Ga0373958_0003311
557 Ga0373928_0163769
558 Ga0373944_0090941
559 Ga0373962_0010528
560 Ga0395899_0071630
561 Ga0395900_0021830
562 Ga0395900_0778618
563 Ga0395900_1763552
564 Ga0395898_0008805
565 Ga0395898_0376289
566 Ga0395898_0461217
567 Ga0395898_0736544
568 Ga0395905_0012901
569 Ga0395905_0777930
570 Ga0395901_0087291
571 Ga0395901_0276073
572 Ga0395901_0838086
573 Ga0466969_0079765
574 Ga0466972_0600509
575 Ga0466961_0435310
576 Ga0466968_0040420
577 Ga0466959_0055915
578 Ga0466958_0016732
579 Ga0466967_1242326
580 Ga0466967_1252783
581 Ga0495603_0043665
582 Ga0495603_0434412
583 Ga0495641_0256908
584 Ga0495594_0019170
585 Ga0495642_0364583
586 Ga0495656_0069547
587 Ga0495659_0062525
588 Ga0495659_0178199
589 Ga0495647_0017085
590 Ga0495658_0039739
591 Ga0495676_0665909
592 Ga0496100_0005844
593 Ga0496100_0057576
594 Ga0496100_0060285
595 Ga0496100_0334880
596 Ga0496100_1382317
597 Ga0496101_0032575
598 Ga0496101_0035104
599 Ga0496101_0677484
600 Ga0496101_0883242
601 Ga0496102_0005960
602 Ga0496102_0424363
603 Ga0496103_0004656
604 Ga0496103_1060582
605 Ga0496104_0002706
606 Ga0496104_0162025
607 Ga0496104_0561766
608 Ga0496104_1627694
609 Ga0496105_0000426
610 Ga0496105_0034112
611 Ga0496106_0073343
612 Ga0496106_0357817
613 Ga0496106_0402579
614 Ga0496106_0482270
615 Ga0496106_0722019
616 Ga0496107_0003820
617 Ga0496107_0025343
618 Ga0496107_0219091
619 Ga0496108_0298170
620 Ga0496109_0012277
621 Ga0496109_0042963
622 Ga0496109_0466282
623 Ga0496110_0003957
624 Ga0496110_0754489
625 Ga0496110_1266804
626 Ga0496111_0000307
627 Ga0496111_0056416
628 Ga0496112_0469492
629 Ga0496112_0857532
630 Ga0496113_0001067
631 Ga0496114_0005191
632 Ga0496114_0022805
633 Ga0496114_0216006
634 Ga0496114_0809130
635 Ga0496114_0986899
636 Ga0496115_0007822
637 Ga0496115_0021275
638 Ga0496115_0190334
639 Ga0496115_0363987
640 Ga0496115_0620063
641 Ga0501042_0734466
642 Ga0501076_1139043
643 nmdc:mga04h51_396497_c1
644 nmdc:mga05p37_346574_c1
645 nmdc:mga05p37_42022_c1
646 nmdc:mga05p37_73017_c1
647 nmdc:mga06r32_34736_c1
648 nmdc:mga08y16_372680_c1
649 nmdc:mga08y16_400279_c1
650 nmdc:mga08y16_480174_c1
651 nmdc:mga08y16_7228_c1
652 nmdc:mga0n895_314238_c1
653 nmdc:mga0n895_53137_c1
654 nmdc:mga0n895_549255_c1
655 nmdc:mga0n895_57978_c1
656 nmdc:mga0n895_992426_c1
657 nmdc:mga0rr50_158865_c1
658 nmdc:mga0rr50_450886_c1
659 nmdc:mga0rr50_495456_c1
660 nmdc:mga0rr50_57190_c1
661 nmdc:mga0rr50_769614_c1
662 nmdc:mga0rr50_80794_c1
663 nmdc:mga08x19_148049_c1
664 nmdc:mga08x19_228147_c1
665 nmdc:mga0a205_1196261_c1
666 nmdc:mga0a205_165242_c1
667 nmdc:mga0a205_222885_c1
668 nmdc:mga0a205_259478_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06803

DUF1232

Protein of unknown function (DUF1232)

61

97

0.96

Map