F410852
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 332 | 191 | 332 | 203 |
Family's Representative Sequence
| Representative Sequence | 3300005468|Ga0070707_100062353|Ga0070707_1000623532 |
| Length | 226 |
| Sequence | MTEGFLQWGRGGPHHSRRDGGTLETMEPFRVHKGRVAPLDRANVDTDQIIPKQFLKRIERTGFGEFLFYDWRRSSDGTPDLSFPLNQPRYAGASVLVAGKNFGCGSSREHAVWALEDFGFRAVITPSFADIFANNCGKNGVLAVVLAEEEVGEIVSRAEKMPDYHVTVDLEQRKVHDERGFSATFEIDEFTRHCLLNGLDDIGLTLQHEPEIAAYESRHPVPQSTK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 5 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 6 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 7 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 8 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 35 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 43 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 46 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 48 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 49 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 50 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 52 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 53 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 54 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 55 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 56 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 57 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 58 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 59 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 60 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 65 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 66 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 67 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 68 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 70 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 92 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 96 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 148 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 149 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 150 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 151 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 152 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 153 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 154 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 155 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 156 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 157 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 158 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 159 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 160 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 161 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 162 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 163 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 164 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 165 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 166 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 167 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 173 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 174 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 175 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 176 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 177 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 178 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 179 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 180 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 181 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 182 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 183 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 184 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 185 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 186 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 187 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 188 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 189 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 190 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 191 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.49 |
| Metatranscriptomes | 1.51 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 7.83 |
| Rhizosphere | 91.87 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.3 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_501321 | 2162886012 | Bacteria | 2111 |
| 2 | JGI24752J21851_1002003 | 3300001976 | Bacteria | 2712 |
| 3 | JGI24737J22298_10037399 | 3300001990 | Bacteria | 1496 |
| 4 | JGI24743J22301_10002414 | 3300001991 | Bacteria | 2811 |
| 5 | JGI24034J26672_10007702 | 3300002239 | Bacteria | 1567 |
| 6 | JGI24751J29686_10026544 | 3300002459 | Bacteria | 1202 |
| 7 | Ga0065712_10112424 | 3300005290 | Bacteria | 1800 |
| 8 | Ga0065715_10034969 | 3300005293 | Bacteria | 1287 |
