F411328

General Info

Members Datasets Scaffolds Average Seq Length
333 172 666 102

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_12201064|Ga0111539_122010642
Length 116
Sequence MKKGHEMIRKLPTFAVTAIAAGAVFAGCTTYKLWTESDSNQAEGTIQLSYEYRKFESPQVDERAGVELARERCGDWGFRNGAARKGEERICIDGTQSDCAKWRVVREYRCLREPAH

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
52 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
117 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
118 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
119 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
120 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
121 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
122 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
123 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
124 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
125 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
126 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
127 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
128 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
129 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
130 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
131 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
132 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
133 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
134 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
135 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
136 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
137 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
138 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
139 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
140 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
141 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
142 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
143 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
144 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
145 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
146 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
147 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
148 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
149 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
150 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
151 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
152 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
153 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
154 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
155 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
156 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
158 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
159 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
160 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
161 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
162 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
163 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
164 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
165 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
166 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
167 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
168 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
169 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
170 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
171 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
172 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.6
Nodule 0
Rhizoplane 8.41
Rhizosphere 86.19
Stem 0
Stem Tuber 0
Unclassified 24.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_12201064 3300009094 Unclassified 640
2 rootH2_10043698 3300003320 Bacteria 1263
3 rootL2_10385396 3300003322 Bacteria 1271
4 rootH1_10115064 3300003323 Bacteria 1883
5 Ga0070676_10138112 3300005328 Bacteria 1548
6 Ga0070676_10222091 3300005328 Bacteria 1248
7 Ga0070676_10891358 3300005328 Bacteria 662
8 Ga0070683_100766497 3300005329 Bacteria 924
9 Ga0070670_100010478 3300005331 Bacteria 7912
10 Ga0070670_100315969 3300005331 Bacteria 1368
11 Ga0070670_100896948 3300005331 Bacteria 803
12 Ga0070677_10053313 3300005333 Bacteria 1643
13 Ga0070677_10074728 3300005333 Bacteria 1434
14 Ga0070677_10461905 3300005333 Bacteria 681
15 Ga0068869_100033219 3300005334 Bacteria 3641
16 Ga0068869_100114108 3300005334 Bacteria 2059
17 Ga0068869_101626675 3300005334 Bacteria 575
18 Ga0070666_11205431 3300005335 Unclassified 564
19 Ga0070682_100023830 3300005337 Bacteria 3638
20 Ga0070682_100112664 3300005337 Bacteria 1816
21 Ga0070682_100354795 3300005337 Bacteria 1095
22 Ga0070682_100685189 3300005337 Bacteria 820
23 Ga0068868_100707687 3300005338 Bacteria 902
24 Ga0068868_100777728 3300005338 Bacteria 862
25 Ga0070689_100436069 3300005340 Bacteria 1113
26 Ga0070691_11020406 3300005341 Bacteria 517
27 Ga0070687_100059275 3300005343 Bacteria 2015
28 Ga0070692_10278683 3300005345 Unclassified 1012
29 Ga0070668_100070467 3300005347 Bacteria 2721
30 Ga0070668_100515978 3300005347 Bacteria 1036
31 Ga0070669_100046861 3300005353 Bacteria 3152
32 Ga0070669_100406058 3300005353 Bacteria 1115
33 Ga0070669_100478626 3300005353 Unclassified 1030
34 Ga0070675_100017056 3300005354 Bacteria 5772
35 Ga0070675_100036048 3300005354 Bacteria 4023
36 Ga0070675_100214578 3300005354 Bacteria 1674
37 Ga0070675_102229987 3300005354 Unclassified 504
38 Ga0070671_101555315 3300005355 Unclassified 586
39 Ga0070674_100214411 3300005356 Bacteria 1494
40 Ga0070674_100353792 3300005356 Bacteria 1187
41 Ga0070673_100064476 3300005364 Bacteria 2919
42 Ga0070673_100082848 3300005364 Bacteria 2604
43 Ga0070688_100353265 3300005365 Bacteria 1077
44 Ga0070688_100665961 3300005365 Unclassified 803
45 Ga0070667_100411204 3300005367 Bacteria 1232
46 Ga0070667_100757193 3300005367 Unclassified 900
47 Ga0070667_101021143 3300005367 Unclassified 772
48 Ga0070701_10031563 3300005438 Bacteria 2629
49 Ga0070701_10056956 3300005438 Bacteria 2047
50 Ga0070701_10181182 3300005438 Bacteria 1233
51 Ga0070711_100103511 3300005439 Bacteria 2075
52 Ga0070700_100050362 3300005441 Bacteria 2589
53 Ga0070700_100175735 3300005441 Bacteria 1486
54 Ga0070700_100370130 3300005441 Unclassified 1068
55 Ga0070700_100589743 3300005441 Bacteria 869
56 Ga0070700_100615518 3300005441 Unclassified 853
57 Ga0070700_100661887 3300005441 Unclassified 826
58 Ga0070694_101845562 3300005444 Unclassified 515
59 Ga0070678_100029506 3300005456 Bacteria 3757
60 Ga0070678_100091150 3300005456 Bacteria 2338
61 Ga0070662_100172623 3300005457 Bacteria 1699
62 Ga0070662_100798488 3300005457 Bacteria 802
63 Ga0068867_100006805 3300005459 Bacteria 8082
64 Ga0068867_100727340 3300005459 Bacteria 878
65 Ga0068867_101034612 3300005459 Unclassified 746
66 Ga0070685_10011268 3300005466 Bacteria 4679
67 Ga0070685_10506773 3300005466 Unclassified 855
68 Ga0070685_10684956 3300005466 Unclassified 746
69 Ga0068853_100867433 3300005539 Unclassified 866
70 Ga0070672_100013528 3300005543 Bacteria 5767
71 Ga0070672_100044816 3300005543 Bacteria 3418
72 Ga0070672_100046431 3300005543 Bacteria 3365
73 Ga0070672_100862705 3300005543 Bacteria 798
74 Ga0070686_100020106 3300005544 Bacteria 3948