| 9 | Ga0070658_10030686 | 3300005327 | Bacteria | 4317 |
| 10 | Ga0070676_10008364 | 3300005328 | Bacteria | 5575 |
| 11 | Ga0070683_100003154 | 3300005329 | Bacteria | 13284 |
| 12 | Ga0070670_100042105 | 3300005331 | Bacteria | 3925 |
| 13 | Ga0070677_10001242 | 3300005333 | Bacteria | 8199 |
| 14 | Ga0068869_100003138 | 3300005334 | Bacteria | 10078 |
| 15 | Ga0068869_100319232 | 3300005334 | Bacteria | 1259 |
| 16 | Ga0070682_100009609 | 3300005337 | Bacteria | 5475 |
| 17 | Ga0068868_100005860 | 3300005338 | Bacteria | 8667 |
| 18 | Ga0068868_100023863 | 3300005338 | Bacteria | 4634 |
| 19 | Ga0070660_100014762 | 3300005339 | Bacteria | 5635 |
| 20 | Ga0070689_100228640 | 3300005340 | Bacteria | 1528 |
| 21 | Ga0070661_100003185 | 3300005344 | Bacteria | 11309 |
| 22 | Ga0070668_100003135 | 3300005347 | Bacteria | 12195 |
| 23 | Ga0070669_100010156 | 3300005353 | Bacteria | 6694 |
| 24 | Ga0070675_100043638 | 3300005354 | Bacteria | 3665 |
| 25 | Ga0070673_100091999 | 3300005364 | Bacteria | 2480 |
| 26 | Ga0070688_100003495 | 3300005365 | Bacteria | 8096 |
| 27 | Ga0070659_100046043 | 3300005366 | Bacteria | 3419 |
| 28 | Ga0070709_10117411 | 3300005434 | Bacteria | 1798 |
| 29 | Ga0070714_100011197 | 3300005435 | Bacteria | 7111 |
| 30 | Ga0070714_100028111 | 3300005435 | Bacteria | 4662 |
| 31 | Ga0070714_100618241 | 3300005435 | Bacteria | 1041 |
| 32 | Ga0070713_100011561 | 3300005436 | Bacteria | 6434 |
| 33 | Ga0070713_100037216 | 3300005436 | Bacteria | 3933 |
| 34 | Ga0070713_100102341 | 3300005436 | Bacteria | 2484 |
| 35 | Ga0070711_100113107 | 3300005439 | Bacteria | 1996 |
| 36 | Ga0070711_100115503 | 3300005439 | Bacteria | 1977 |
| 37 | Ga0070700_100537207 | 3300005441 | Bacteria | 906 |
| 38 | Ga0070694_100181502 | 3300005444 | Bacteria | 1557 |
| 39 | Ga0070708_100002211 | 3300005445 | Bacteria | 15036 |
| 40 | Ga0070708_100002318 | 3300005445 | Bacteria | 14730 |
| 41 | Ga0070708_100017296 | 3300005445 | Bacteria | 6010 |
| 42 | Ga0070662_100207838 | 3300005457 | Bacteria | 1556 |
| 43 | Ga0070662_100277006 | 3300005457 | Bacteria | 1356 |
| 44 | Ga0068867_100029578 | 3300005459 | Bacteria | 3947 |
| 45 | Ga0068867_100107652 | 3300005459 | Bacteria | 2137 |
| 46 | Ga0068867_100752097 | 3300005459 | Bacteria | 865 |
| 47 | Ga0070685_10001409 | 3300005466 | Bacteria | 12591 |
| 48 | Ga0070706_100001249 | 3300005467 | Bacteria | 27215 |
| 49 | Ga0070706_100002917 | 3300005467 | Bacteria | 17028 |
| 50 | Ga0070706_100003337 | 3300005467 | Bacteria | 15839 |
| 51 | Ga0070706_100369626 | 3300005467 | Bacteria | 1336 |
| 52 | Ga0070707_100004406 | 3300005468 | Bacteria | 13195 |
| 53 | Ga0070707_100008917 | 3300005468 | Bacteria | 9303 |
| 54 | Ga0070707_100031608 | 3300005468 | Bacteria | 5044 |
| 55 | Ga0070707_100062353 | 3300005468 | Bacteria | 3577 |
| 56 | Ga0070707_100312401 | 3300005468 | Bacteria | 1528 |
| 57 | Ga0070707_100456397 | 3300005468 | Bacteria | 1238 |
| 58 | Ga0070707_100732654 | 3300005468 | Bacteria | 952 |
| 59 | Ga0070707_100796980 | 3300005468 | Bacteria | 908 |
| 60 | Ga0070698_100000091 | 3300005471 | Bacteria | 71604 |
| 61 | Ga0070698_100006156 | 3300005471 | Bacteria | 13066 |
| 62 | Ga0070698_100247845 | 3300005471 | Bacteria | 1714 |
| 63 | Ga0070699_100001679 | 3300005518 | Bacteria | 20176 |
| 64 | Ga0070699_100076619 | 3300005518 | Bacteria | 2911 |
| 65 | Ga0070699_100544943 | 3300005518 | Bacteria | 1056 |
| 66 | Ga0070684_100003440 | 3300005535 | Bacteria | 11880 |
| 67 | Ga0070697_100001267 | 3300005536 | Bacteria | 19065 |
| 68 | Ga0070697_100001538 | 3300005536 | Bacteria | 17569 |
| 69 | Ga0070697_100004847 | 3300005536 | Bacteria | 10317 |
| 70 | Ga0070697_100068795 | 3300005536 | Bacteria | 2899 |
| 71 | Ga0070697_100121448 | 3300005536 | Bacteria | 2185 |
| 72 | Ga0070697_100259196 | 3300005536 | Bacteria | 1488 |
| 73 | Ga0070697_100324276 | 3300005536 | Bacteria | 1327 |
| 74 | Ga0070697_101049828 | 3300005536 | Bacteria | 725 |
| 75 | Ga0068853_100065031 | 3300005539 | Bacteria | 3164 |
| 76 | Ga0070672_100003094 | 3300005543 | Bacteria | 10738 |
| 77 | Ga0070672_100232230 | 3300005543 | Bacteria | 1550 |
| 78 | Ga0070665_100229558 | 3300005548 | Bacteria | 1856 |
| 79 | Ga0068855_100066732 | 3300005563 | Bacteria | 4194 |
| 80 | Ga0070664_100047198 | 3300005564 | Bacteria | 3638 |
| 81 | Ga0068857_100001862 | 3300005577 | Bacteria | 16990 |
| 82 | Ga0068854_100253557 | 3300005578 | Bacteria | 1406 |
| 83 | Ga0068856_100410558 | 3300005614 | Unclassified | 1374 |
| 84 | Ga0070702_100001029 | 3300005615 | Bacteria | 11058 |
| 85 | Ga0068852_100003843 | 3300005616 | Bacteria | 10550 |
| 86 | Ga0068859_100019211 | 3300005617 | Bacteria | 6865 |
| 87 | Ga0068859_100053368 | 3300005617 | Bacteria | 4066 |
| 88 | Ga0068864_100048853 | 3300005618 | Bacteria | 3638 |
| 89 | Ga0068861_100952789 | 3300005719 | Unclassified | 816 |
| 90 | Ga0068863_100042740 | 3300005841 | Bacteria | 4306 |
| 91 | Ga0068863_100046161 | 3300005841 | Bacteria | 4135 |
| 92 | Ga0068858_100005535 | 3300005842 | Bacteria | 12367 |
| 93 | Ga0068858_100005999 | 3300005842 | Bacteria | 11865 |
| 94 | Ga0068860_100562536 | 3300005843 | Bacteria | 1143 |
| 95 | Ga0068860_100610627 | 3300005843 | Bacteria | 1097 |
| 96 | Ga0068862_100052375 | 3300005844 | Bacteria | 3492 |
| 97 | Ga0068862_100124771 | 3300005844 | Bacteria | 2272 |
| 98 | Ga0081455_10141170 | 3300005937 | Bacteria | 1870 |
| 99 | Ga0070717_10001290 | 3300006028 | Bacteria | 17132 |
| 100 | Ga0070717_10009846 | 3300006028 | Bacteria | 7200 |
| 101 | Ga0070717_10014846 | 3300006028 | Bacteria | 5994 |
| 102 | Ga0070717_10181795 | 3300006028 | Bacteria | 1833 |
| 103 | Ga0070717_10360986 | 3300006028 | Bacteria | 1300 |
| 104 | Ga0070715_10573017 | 3300006163 | Bacteria | 658 |
| 105 | Ga0070716_100134130 | 3300006173 | Bacteria | 1570 |
| 106 | Ga0097621_100198346 | 3300006237 | Bacteria | 1741 |
| 107 | Ga0097621_100205221 | 3300006237 | Bacteria | 1712 |
| 108 | Ga0097621_100416976 | 3300006237 | Bacteria | 1204 |
| 109 | Ga0097621_100590211 | 3300006237 | Bacteria | 1014 |
| 110 | Ga0068871_100294672 | 3300006358 | Bacteria | 1422 |
| 111 | Ga0068871_100379694 | 3300006358 | Bacteria | 1255 |
| 112 | Ga0068871_101092357 | 3300006358 | Bacteria | 746 |
| 113 | Ga0075433_10852794 | 3300006852 | Bacteria | 795 |
| 114 | Ga0075434_100003171 | 3300006871 | Bacteria | 14661 |
| 115 | Ga0075434_100006917 | 3300006871 | Bacteria | 10453 |
| 116 | Ga0068865_100020208 | 3300006881 | Bacteria | 4318 |
| 117 | Ga0068865_100740141 | 3300006881 | Bacteria | 843 |
| 118 | Ga0097620_100019211 | 3300006931 | Bacteria | 6865 |
| 119 | Ga0097620_100053364 | 3300006931 | Bacteria | 4066 |
| 120 | Ga0075435_100051461 | 3300007076 | Bacteria | 3318 |
| 121 | Ga0075435_100185866 | 3300007076 | Bacteria | 1757 |
| 122 | Ga0075435_100236667 | 3300007076 | Bacteria | 1552 |
| 123 | Ga0105250_10017978 | 3300009092 | Bacteria | 2868 |
| 124 | Ga0105250_10232561 | 3300009092 | Bacteria | 784 |
| 125 | Ga0105245_10003694 | 3300009098 | Bacteria | 13659 |
| 126 | Ga0105245_10018803 | 3300009098 | Bacteria | 6046 |
| 127 | Ga0105247_10025937 | 3300009101 | Bacteria | 3538 |
| 128 | Ga0114129_10882114 | 3300009147 | Bacteria | 1135 |
| 129 | Ga0105241_10087385 | 3300009174 | Bacteria | 2454 |
| 130 | Ga0105241_10732050 | 3300009174 | Bacteria | 905 |
| 131 | Ga0105248_10146996 | 3300009177 | Bacteria | 2660 |
| 132 | Ga0105248_10821580 | 3300009177 | Unclassified | 1049 |
| 133 | Ga0105248_10961255 | 3300009177 | Bacteria | 965 |
| 134 | Ga0105237_10206241 | 3300009545 | Bacteria | 1966 |
| 135 | Ga0105237_10227489 | 3300009545 | Bacteria | 1866 |
| 136 | Ga0105238_10438001 | 3300009551 | Bacteria | 1303 |
| 137 | Ga0105249_10056661 | 3300009553 | Bacteria | 3588 |
| 138 | Ga0105239_10019815 | 3300010375 | Bacteria | 7424 |
| 139 | Ga0105246_10008033 | 3300011119 | Bacteria | 6475 |
| 140 | Ga0157373_10005319 | 3300013100 | Bacteria | 9671 |
| 141 | Ga0157371_10024359 | 3300013102 | Bacteria | 4420 |
| 142 | Ga0157369_10006236 | 3300013105 | Bacteria | 13839 |
| 143 | Ga0157374_10001313 | 3300013296 | Bacteria | 21164 |
| 144 | Ga0157374_10004674 | 3300013296 | Bacteria | 11492 |
| 145 | Ga0157374_10062823 | 3300013296 | Bacteria | 3482 |
| 146 | Ga0157374_10728615 | 3300013296 | Bacteria | 1006 |
| 147 | Ga0157378_10335654 | 3300013297 | Bacteria | 1472 |
| 148 | Ga0157378_10878741 | 3300013297 | Bacteria | 926 |
| 149 | Ga0163162_10009076 | 3300013306 | Bacteria | 9668 |
| 150 | Ga0163162_10026375 | 3300013306 | Bacteria | 5742 |
| 151 | Ga0163162_10465664 | 3300013306 | Bacteria | 1395 |
| 152 | Ga0163162_10533405 | 3300013306 | Bacteria | 1303 |
| 153 | Ga0157372_10040974 | 3300013307 | Bacteria | 5119 |
| 154 | Ga0157372_10168395 | 3300013307 | Bacteria | 2534 |
| 155 | Ga0157375_10016877 | 3300013308 | Bacteria | 6574 |
| 156 | Ga0157375_10040731 | 3300013308 | Bacteria | 4481 |
| 157 | Ga0157375_10960766 | 3300013308 | Bacteria | 996 |
| 158 | Ga0163163_10004144 | 3300014325 | Bacteria | 12345 |
| 159 | Ga0163163_10320673 | 3300014325 | Bacteria | 1603 |
| 160 | Ga0163163_10999658 | 3300014325 | Bacteria | 900 |
| 161 | Ga0157380_10006082 | 3300014326 | Bacteria | 8460 |
| 162 | Ga0182008_10005338 | 3300014497 | Bacteria | 7337 |
| 163 | Ga0157377_10004637 | 3300014745 | Bacteria | 6357 |
| 164 | Ga0157379_10006245 | 3300014968 | Bacteria | 10258 |
| 165 | Ga0157379_10115694 | 3300014968 | Bacteria | 2411 |
| 166 | Ga0157379_10118730 | 3300014968 | Bacteria | 2379 |
| 167 | Ga0157379_10222087 | 3300014968 | Bacteria | 1712 |
| 168 | Ga0157376_10010434 | 3300014969 | Bacteria | 6794 |
| 169 | Ga0157376_10077980 | 3300014969 | Bacteria | 2835 |
| 170 | Ga0157376_10368569 | 3300014969 | Bacteria | 1380 |
| 171 | Ga0157376_10527826 | 3300014969 | Bacteria | 1165 |
| 172 | Ga0182007_10008958 | 3300015262 | Bacteria | 4076 |
| 173 | Ga0163161_10005306 | 3300017792 | Bacteria | 8970 |