75 Ga0070686_100239214 3300005544 Unclassified 1321
76 Ga0070686_101959251 3300005544 Unclassified 501
77 Ga0070695_101885292 3300005545 Unclassified 502
78 Ga0070693_100860898 3300005547 Bacteria 676
79 Ga0070665_100431931 3300005548 Bacteria 1326
80 Ga0070665_100651776 3300005548 Unclassified 1066
81 Ga0070665_100983464 3300005548 Bacteria 856
82 Ga0070664_100218798 3300005564 Bacteria 1703
83 Ga0070664_100356661 3300005564 Bacteria 1331
84 Ga0070664_100824498 3300005564 Bacteria 868
85 Ga0070664_100840848 3300005564 Bacteria 859
86 Ga0068857_100175567 3300005577 Bacteria 1949
87 Ga0068854_100207045 3300005578 Bacteria 1545
88 Ga0068854_101041836 3300005578 Bacteria 726
89 Ga0070702_100356707 3300005615 Bacteria 1032
90 Ga0070702_100377231 3300005615 Bacteria 1007
91 Ga0070702_100626583 3300005615 Bacteria 810
92 Ga0068859_100660691 3300005617 Bacteria 1137
93 Ga0068859_101415653 3300005617 Unclassified 767
94 Ga0068864_100061579 3300005618 Bacteria 3251
95 Ga0068864_100351872 3300005618 Bacteria 1390
96 Ga0068866_10077133 3300005718 Bacteria 1779
97 Ga0068861_100030033 3300005719 Bacteria 3981
98 Ga0068861_100110998 3300005719 Bacteria 2197
99 Ga0068861_100558321 3300005719 Bacteria 1044
100 Ga0068861_100648631 3300005719 Unclassified 975
101 Ga0068851_10086121 3300005834 Bacteria 1648
102 Ga0068870_10102956 3300005840 Bacteria 1617
103 Ga0068870_10133559 3300005840 Bacteria 1444
104 Ga0068870_10804700 3300005840 Unclassified 657
105 Ga0068870_10850909 3300005840 Unclassified 641
106 Ga0068862_100121162 3300005844 Bacteria 2306
107 Ga0068862_100269810 3300005844 Bacteria 1556
108 Ga0068862_100369648 3300005844 Bacteria 1334
109 Ga0068862_100520509 3300005844 Unclassified 1132
110 Ga0081455_10019871 3300005937 Bacteria 6343
111 Ga0070715_10293486 3300006163 Unclassified 867
112 Ga0075366_10354082 3300006195 Bacteria 901
113 Ga0097621_100042211 3300006237 Bacteria 3673
114 Ga0097621_100249641 3300006237 Bacteria 1553
115 Ga0097621_101501009 3300006237 Bacteria 639
116 Ga0068871_100018440 3300006358 Bacteria 5304
117 Ga0068871_100105015 3300006358 Bacteria 2370
118 Ga0068871_100105969 3300006358 Bacteria 2359
119 Ga0068871_100214606 3300006358 Bacteria 1665
120 Ga0068871_100582808 3300006358 Bacteria 1016
121 Ga0075430_101130649 3300006846 Bacteria 645
122 Ga0075429_100302116 3300006880 Bacteria 1401
123 Ga0068865_100039992 3300006881 Bacteria 3184
124 Ga0068865_100138814 3300006881 Bacteria 1830
125 Ga0097620_100660626 3300006931 Bacteria 1137
126 Ga0097620_101415632 3300006931 Unclassified 767
127 Ga0097620_102424122 3300006931 Bacteria 578
128 Ga0111539_11264947 3300009094 Bacteria 856
129 Ga0105245_10415815 3300009098 Bacteria 1347
130 Ga0105243_10055679 3300009148 Bacteria 3142
131 Ga0105242_10424597 3300009176 Bacteria 1247
132 Ga0105242_13149529 3300009176 Unclassified 512
133 Ga0105248_10655309 3300009177 Bacteria 1185
134 Ga0105248_12554862 3300009177 Unclassified 582
135 Ga0105248_12904334 3300009177 Unclassified 546
136 Ga0105238_11018225 3300009551 Unclassified 849
137 Ga0105249_10665087 3300009553 Bacteria 1100
138 Ga0157378_11778623 3300013297 Unclassified 664
139 Ga0157378_12692871 3300013297 Unclassified 550
140 Ga0163162_10039499 3300013306 Bacteria 4716
141 Ga0157375_10324279 3300013308 Bacteria 1705
142 Ga0157375_11218512 3300013308 Bacteria 883
143 Ga0163163_10027283 3300014325 Bacteria 5469
144 Ga0163163_10271758 3300014325 Bacteria 1746
145 Ga0163163_12478776 3300014325 Unclassified 577
146 Ga0163163_13159424 3300014325 Unclassified 514
147 Ga0157380_10017385 3300014326 Bacteria 5322
148 Ga0157380_10262846 3300014326 Bacteria 1568
149 Ga0157380_10424639 3300014326 Bacteria 1269