| 174 | Ga0207682_10002315 | 3300025893 | Bacteria | 8586 |
| 175 | Ga0207642_10020278 | 3300025899 | Bacteria | 2591 |
| 176 | Ga0207688_10019744 | 3300025901 | Bacteria | 3673 |
| 177 | Ga0207680_10051753 | 3300025903 | Bacteria | 2458 |
| 178 | Ga0207647_10002827 | 3300025904 | Bacteria | 13100 |
| 179 | Ga0207647_10006665 | 3300025904 | Bacteria | 8392 |
| 180 | Ga0207699_10109627 | 3300025906 | Bacteria | 1767 |
| 181 | Ga0207699_10302234 | 3300025906 | Bacteria | 1118 |
| 182 | Ga0207645_10002059 | 3300025907 | Bacteria | 16116 |
| 183 | Ga0207643_10002962 | 3300025908 | Bacteria | 9161 |
| 184 | Ga0207684_10000383 | 3300025910 | Bacteria | 59620 |
| 185 | Ga0207684_10001626 | 3300025910 | Bacteria | 23847 |
| 186 | Ga0207684_10007732 | 3300025910 | Bacteria | 9626 |
| 187 | Ga0207684_10104450 | 3300025910 | Bacteria | 2422 |
| 188 | Ga0207684_10105016 | 3300025910 | Bacteria | 2416 |
| 189 | Ga0207684_10331979 | 3300025910 | Bacteria | 1310 |
| 190 | Ga0207695_10298589 | 3300025913 | Bacteria | 1502 |
| 191 | Ga0207671_10061200 | 3300025914 | Bacteria | 2793 |
| 192 | Ga0207671_10116356 | 3300025914 | Bacteria | 2039 |
| 193 | Ga0207693_10024267 | 3300025915 | Bacteria | 4813 |
| 194 | Ga0207663_10566887 | 3300025916 | Bacteria | 889 |
| 195 | Ga0207657_10002970 | 3300025919 | Bacteria | 18184 |
| 196 | Ga0207649_10000566 | 3300025920 | Bacteria | 25447 |
| 197 | Ga0207646_10000229 | 3300025922 | Bacteria | 77035 |
| 198 | Ga0207646_10001190 | 3300025922 | Bacteria | 32778 |
| 199 | Ga0207646_10067226 | 3300025922 | Bacteria | 3200 |
| 200 | Ga0207646_10157807 | 3300025922 | Bacteria | 2047 |
| 201 | Ga0207646_10196754 | 3300025922 | Bacteria | 1820 |
| 202 | Ga0207646_10312812 | 3300025922 | Bacteria | 1419 |
| 203 | Ga0207646_10597850 | 3300025922 | Bacteria | 990 |
| 204 | Ga0207694_10317093 | 3300025924 | Bacteria | 1286 |
| 205 | Ga0207650_10000051 | 3300025925 | Bacteria | 168652 |
| 206 | Ga0207659_10014645 | 3300025926 | Bacteria | 5064 |
| 207 | Ga0207687_10051257 | 3300025927 | Bacteria | 2876 |
| 208 | Ga0207700_10058419 | 3300025928 | Bacteria | 2913 |
| 209 | Ga0207700_10080276 | 3300025928 | Bacteria | 2543 |
| 210 | Ga0207700_10108058 | 3300025928 | Bacteria | 2233 |
| 211 | Ga0207700_10129763 | 3300025928 | Bacteria | 2056 |
| 212 | Ga0207700_10234847 | 3300025928 | Bacteria | 1561 |
| 213 | Ga0207664_10006501 | 3300025929 | Bacteria | 8045 |
| 214 | Ga0207664_10050646 | 3300025929 | Bacteria | 3276 |
| 215 | Ga0207664_10284323 | 3300025929 | Bacteria | 1452 |
| 216 | Ga0207644_10009032 | 3300025931 | Bacteria | 6532 |
| 217 | Ga0207706_10022854 | 3300025933 | Bacteria | 5611 |
| 218 | Ga0207706_10233407 | 3300025933 | Bacteria | 1609 |
| 219 | Ga0207670_10025075 | 3300025936 | Bacteria | 3737 |
| 220 | Ga0207669_10151727 | 3300025937 | Bacteria | 1624 |
| 221 | Ga0207704_10009101 | 3300025938 | Bacteria | 4776 |
| 222 | Ga0207704_10045113 | 3300025938 | Bacteria | 2616 |
| 223 | Ga0207665_10029441 | 3300025939 | Bacteria | 3630 |
| 224 | Ga0207665_10162423 | 3300025939 | Bacteria | 1608 |
| 225 | Ga0207665_10263247 | 3300025939 | Bacteria | 1278 |
| 226 | Ga0207711_10020175 | 3300025941 | Bacteria | 5553 |
| 227 | Ga0207689_10000184 | 3300025942 | Bacteria | 54232 |
| 228 | Ga0207689_10040050 | 3300025942 | Bacteria | 3879 |
| 229 | Ga0207689_10305004 | 3300025942 | Bacteria | 1320 |
| 230 | Ga0207661_10003823 | 3300025944 | Bacteria | 10499 |
| 231 | Ga0207679_10000101 | 3300025945 | Bacteria | 71096 |
| 232 | Ga0207667_10413749 | 3300025949 | Bacteria | 1372 |
| 233 | Ga0207667_11003050 | 3300025949 | Unclassified | 822 |
| 234 | Ga0207651_10036492 | 3300025960 | Bacteria | 3209 |
| 235 | Ga0207668_10048796 | 3300025972 | Bacteria | 2907 |
| 236 | Ga0207658_10004998 | 3300025986 | Bacteria | 9137 |
| 237 | Ga0207677_10007786 | 3300026023 | Bacteria | 5947 |
| 238 | Ga0207677_10052655 | 3300026023 | Bacteria | 2766 |
| 239 | Ga0207677_10053693 | 3300026023 | Bacteria | 2745 |
| 240 | Ga0207703_10001248 | 3300026035 | Bacteria | 23840 |
| 241 | Ga0207703_10023924 | 3300026035 | Bacteria | 4804 |
| 242 | Ga0207639_10072220 | 3300026041 | Bacteria | 2701 |
| 243 | Ga0207678_10004418 | 3300026067 | Bacteria | 12647 |
| 244 | Ga0207641_10000006 | 3300026088 | Bacteria | 442569 |
| 245 | Ga0207641_10041235 | 3300026088 | Bacteria | 3868 |
| 246 | Ga0207641_10226143 | 3300026088 | Bacteria | 1737 |
| 247 | Ga0207641_10606424 | 3300026088 | Bacteria | 1072 |
| 248 | Ga0207641_11287570 | 3300026088 | Bacteria | 731 |
| 249 | Ga0207648_10000664 | 3300026089 | Bacteria | 38538 |
| 250 | Ga0207648_10079508 | 3300026089 | Bacteria | 2860 |
| 251 | Ga0207648_10384311 | 3300026089 | Bacteria | 1270 |
| 252 | Ga0207676_10000155 | 3300026095 | Bacteria | 59757 |
| 253 | Ga0207674_10002842 | 3300026116 | Bacteria | 21530 |
| 254 | Ga0207675_100003987 | 3300026118 | Bacteria | 14322 |
| 255 | Ga0207675_100622781 | 3300026118 | Bacteria | 1084 |
| 256 | Ga0207683_10200743 | 3300026121 | Bacteria | 1813 |
| 257 | Ga0207698_10846578 | 3300026142 | Bacteria | 919 |
| 258 | Ga0268266_10008965 | 3300028379 | Bacteria | 8854 |
| 259 | Ga0268266_10181978 | 3300028379 | Bacteria | 1914 |
| 260 | Ga0268266_10296721 | 3300028379 | Bacteria | 1507 |
| 261 | Ga0268265_10012477 | 3300028380 | Bacteria | 5758 |
| 262 | Ga0268265_10087399 | 3300028380 | Bacteria | 2480 |
| 263 | Ga0268264_10029796 | 3300028381 | Bacteria | 4472 |
| 264 | Ga0268264_10757182 | 3300028381 | Bacteria | 968 |
| 265 | Ga0265338_10008023 | 3300028800 | Bacteria | 12919 |
| 266 | Ga0265338_10126122 | 3300028800 | Bacteria | 2031 |
| 267 | Ga0265762_1000716 | 3300030760 | Bacteria | 5876 |
| 268 | Ga0265770_1010654 | 3300030878 | Bacteria | 1338 |
| 269 | Ga0265765_1006286 | 3300030879 | Bacteria | 1261 |
| 270 | Ga0265760_10000743 | 3300031090 | Bacteria | 9310 |
| 271 | Ga0265760_10004105 | 3300031090 | Bacteria | 4194 |
| 272 | Ga0265340_10021238 | 3300031247 | Bacteria | 3330 |
| 273 | Ga0265331_10120107 | 3300031250 | Bacteria | 1202 |
| 274 | Ga0265316_10009351 | 3300031344 | Bacteria | 9032 |
| 275 | Ga0265314_10000920 | 3300031711 | Bacteria | 34667 |
| 276 | Ga0265314_10039715 | 3300031711 | Bacteria | 3386 |
| 277 | Ga0307411_10701055 | 3300032005 | Bacteria | 882 |
| 278 | Ga0316214_1005083 | 3300033545 | Bacteria | 1715 |
| 279 | Ga0373931_0074163 | 3300035691 | Bacteria | 1864 |
| 280 | Ga0373935_0001316 | 3300035692 | Bacteria | 13737 |
| 281 | Ga0373927_0064074 | 3300035695 | Bacteria | 2378 |
| 282 | Ga0373947_0010322 | 3300035725 | Bacteria | 5359 |
| 283 | Ga0373947_0089317 | 3300035725 | Bacteria | 1919 |
| 284 | Ga0373925_0005124 | 3300037068 | Bacteria | 9817 |
| 285 | Ga0451577_0051781 | 3300042876 | Bacteria | 3666 |
| 286 | Ga0453684_0726894 | 3300044712 | Bacteria | 1077 |
| 287 | Ga0451576_0069484 | 3300045051 | Bacteria | 3665 |
| 288 | Ga0466967_0060877 | 3300045976 | Bacteria | 3348 |
| 289 | Ga0495603_0110476 | 3300046455 | Bacteria | 1604 |
| 290 | Ga0495580_0002349 | 3300046472 | Bacteria | 16510 |
| 291 | Ga0495580_0002714 | 3300046472 | Bacteria | 15301 |
| 292 | Ga0495580_0011121 | 3300046472 | Bacteria | 6975 |
| 293 | Ga0495580_0033833 | 3300046472 | Bacteria | 3681 |
| 294 | Ga0495582_0002549 | 3300046473 | Bacteria | 10144 |
| 295 | Ga0495665_0004192 | 3300046531 | Bacteria | 7778 |
| 296 | Ga0495659_0021209 | 3300046664 | Bacteria | 2188 |
| 297 | Ga0496100_0074931 | 3300048903 | Bacteria | 2268 |
| 298 | Ga0496100_0090856 | 3300048903 | Bacteria | 2083 |
| 299 | Ga0496101_0110561 | 3300048904 | Bacteria | 2068 |
| 300 | Ga0496101_0272760 | 3300048904 | Bacteria | 1321 |
| 301 | Ga0496102_0030118 | 3300048905 | Bacteria | 4857 |
| 302 | Ga0496102_0955933 | 3300048905 | Bacteria | 778 |
| 303 | Ga0496102_1088099 | 3300048905 | Bacteria | 719 |
| 304 | Ga0496103_0001542 | 3300048906 | Bacteria | 15338 |
| 305 | Ga0496103_0304456 | 3300048906 | Bacteria | 1025 |
| 306 | Ga0496104_0005846 | 3300048907 | Bacteria | 10775 |
| 307 | Ga0496104_0115809 | 3300048907 | Bacteria | 2572 |
| 308 | Ga0496105_0180605 | 3300048908 | Bacteria | 1728 |
| 309 | Ga0496105_0359112 | 3300048908 | Bacteria | 1162 |
| 310 | Ga0496106_0140787 | 3300048909 | Bacteria | 1897 |
| 311 | Ga0496107_0034480 | 3300048910 | Bacteria | 3626 |
| 312 | Ga0496108_0001035 | 3300048911 | Bacteria | 21687 |
| 313 | Ga0496109_0000126 | 3300048912 | Bacteria | 77920 |
| 314 | Ga0496110_0000429 | 3300048913 | Bacteria | 28526 |
| 315 | Ga0496111_0000748 | 3300048914 | Bacteria | 17329 |
| 316 | Ga0496112_0000615 | 3300048915 | Bacteria | 24595 |
| 317 | Ga0496112_0030673 | 3300048915 | Bacteria | 5207 |
| 318 | Ga0496112_1001552 | 3300048915 | Bacteria | 755 |
| 319 | Ga0496113_0000595 | 3300048916 | Bacteria | 18025 |
| 320 | Ga0496114_0260418 | 3300048917 | Bacteria | 1527 |
| 321 | Ga0496115_0105197 | 3300048918 | Bacteria | 2316 |
| 322 | Ga0496115_0226486 | 3300048918 | Bacteria | 1542 |
| 323 | nmdc:mga0n895_135157_c1 | 3300050512 | Bacteria | 2492 |
| 324 | nmdc:mga0n895_2407_c1 | 3300050512 | Bacteria | 14583 |
| 325 | nmdc:mga0n895_3709_c1 | 3300050512 | Bacteria | 12351 |
| 326 | nmdc:mga0rr50_128382_c1 | 3300050513 | Bacteria | 2027 |
| 327 | nmdc:mga0rr50_169095_c1 | 3300050513 | Bacteria | 1780 |
| 328 | nmdc:mga0rr50_286999_c1 | 3300050513 | Bacteria | 1374 |
| 329 | nmdc:mga0rr50_35979_c1 | 3300050513 | Bacteria | 3561 |
| 330 | nmdc:mga08x19_108246_c1 | 3300050514 | Bacteria | 1851 |
| 331 | nmdc:mga08x19_16534_c1 | 3300050514 | Bacteria | 4501 |
| 332 | nmdc:mga0a205_26435_c3 | 3300050515 | Bacteria | 832 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300028800 | Ga0265338_10126122 | Ga0265338_101261221 | 184 |
| 2 | 3300025939 | Ga0207665_10029441 | Ga0207665_100294412 | 188 |
| 3 | 3300005459 | Ga0068867_100752097 | Ga0068867_1007520971 | 193 |
| 4 | 3300014326 | Ga0157380_10006082 | Ga0157380_100060824 | 193 |