150 Ga0157379_10254146 3300014968 Bacteria 1596
151 Ga0157376_10806325 3300014969 Bacteria 952
152 Ga0157376_11070719 3300014969 Bacteria 831
153 Ga0163161_10548002 3300017792 Bacteria 948
154 Ga0163161_10801693 3300017792 Unclassified 791
155 Ga0207697_10037828 3300025315 Bacteria 1978
156 Ga0207682_10042864 3300025893 Bacteria 1850
157 Ga0207682_10056905 3300025893 Bacteria 1629
158 Ga0207692_10440252 3300025898 Bacteria 819
159 Ga0207642_10712213 3300025899 Unclassified 633
160 Ga0207685_10134031 3300025905 Bacteria 1103
161 Ga0207645_10213466 3300025907 Bacteria 1271
162 Ga0207643_10012501 3300025908 Bacteria 4587
163 Ga0207643_10018892 3300025908 Bacteria 3775
164 Ga0207662_10486371 3300025918 Unclassified 848
165 Ga0207649_10210739 3300025920 Bacteria 1378
166 Ga0207681_10368733 3300025923 Bacteria 1153
167 Ga0207681_11289713 3300025923 Unclassified 613
168 Ga0207681_11439142 3300025923 Unclassified 578
169 Ga0207694_10665455 3300025924 Unclassified 878
170 Ga0207650_10029624 3300025925 Bacteria 3936
171 Ga0207650_10170144 3300025925 Bacteria 1731
172 Ga0207650_10857383 3300025925 Bacteria 771
173 Ga0207659_10668559 3300025926 Bacteria 888
174 Ga0207659_11859229 3300025926 Unclassified 511
175 Ga0207687_10292697 3300025927 Bacteria 1309
176 Ga0207644_10473598 3300025931 Bacteria 1031
177 Ga0207644_10635228 3300025931 Bacteria 888
178 Ga0207644_11505950 3300025931 Unclassified 565
179 Ga0207644_11575850 3300025931 Unclassified 551
180 Ga0207706_10073827 3300025933 Bacteria 2999
181 Ga0207706_10572566 3300025933 Bacteria 971
182 Ga0207686_10988889 3300025934 Bacteria 682
183 Ga0207686_11025613 3300025934 Unclassified 670
184 Ga0207709_10114740 3300025935 Bacteria 1808
185 Ga0207670_10156879 3300025936 Bacteria 1695
186 Ga0207669_10003702 3300025937 Bacteria 6651
187 Ga0207669_10010373 3300025937 Bacteria 4482
188 Ga0207669_10658030 3300025937 Bacteria 857
189 Ga0207704_10120119 3300025938 Bacteria 1796
190 Ga0207691_10008794 3300025940 Bacteria 9683
191 Ga0207691_10028714 3300025940 Bacteria 5205
192 Ga0207691_10058663 3300025940 Bacteria 3500
193 Ga0207691_10093000 3300025940 Bacteria 2700
194 Ga0207711_10375615 3300025941 Bacteria 1319
195 Ga0207711_11269855 3300025941 Bacteria 678
196 Ga0207689_10066498 3300025942 Bacteria 2963
197 Ga0207689_10163849 3300025942 Bacteria 1832
198 Ga0207689_11302770 3300025942 Unclassified 610
199 Ga0207661_10689958 3300025944 Bacteria 939
200 Ga0207679_11221799 3300025945 Bacteria 690
201 Ga0207679_11492207 3300025945 Unclassified 620
202 Ga0207651_10037780 3300025960 Bacteria 3166
203 Ga0207651_10297123 3300025960 Bacteria 1341
204 Ga0207651_11454508 3300025960 Unclassified 617
205 Ga0207668_10101805 3300025972 Bacteria 2136
206 Ga0207668_10735573 3300025972 Bacteria 869
207 Ga0207668_10755414 3300025972 Bacteria 858
208 Ga0207640_10193240 3300025981 Bacteria 1536
209 Ga0207658_11259009 3300025986 Unclassified 676
210 Ga0207658_11668198 3300025986 Bacteria 582
211 Ga0207677_11251001 3300026023 Bacteria 681
212 Ga0207639_10564607 3300026041 Bacteria 1046
213 Ga0207678_11102757 3300026067 Unclassified 703
214 Ga0207708_10035193 3300026075 Bacteria 3811
215 Ga0207708_10081089 3300026075 Bacteria 2493
216 Ga0207708_10486511 3300026075 Bacteria 1032
217 Ga0207708_10571893 3300026075 Bacteria 955
218 Ga0207641_10099329 3300026088 Bacteria 2561
219 Ga0207641_10252814 3300026088 Bacteria 1646
220 Ga0207641_11527811 3300026088 Bacteria 669
221 Ga0207648_10032177 3300026089 Bacteria 4632
222 Ga0207648_10064532 3300026089 Bacteria 3192
223 Ga0207648_10481658 3300026089 Unclassified 1133
224 Ga0207648_10886530 3300026089 Bacteria 833