| 5 | 3300026089 | Ga0207648_10384311 | Ga0207648_103843111 | 193 |
| 6 | 3300005334 | Ga0068869_100003138 | Ga0068869_1000031382 | 194 |
| 7 | 3300005338 | Ga0068868_100005860 | Ga0068868_1000058603 | 194 |
| 8 | 3300005340 | Ga0070689_100228640 | Ga0070689_1002286402 | 194 |
| 9 | 3300005457 | Ga0070662_100207838 | Ga0070662_1002078382 | 194 |
| 10 | 3300005459 | Ga0068867_100107652 | Ga0068867_1001076522 | 194 |
| 11 | 3300005543 | Ga0070672_100232230 | Ga0070672_1002322302 | 194 |
| 12 | 3300005617 | Ga0068859_100019211 | Ga0068859_1000192114 | 194 |
| 13 | 3300005719 | Ga0068861_100952789 | Ga0068861_1009527891 | 194 |
| 14 | 3300005841 | Ga0068863_100042740 | Ga0068863_1000427403 | 194 |
| 15 | 3300005842 | Ga0068858_100005999 | Ga0068858_10000599913 | 194 |
| 16 | 3300005844 | Ga0068862_100052375 | Ga0068862_1000523752 | 194 |
| 17 | 3300006237 | Ga0097621_100416976 | Ga0097621_1004169762 | 194 |
| 18 | 3300006358 | Ga0068871_101092357 | Ga0068871_1010923571 | 194 |
| 19 | 3300006881 | Ga0068865_100740141 | Ga0068865_1007401412 | 194 |
| 20 | 3300006931 | Ga0097620_100019211 | Ga0097620_1000192114 | 194 |
| 21 | 3300009545 | Ga0105237_10206241 | Ga0105237_102062411 | 194 |
| 22 | 3300009545 | Ga0105237_10227489 | Ga0105237_102274892 | 194 |
| 23 | 3300010375 | Ga0105239_10019815 | Ga0105239_100198157 | 194 |
| 24 | 3300013296 | Ga0157374_10001313 | Ga0157374_100013132 | 194 |
| 25 | 3300013306 | Ga0163162_10009076 | Ga0163162_1000907611 | 194 |
| 26 | 3300013307 | Ga0157372_10168395 | Ga0157372_101683953 | 194 |
| 27 | 3300013308 | Ga0157375_10016877 | Ga0157375_100168774 | 194 |
| 28 | 3300013308 | Ga0157375_10040731 | Ga0157375_100407312 | 194 |
| 29 | 3300014968 | Ga0157379_10115694 | Ga0157379_101156942 | 194 |
| 30 | 3300014968 | Ga0157379_10222087 | Ga0157379_102220872 | 194 |
| 31 | 3300014969 | Ga0157376_10010434 | Ga0157376_100104348 | 194 |
| 32 | 3300025904 | Ga0207647_10002827 | Ga0207647_100028276 | 194 |
| 33 | 3300025914 | Ga0207671_10061200 | Ga0207671_100612001 | 194 |
| 34 | 3300025933 | Ga0207706_10233407 | Ga0207706_102334072 | 194 |
| 35 | 3300025938 | Ga0207704_10045113 | Ga0207704_100451132 | 194 |
| 36 | 3300025942 | Ga0207689_10040050 | Ga0207689_100400501 | 194 |
| 37 | 3300025949 | Ga0207667_11003050 | Ga0207667_110030502 | 194 |
| 38 | 3300026023 | Ga0207677_10052655 | Ga0207677_100526552 | 194 |
| 39 | 3300026035 | Ga0207703_10001248 | Ga0207703_1000124817 | 194 |
| 40 | 3300026088 | Ga0207641_10041235 | Ga0207641_100412352 | 194 |
| 41 | 3300026088 | Ga0207641_10226143 | Ga0207641_102261432 | 194 |
| 42 | 3300026089 | Ga0207648_10079508 | Ga0207648_100795082 | 194 |
| 43 | 3300026118 | Ga0207675_100622781 | Ga0207675_1006227812 | 194 |
| 44 | 3300028379 | Ga0268266_10296721 | Ga0268266_102967212 | 194 |
| 45 | 3300028380 | Ga0268265_10087399 | Ga0268265_100873992 | 194 |
| 46 | 3300048915 | Ga0496112_1001552 | Ga0496112_1001552_98_685 | 194 |
| 47 | 3300005937 | Ga0081455_10141170 | Ga0081455_101411702 | 195 |
| 48 | 3300046664 | Ga0495659_0021209 | Ga0495659_0021209_1588_2178 | 195 |
| 49 | 3300005435 | Ga0070714_100618241 | Ga0070714_1006182411 | 196 |
| 50 | 3300009147 | Ga0114129_10882114 | Ga0114129_108821142 | 196 |
| 51 | 3300025928 | Ga0207700_10108058 | Ga0207700_101080581 | 196 |
| 52 | 3300042876 | Ga0451577_0051781 | Ga0451577_0051781_1598_2191 | 196 |
| 53 | 3300045051 | Ga0451576_0069484 | Ga0451576_0069484_1053_1646 | 196 |
| 54 | 3300005434 | Ga0070709_10117411 | Ga0070709_101174112 | 198 |
| 55 | 3300006237 | Ga0097621_100198346 | Ga0097621_1001983463 | 198 |
| 56 | 3300006358 | Ga0068871_100379694 | Ga0068871_1003796942 | 198 |
| 57 | 3300006852 | Ga0075433_10852794 | Ga0075433_108527941 | 198 |
| 58 | 3300006871 | Ga0075434_100003171 | Ga0075434_10000317111 | 198 |
| 59 | 3300007076 | Ga0075435_100185866 | Ga0075435_1001858661 | 198 |
| 60 | 3300025906 | Ga0207699_10109627 | Ga0207699_101096272 | 198 |
| 61 | 3300025939 | Ga0207665_10162423 | Ga0207665_101624232 | 198 |
| 62 | 3300030878 | Ga0265770_1010654 | Ga0265770_10106542 | 198 |
| 63 | 3300031090 | Ga0265760_10000743 | Ga0265760_100007432 | 198 |
| 64 | 3300045976 | Ga0466967_0060877 | Ga0466967_0060877_181_780 | 198 |
| 65 | 3300046455 | Ga0495603_0110476 | Ga0495603_0110476_596_1195 | 198 |
| 66 | 3300046472 | Ga0495580_0002714 | Ga0495580_0002714_12529_13128 | 198 |
| 67 | 3300050512 | nmdc:mga0n895_2407_c1 | nmdc:mga0n895_2407_c1_6449_7048 | 198 |
| 68 | 3300050513 | nmdc:mga0rr50_169095_c1 | nmdc:mga0rr50_169095_c1_1128_1727 | 198 |
| 69 | 3300050515 | nmdc:mga0a205_26435_c3 | nmdc:mga0a205_26435_c3_205_804 | 198 |
| 70 | 3300005468 | Ga0070707_100312401 | Ga0070707_1003124012 | 199 |
| 71 | 3300005471 | Ga0070698_100247845 | Ga0070698_1002478452 | 199 |
| 72 | 3300005536 | Ga0070697_100259196 | Ga0070697_1002591962 | 199 |
| 73 | 3300006028 | Ga0070717_10009846 | Ga0070717_100098468 | 199 |
| 74 | 3300025910 | Ga0207684_10105016 | Ga0207684_101050165 | 199 |