225 Ga0207676_10376697 3300026095 Unclassified 1320
226 Ga0207676_10694252 3300026095 Bacteria 985
227 Ga0207674_10268284 3300026116 Bacteria 1654
228 Ga0207675_100019644 3300026118 Bacteria 6306
229 Ga0207675_100041661 3300026118 Bacteria 4288
230 Ga0207675_100581554 3300026118 Bacteria 1121
231 Ga0207675_101158210 3300026118 Unclassified 793
232 Ga0207683_10012355 3300026121 Bacteria 7285
233 Ga0207683_10019124 3300026121 Bacteria 5846
234 Ga0207428_10423385 3300027907 Bacteria 973
235 Ga0268266_10239607 3300028379 Bacteria 1674
236 Ga0268266_10383298 3300028379 Bacteria 1326
237 Ga0268266_10502243 3300028379 Bacteria 1158
238 Ga0268265_10078011 3300028380 Bacteria 2604
239 Ga0268265_10485376 3300028380 Bacteria 1161
240 Ga0268265_10509783 3300028380 Unclassified 1135
241 Ga0268265_10673160 3300028380 Unclassified 997
242 Ga0307515_10186022 3300028794 Bacteria 2006
243 Ga0307513_10009183 3300031456 Bacteria 12517
244 Ga0307513_10031651 3300031456 Bacteria 5986
245 Ga0307509_10085532 3300031507 Bacteria 3245
246 Ga0307408_100440347 3300031548 Unclassified 1128
247 Ga0307514_10128339 3300031649 Bacteria 1752
248 Ga0307405_10097443 3300031731 Bacteria 1964
249 Ga0307410_10074463 3300031852 Bacteria 2365
250 Ga0307407_10801606 3300031903 Unclassified 716
251 Ga0307409_100158629 3300031995 Bacteria 1975
252 Ga0307409_100232814 3300031995 Bacteria 1671
253 Ga0307409_100817021 3300031995 Bacteria 941
254 Ga0307411_10068704 3300032005 Bacteria 2390
255 Ga0307411_10166212 3300032005 Bacteria 1659
256 Ga0307411_10934506 3300032005 Bacteria 772
257 Ga0307415_100314930 3300032126 Bacteria 1302
258 Ga0307415_101594807 3300032126 Unclassified 627
259 Ga0451787_244844 3300041441 Bacteria 1152
260 Ga0451789_0061707 3300041443 Unclassified 533
261 Ga0451789_0199066 3300041443 Bacteria 1817
262 Ga0451789_0475072 3300041443 Bacteria 825
263 Ga0451789_0938274 3300041443 Unclassified 695
264 Ga0451791_0618861 3300041451 Bacteria 2966
265 Ga0451791_0672547 3300041451 Bacteria 1151
266 Ga0451791_1447370 3300041451 Bacteria 799
267 Ga0451791_1558695 3300041451 Bacteria 1398
268 Ga0451793_1328527 3300041452 Bacteria 1970
269 Ga0451797_0137432 3300041453 Bacteria 1023
270 Ga0451797_1477967 3300041453 Bacteria 959
271 Ga0451798_0027477 3300041458 Bacteria 1263
272 Ga0451798_0436501 3300041458 Unclassified 729
273 Ga0451798_0745726 3300041458 Bacteria 1016
274 Ga0451798_0829832 3300041458 Bacteria 3609
275 Ga0451800_1557293 3300041459 Bacteria 1789
276 Ga0451802_0252681 3300041460 Bacteria 627
277 Ga0451802_0513967 3300041460 Unclassified 888
278 Ga0451807_0020747 3300041486 Bacteria 829
279 Ga0451807_0395140 3300041486 Unclassified 625
280 Ga0451807_0730759 3300041486 Bacteria 2526
281 Ga0451807_1136205 3300041486 Bacteria 4284
282 Ga0451807_1467567 3300041486 Bacteria 5799
283 Ga0451807_1557607 3300041486 Bacteria 792
284 Ga0451807_2203143 3300041486 Bacteria 638
285 Ga0451833_0585980 3300041491 Bacteria 526
286 Ga0451833_1136118 3300041491 Bacteria 1327
287 Ga0451837_1706620 3300041494 Bacteria 2465
288 Ga0451849_1462338 3300041505 Bacteria 845
289 Ga0451843_0746039 3300041509 Unclassified 714
290 Ga0451843_1767994 3300041509 Unclassified 641
291 Ga0451853_0260513 3300041512 Unclassified 777
292 Ga0451853_1962713 3300041512 Unclassified 597
293 Ga0439464_0183146 3300042439 Unclassified 664
294 Ga0495591_085856 3300046458 Bacteria 796
295 Ga0495638_0016997 3300046460 Bacteria 4863
296 Ga0495596_0080824 3300046500 Bacteria 1262
297 Ga0495616_0032638 3300046513 Bacteria 2718
298 Ga0495656_0519061 3300046615 Unclassified 633
299 Ga0495625_0011678 3300046660 Bacteria 7144
300 Ga0495625_0016347 3300046660 Bacteria 5843