| 75 | 3300025939 | Ga0207665_10263247 | Ga0207665_102632472 | 199 |
| 76 | 3300005334 | Ga0068869_100319232 | Ga0068869_1003192322 | 200 |
| 77 | 3300005444 | Ga0070694_100181502 | Ga0070694_1001815022 | 200 |
| 78 | 3300005468 | Ga0070707_100062353 | Ga0070707_1000623532 | 200 |
| 79 | 3300005548 | Ga0070665_100229558 | Ga0070665_1002295582 | 200 |
| 80 | 3300005614 | Ga0068856_100410558 | Ga0068856_1004105582 | 200 |
| 81 | 3300005841 | Ga0068863_100046161 | Ga0068863_1000461613 | 200 |
| 82 | 3300005843 | Ga0068860_100562536 | Ga0068860_1005625362 | 200 |
| 83 | 3300006163 | Ga0070715_10573017 | Ga0070715_105730171 | 200 |
| 84 | 3300006173 | Ga0070716_100134130 | Ga0070716_1001341302 | 200 |
| 85 | 3300006237 | Ga0097621_100590211 | Ga0097621_1005902112 | 200 |
| 86 | 3300006358 | Ga0068871_100294672 | Ga0068871_1002946722 | 200 |
| 87 | 3300007076 | Ga0075435_100236667 | Ga0075435_1002366672 | 200 |
| 88 | 3300009174 | Ga0105241_10732050 | Ga0105241_107320501 | 200 |
| 89 | 3300009177 | Ga0105248_10821580 | Ga0105248_108215802 | 200 |
| 90 | 3300009177 | Ga0105248_10961255 | Ga0105248_109612551 | 200 |
| 91 | 3300009551 | Ga0105238_10438001 | Ga0105238_104380012 | 200 |
| 92 | 3300013296 | Ga0157374_10004674 | Ga0157374_100046746 | 200 |
| 93 | 3300013296 | Ga0157374_10728615 | Ga0157374_107286152 | 200 |
| 94 | 3300013297 | Ga0157378_10335654 | Ga0157378_103356542 | 200 |
| 95 | 3300013297 | Ga0157378_10878741 | Ga0157378_108787411 | 200 |
| 96 | 3300013306 | Ga0163162_10026375 | Ga0163162_100263754 | 200 |
| 97 | 3300013308 | Ga0157375_10960766 | Ga0157375_109607662 | 200 |
| 98 | 3300014325 | Ga0163163_10999658 | Ga0163163_109996581 | 200 |
| 99 | 3300014968 | Ga0157379_10006245 | Ga0157379_100062452 | 200 |
| 100 | 3300014968 | Ga0157379_10118730 | Ga0157379_101187302 | 200 |
| 101 | 3300014969 | Ga0157376_10368569 | Ga0157376_103685692 | 200 |
| 102 | 3300014969 | Ga0157376_10527826 | Ga0157376_105278262 | 200 |
| 103 | 3300025906 | Ga0207699_10302234 | Ga0207699_103022342 | 200 |
| 104 | 3300025913 | Ga0207695_10298589 | Ga0207695_102985892 | 200 |
| 105 | 3300025922 | Ga0207646_10067226 | Ga0207646_100672262 | 200 |
| 106 | 3300025924 | Ga0207694_10317093 | Ga0207694_103170932 | 200 |
| 107 | 3300025942 | Ga0207689_10305004 | Ga0207689_103050042 | 200 |
| 108 | 3300026088 | Ga0207641_10606424 | Ga0207641_106064242 | 200 |
| 109 | 3300028379 | Ga0268266_10181978 | Ga0268266_101819782 | 200 |
| 110 | 3300028381 | Ga0268264_10757182 | Ga0268264_107571821 | 200 |
| 111 | 3300035691 | Ga0373931_0074163 | Ga0373931_0074163_1242_1847 | 200 |
| 112 | 3300046472 | Ga0495580_0033833 | Ga0495580_0033833_61_699 | 200 |
| 113 | 3300048903 | Ga0496100_0074931 | Ga0496100_0074931_698_1303 | 200 |
| 114 | 3300048903 | Ga0496100_0090856 | Ga0496100_0090856_55_660 | 200 |
| 115 | 3300048904 | Ga0496101_0110561 | Ga0496101_0110561_910_1515 | 200 |
| 116 | 3300048904 | Ga0496101_0272760 | Ga0496101_0272760_530_1135 | 200 |
| 117 | 3300048905 | Ga0496102_0955933 | Ga0496102_0955933_31_636 | 200 |
| 118 | 3300048906 | Ga0496103_0001542 | Ga0496103_0001542_4352_4957 | 200 |
| 119 | 3300048907 | Ga0496104_0005846 | Ga0496104_0005846_4105_4710 | 200 |
| 120 | 3300048908 | Ga0496105_0180605 | Ga0496105_0180605_959_1564 | 200 |
| 121 | 3300048908 | Ga0496105_0359112 | Ga0496105_0359112_392_997 | 200 |
| 122 | 3300048909 | Ga0496106_0140787 | Ga0496106_0140787_1102_1707 | 200 |
| 123 | 3300048910 | Ga0496107_0034480 | Ga0496107_0034480_530_1135 | 200 |
| 124 | 3300048915 | Ga0496112_0030673 | Ga0496112_0030673_507_1112 | 200 |
| 125 | 3300048917 | Ga0496114_0260418 | Ga0496114_0260418_693_1298 | 200 |
| 126 | 3300048918 | Ga0496115_0105197 | Ga0496115_0105197_1585_2190 | 200 |
| 127 | 3300048918 | Ga0496115_0226486 | Ga0496115_0226486_375_980 | 200 |
| 128 | 3300050513 | nmdc:mga0rr50_286999_c1 | nmdc:mga0rr50_286999_c1_525_1130 | 200 |
| 129 | 3300005435 | Ga0070714_100011197 | Ga0070714_1000111975 | 201 |
| 130 | 3300005435 | Ga0070714_100028111 | Ga0070714_1000281112 | 201 |
| 131 | 3300005436 | Ga0070713_100011561 | Ga0070713_1000115615 | 201 |
| 132 | 3300005436 | Ga0070713_100102341 | Ga0070713_1001023412 | 201 |
| 133 | 3300005439 | Ga0070711_100113107 | Ga0070711_1001131074 | 201 |
| 134 | 3300005445 | Ga0070708_100002211 | Ga0070708_1000022118 | 201 |
| 135 | 3300005467 | Ga0070706_100001249 | Ga0070706_10000124928 | 201 |
| 136 | 3300005468 | Ga0070707_100008917 | Ga0070707_1000089172 | 201 |
| 137 | 3300005471 | Ga0070698_100000091 | Ga0070698_10000009114 | 201 |
| 138 | 3300005518 | Ga0070699_100076619 | Ga0070699_1000766192 | 201 |
| 139 | 3300005536 | Ga0070697_100004847 | Ga0070697_1000048477 | 201 |
| 140 | 3300006028 | Ga0070717_10001290 | Ga0070717_100012904 | 201 |
| 141 | 3300006028 | Ga0070717_10360986 | Ga0070717_103609862 | 201 |
| 142 | 3300006871 | Ga0075434_100006917 | Ga0075434_1000069179 | 201 |
| 143 | 3300007076 | Ga0075435_100051461 | Ga0075435_1000514612 | 201 |