301 Ga0495625_0153172 3300046660 Unclassified 1548
302 Ga0495649_0020116 3300046694 Bacteria 3745
303 Ga0495649_0235903 3300046694 Bacteria 943
304 Ga0495589_0142464 3300046794 Bacteria 1147
305 Ga0495589_0446887 3300046794 Unclassified 592
306 Ga0495683_0472716 3300047323 Unclassified 512
307 Ga0495673_0133529 3300047469 Bacteria 974
308 Ga0495681_0130535 3300047470 Bacteria 1070
309 Ga0495686_0084392 3300047472 Bacteria 1936
310 Ga0495686_0493284 3300047472 Unclassified 646
311 Ga0496104_0676371 3300048907 Bacteria 940
312 Ga0496114_1326419 3300048917 Bacteria 606
313 Ga0501042_0595578 3300049578 Unclassified 804
314 Ga0501042_1349076 3300049578 Unclassified 520
315 Ga0501068_0000340 3300049584 Bacteria 23508
316 Ga0501068_0793852 3300049584 Bacteria 621
317 Ga0501070_0047069 3300049586 Bacteria 3586
318 Ga0501072_0143480 3300049588 Unclassified 1904
319 Ga0501073_0001286 3300049589 Bacteria 18435
320 Ga0501074_0010748 3300049590 Bacteria 6650
321 Ga0501075_0132881 3300049591 Unclassified 1896
322 Ga0501076_0054089 3300049592 Bacteria 3181
323 Ga0501079_0000501 3300049741 Bacteria 25528
324 Ga0501080_0001374 3300049742 Bacteria 20358
325 Ga0501080_0292062 3300049742 Bacteria 1480
326 Ga0501083_0218941 3300049744 Bacteria 1240
327 nmdc:mga0qj67_788943_c1 3300050509 Bacteria 752
328 nmdc:mga08y16_1202236_c1 3300050511 Unclassified 729
329 nmdc:mga08y16_347742_c1 3300050511 Bacteria 1523
330 Ga0495655_0278892 3300053083 Bacteria 569
331 Ga0500611_012632 3300053727 Bacteria 1430
332 Ga0501084_0024366 3300054114 Bacteria 5047
333 Ga0501082_0130530 3300060353 Unclassified 2180
334 Ga0111539_12201064
335 rootH2_10043698
336 rootL2_10385396
337 rootH1_10115064
338 Ga0070676_10138112
339 Ga0070676_10222091
340 Ga0070676_10891358
341 Ga0070683_100766497
342 Ga0070670_100010478
343 Ga0070670_100315969
344 Ga0070670_100896948
345 Ga0070677_10053313
346 Ga0070677_10074728
347 Ga0070677_10461905
348 Ga0068869_100033219
349 Ga0068869_100114108
350 Ga0068869_101626675
351 Ga0070666_11205431
352 Ga0070682_100023830
353 Ga0070682_100112664
354 Ga0070682_100354795
355 Ga0070682_100685189
356 Ga0068868_100707687
357 Ga0068868_100777728
358 Ga0070689_100436069
359 Ga0070691_11020406
360 Ga0070687_100059275
361 Ga0070692_10278683
362 Ga0070668_100070467
363 Ga0070668_100515978
364 Ga0070669_100046861
365 Ga0070669_100406058
366 Ga0070669_100478626
367 Ga0070675_100017056
368 Ga0070675_100036048
369 Ga0070675_100214578
370 Ga0070675_102229987
371 Ga0070671_101555315
372 Ga0070674_100214411
373 Ga0070674_100353792
374 Ga0070673_100064476
375 Ga0070673_100082848
376 Ga0070688_100353265
377 Ga0070688_100665961
378 Ga0070667_100411204
379 Ga0070667_100757193
380 Ga0070667_101021143
381 Ga0070701_10031563
382 Ga0070701_10056956
383 Ga0070701_10181182
384 Ga0070711_100103511
385 Ga0070700_100050362
386 Ga0070700_100175735
387 Ga0070700_100370130
388 Ga0070700_100589743
389 Ga0070700_100615518
390 Ga0070700_100661887
391 Ga0070694_101845562
392 Ga0070678_100029506
393 Ga0070678_100091150
394 Ga0070662_100172623
395 Ga0070662_100798488
396 Ga0068867_100006805
397 Ga0068867_100727340
398 Ga0068867_101034612
399 Ga0070685_10011268
400 Ga0070685_10506773
401 Ga0070685_10684956
402 Ga0068853_100867433
403 Ga0070672_100013528
404 Ga0070672_100044816
405 Ga0070672_100046431
406 Ga0070672_100862705
407 Ga0070686_100020106
408 Ga0070686_100239214
409 Ga0070686_101959251
410 Ga0070695_101885292
411 Ga0070693_100860898
412 Ga0070665_100431931
413 Ga0070665_100651776
414 Ga0070665_100983464
415 Ga0070664_100218798
416 Ga0070664_100356661
417 Ga0070664_100824498
418 Ga0070664_100840848
419 Ga0068857_100175567
420 Ga0068854_100207045
421 Ga0068854_101041836
422 Ga0070702_100356707
423 Ga0070702_100377231
424 Ga0070702_100626583
425 Ga0068859_100660691
426 Ga0068859_101415653
427 Ga0068864_100061579
428 Ga0068864_100351872
429 Ga0068866_10077133
430 Ga0068861_100030033
431 Ga0068861_100110998
432 Ga0068861_100558321
433 Ga0068861_100648631
434 Ga0068851_10086121
435 Ga0068870_10102956
436 Ga0068870_10133559
437 Ga0068870_10804700
438 Ga0068870_10850909
439 Ga0068862_100121162
440 Ga0068862_100269810
441 Ga0068862_100369648
442 Ga0068862_100520509
443 Ga0081455_10019871
444 Ga0070715_10293486
445 Ga0075366_10354082
446 Ga0097621_100042211
447 Ga0097621_100249641
448 Ga0097621_101501009
449 Ga0068871_100018440
450 Ga0068871_100105015
451 Ga0068871_100105969
452 Ga0068871_100214606
453 Ga0068871_100582808
454 Ga0075430_101130649
455 Ga0075429_100302116
456 Ga0068865_100039992
457 Ga0068865_100138814
458 Ga0097620_100660626
459 Ga0097620_101415632
460 Ga0097620_102424122
461 Ga0111539_11264947
462 Ga0105245_10415815
463 Ga0105243_10055679
464 Ga0105242_10424597
465 Ga0105242_13149529
466 Ga0105248_10655309
467 Ga0105248_12554862
468 Ga0105248_12904334
469 Ga0105238_11018225
470 Ga0105249_10665087
471 Ga0157378_11778623
472 Ga0157378_12692871
473 Ga0163162_10039499
474 Ga0157375_10324279
475 Ga0157375_11218512
476 Ga0163163_10027283
477 Ga0163163_10271758
478 Ga0163163_12478776
479 Ga0163163_13159424
480 Ga0157380_10017385
481 Ga0157380_10262846
482 Ga0157380_10424639
483 Ga0157379_10254146
484 Ga0157376_10806325
485 Ga0157376_11070719
486 Ga0163161_10548002
487 Ga0163161_10801693
488 Ga0207697_10037828
489 Ga0207682_10042864
490 Ga0207682_10056905
491 Ga0207692_10440252
492 Ga0207642_10712213
493 Ga0207685_10134031
494 Ga0207645_10213466
495 Ga0207643_10012501
496 Ga0207643_10018892
497 Ga0207662_10486371
498 Ga0207649_10210739
499 Ga0207681_10368733
500 Ga0207681_11289713
501 Ga0207681_11439142
502 Ga0207694_10665455
503 Ga0207650_10029624
504 Ga0207650_10170144
505 Ga0207650_10857383
506 Ga0207659_10668559
507 Ga0207659_11859229
508 Ga0207687_10292697
509 Ga0207644_10473598
510 Ga0207644_10635228
511 Ga0207644_11505950
512 Ga0207644_11575850
513 Ga0207706_10073827
514 Ga0207706_10572566
515 Ga0207686_10988889
516 Ga0207686_11025613
517 Ga0207709_10114740
518 Ga0207670_10156879
519 Ga0207669_10003702
520 Ga0207669_10010373
521 Ga0207669_10658030
522 Ga0207704_10120119
523 Ga0207691_10008794
524 Ga0207691_10028714
525 Ga0207691_10058663
526 Ga0207691_10093000
527 Ga0207711_10375615
528 Ga0207711_11269855
529 Ga0207689_10066498
530 Ga0207689_10163849
531 Ga0207689_11302770
532 Ga0207661_10689958
533 Ga0207679_11221799
534 Ga0207679_11492207
535 Ga0207651_10037780
536 Ga0207651_10297123
537 Ga0207651_11454508
538 Ga0207668_10101805
539 Ga0207668_10735573
540 Ga0207668_10755414
541 Ga0207640_10193240
542 Ga0207658_11259009
543 Ga0207658_11668198
544 Ga0207677_11251001
545 Ga0207639_10564607
546 Ga0207678_11102757
547 Ga0207708_10035193
548 Ga0207708_10081089
549 Ga0207708_10486511
550 Ga0207708_10571893
551 Ga0207641_10099329
552 Ga0207641_10252814
553 Ga0207641_11527811
554 Ga0207648_10032177
555 Ga0207648_10064532
556 Ga0207648_10481658
557 Ga0207648_10886530
558 Ga0207676_10376697
559 Ga0207676_10694252
560 Ga0207674_10268284
561 Ga0207675_100019644
562 Ga0207675_100041661
563 Ga0207675_100581554
564 Ga0207675_101158210
565 Ga0207683_10012355
566 Ga0207683_10019124
567 Ga0207428_10423385
568 Ga0268266_10239607
569 Ga0268266_10383298
570 Ga0268266_10502243
571 Ga0268265_10078011
572 Ga0268265_10485376
573 Ga0268265_10509783
574 Ga0268265_10673160
575 Ga0307515_10186022
576 Ga0307513_10009183
577 Ga0307513_10031651
578 Ga0307509_10085532
579 Ga0307408_100440347
580 Ga0307514_10128339
581 Ga0307405_10097443
582 Ga0307410_10074463
583 Ga0307407_10801606
584 Ga0307409_100158629
585 Ga0307409_100232814
586 Ga0307409_100817021
587 Ga0307411_10068704
588 Ga0307411_10166212
589 Ga0307411_10934506
590 Ga0307415_100314930
591 Ga0307415_101594807
592 Ga0451787_244844
593 Ga0451789_0061707
594 Ga0451789_0199066
595 Ga0451789_0475072
596 Ga0451789_0938274
597 Ga0451791_0618861
598 Ga0451791_0672547
599 Ga0451791_1447370
600 Ga0451791_1558695
601 Ga0451793_1328527
602 Ga0451797_0137432
603 Ga0451797_1477967
604 Ga0451798_0027477
605 Ga0451798_0436501
606 Ga0451798_0745726
607 Ga0451798_0829832
608 Ga0451800_1557293
609 Ga0451802_0252681
610 Ga0451802_0513967
611 Ga0451807_0020747
612 Ga0451807_0395140
613 Ga0451807_0730759
614 Ga0451807_1136205
615 Ga0451807_1467567
616 Ga0451807_1557607
617 Ga0451807_2203143
618 Ga0451833_0585980
619 Ga0451833_1136118
620 Ga0451837_1706620
621 Ga0451849_1462338
622 Ga0451843_0746039
623 Ga0451843_1767994
624 Ga0451853_0260513
625 Ga0451853_1962713
626 Ga0439464_0183146
627 Ga0495591_085856
628 Ga0495638_0016997
629 Ga0495596_0080824
630 Ga0495616_0032638
631 Ga0495656_0519061
632 Ga0495625_0011678
633 Ga0495625_0016347
634 Ga0495625_0153172
635 Ga0495649_0020116
636 Ga0495649_0235903
637 Ga0495589_0142464
638 Ga0495589_0446887
639 Ga0495683_0472716
640 Ga0495673_0133529
641 Ga0495681_0130535
642 Ga0495686_0084392
643 Ga0495686_0493284
644 Ga0496104_0676371
645 Ga0496114_1326419
646 Ga0501042_0595578
647 Ga0501042_1349076
648 Ga0501068_0000340
649 Ga0501068_0793852
650 Ga0501070_0047069
651 Ga0501072_0143480
652 Ga0501073_0001286
653 Ga0501074_0010748
654 Ga0501075_0132881
655 Ga0501076_0054089
656 Ga0501079_0000501
657 Ga0501080_0001374
658 Ga0501080_0292062
659 Ga0501083_0218941
660 nmdc:mga0qj67_788943_c1
661 nmdc:mga08y16_1202236_c1
662 nmdc:mga08y16_347742_c1
663 Ga0495655_0278892
664 Ga0500611_012632
665 Ga0501084_0024366
666 Ga0501082_0130530

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13992

YecR

YecR-like lipoprotein

38

110

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bgl-assembly1.cif.gz_1 salmonella lp ring 26 mer refined in c26 map 0.8979 17 98
7bgl-assembly1.cif.gz_1 salmonella lp ring 26 mer refined in c26 map 0.8684 17 98
8ev3-assembly1.cif.gz_P ytm1 associated 60s nascent ribosome (-fkbp39) state 1b 0.5792 51 104
6cb1-assembly1.cif.gz_P yeast nucleolar pre-60s ribosomal subunit (state 3) 0.5459 51 104
6mmo-assembly1.cif.gz_B carbon regulatory pii-like protein sbtb from cyanobium sp. 7001 bound to amp 0.5369 34 95
ID Description Score Start End Superfamily
af_P76010_114_240_2.40.10.220 Mainly Beta;Beta Barrel;Thrombin, subunit H;predicted glycosyltransferase like domains 0.5684 69 103 2.40.10.220
af_Q09524_159_349_3.30.70.660 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Pseudouridine synthase I, catalytic domain, C-terminal subdomain 0.5342 70 99 3.30.70.660
af_Q58EG3_156_249_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.5226 69 100 2.60.40.10
af_A0A1D6MG73_114_192_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.5109 71 94 3.30.70.330
af_P51840_560_808_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.5091 70 97 1.10.510.10
ID Description Score Start End GO Terms
AF-A0A1B7HTI6-F1-model_v4 Putative outer membrane lipoprotein 0.9476 19 98
AF-A0A511XDU2-F1-model_v4 YecR-like lipoprotein 0.9426 17 99
AF-A0A1V3IX83-F1-model_v4 DUF4156 domain-containing protein 0.9369 17 101
AF-A0A2D6TSP1-F1-model_v4 YecR-like lipoprotein 0.9328 17 99
AF-A0A1M7TFF3-F1-model_v4 YecR-like lipoprotein 0.9312 18 99

Map