| 144 | 3300025910 | Ga0207684_10000383 | Ga0207684_1000038348 | 201 |
| 145 | 3300025915 | Ga0207693_10024267 | Ga0207693_100242675 | 201 |
| 146 | 3300025922 | Ga0207646_10000229 | Ga0207646_1000022963 | 201 |
| 147 | 3300025928 | Ga0207700_10080276 | Ga0207700_100802763 | 201 |
| 148 | 3300025928 | Ga0207700_10234847 | Ga0207700_102348472 | 201 |
| 149 | 3300025929 | Ga0207664_10050646 | Ga0207664_100506464 | 201 |
| 150 | 3300025929 | Ga0207664_10284323 | Ga0207664_102843232 | 201 |
| 151 | 3300035692 | Ga0373935_0001316 | Ga0373935_0001316_6634_7242 | 201 |
| 152 | 3300035695 | Ga0373927_0064074 | Ga0373927_0064074_354_962 | 201 |
| 153 | 3300035725 | Ga0373947_0010322 | Ga0373947_0010322_2187_2795 | 201 |
| 154 | 3300035725 | Ga0373947_0089317 | Ga0373947_0089317_1267_1875 | 201 |
| 155 | 3300037068 | Ga0373925_0005124 | Ga0373925_0005124_2952_3560 | 201 |
| 156 | 3300046472 | Ga0495580_0002349 | Ga0495580_0002349_6263_6871 | 201 |
| 157 | 3300046473 | Ga0495582_0002549 | Ga0495582_0002549_76_684 | 201 |
| 158 | 3300046531 | Ga0495665_0004192 | Ga0495665_0004192_219_827 | 201 |
| 159 | 3300048907 | Ga0496104_0115809 | Ga0496104_0115809_436_1044 | 201 |
| 160 | 3300050512 | nmdc:mga0n895_135157_c1 | nmdc:mga0n895_135157_c1_503_1111 | 201 |
| 161 | 3300050512 | nmdc:mga0n895_3709_c1 | nmdc:mga0n895_3709_c1_4328_4936 | 201 |
| 162 | 3300050513 | nmdc:mga0rr50_128382_c1 | nmdc:mga0rr50_128382_c1_1276_1884 | 201 |
| 163 | 3300050513 | nmdc:mga0rr50_35979_c1 | nmdc:mga0rr50_35979_c1_2668_3276 | 201 |
| 164 | 3300050514 | nmdc:mga08x19_108246_c1 | nmdc:mga08x19_108246_c1_727_1335 | 201 |
| 165 | 3300050514 | nmdc:mga08x19_16534_c1 | nmdc:mga08x19_16534_c1_3066_3674 | 201 |
| 166 | 3300005468 | Ga0070707_100456397 | Ga0070707_1004563972 | 202 |
| 167 | 3300025922 | Ga0207646_10597850 | Ga0207646_105978501 | 202 |
| 168 | 3300025929 | Ga0207664_10006501 | Ga0207664_100065017 | 202 |
| 169 | 3300030760 | Ga0265762_1000716 | Ga0265762_10007163 | 202 |
| 170 | 3300030879 | Ga0265765_1006286 | Ga0265765_10062861 | 202 |
| 171 | 3300031090 | Ga0265760_10004105 | Ga0265760_100041053 | 202 |
| 172 | 3300005445 | Ga0070708_100017296 | Ga0070708_1000172965 | 203 |
| 173 | 3300005467 | Ga0070706_100003337 | Ga0070706_1000033374 | 203 |
| 174 | 3300005467 | Ga0070706_100369626 | Ga0070706_1003696262 | 203 |
| 175 | 3300005536 | Ga0070697_100001267 | Ga0070697_10000126711 | 203 |
| 176 | 3300005536 | Ga0070697_100121448 | Ga0070697_1001214482 | 203 |
| 177 | 3300005536 | Ga0070697_100324276 | Ga0070697_1003242762 | 203 |
| 178 | 3300005536 | Ga0070697_101049828 | Ga0070697_1010498281 | 203 |
| 179 | 3300006028 | Ga0070717_10014846 | Ga0070717_100148464 | 203 |
| 180 | 3300025910 | Ga0207684_10007732 | Ga0207684_100077323 | 203 |
| 181 | 3300025910 | Ga0207684_10331979 | Ga0207684_103319792 | 203 |
| 182 | 3300048905 | Ga0496102_0030118 | Ga0496102_0030118_2378_2992 | 203 |
| 183 | 3300048906 | Ga0496103_0304456 | Ga0496103_0304456_126_740 | 203 |
| 184 | 3300005445 | Ga0070708_100002318 | Ga0070708_1000023185 | 204 |
| 185 | 3300005467 | Ga0070706_100002917 | Ga0070706_1000029179 | 204 |
| 186 | 3300005468 | Ga0070707_100004406 | Ga0070707_1000044068 | 204 |
| 187 | 3300005471 | Ga0070698_100006156 | Ga0070698_1000061566 | 204 |
| 188 | 3300005518 | Ga0070699_100001679 | Ga0070699_10000167913 | 204 |
| 189 | 3300005536 | Ga0070697_100001538 | Ga0070697_1000015384 | 204 |
| 190 | 3300025910 | Ga0207684_10001626 | Ga0207684_1000162624 | 204 |
| 191 | 3300025922 | Ga0207646_10001190 | Ga0207646_1000119025 | 204 |
| 192 | 3300005439 | Ga0070711_100115503 | Ga0070711_1001155032 | 205 |
| 193 | 3300005468 | Ga0070707_100031608 | Ga0070707_1000316084 | 205 |
| 194 | 3300005536 | Ga0070697_100068795 | Ga0070697_1000687952 | 205 |
| 195 | 3300014497 | Ga0182008_10005338 | Ga0182008_100053386 | 205 |
| 196 | 3300015262 | Ga0182007_10008958 | Ga0182007_100089582 | 205 |
| 197 | 3300025910 | Ga0207684_10104450 | Ga0207684_101044502 | 205 |
| 198 | 3300025916 | Ga0207663_10566887 | Ga0207663_105668871 | 205 |
| 199 | 3300025922 | Ga0207646_10157807 | Ga0207646_101578072 | 205 |
| 200 | 3300025928 | Ga0207700_10058419 | Ga0207700_100584194 | 205 |
| 201 | 3300031247 | Ga0265340_10021238 | Ga0265340_100212382 | 205 |
| 202 | 3300031711 | Ga0265314_10000920 | Ga0265314_1000092013 | 205 |
| 203 | 3300031711 | Ga0265314_10039715 | Ga0265314_100397153 | 205 |
| 204 | 3300033545 | Ga0316214_1005083 | Ga0316214_10050832 | 205 |
| 205 | 3300005436 | Ga0070713_100037216 | Ga0070713_1000372163 | 206 |
| 206 | 3300005468 | Ga0070707_100732654 | Ga0070707_1007326542 | 206 |
| 207 | 3300005468 | Ga0070707_100796980 | Ga0070707_1007969801 | 206 |
| 208 | 3300005518 | Ga0070699_100544943 | Ga0070699_1005449432 | 206 |
| 209 | 3300006028 | Ga0070717_10181795 | Ga0070717_101817952 | 206 |
| 210 | 3300025922 | Ga0207646_10196754 | Ga0207646_101967542 | 206 |
| 211 | 3300025922 | Ga0207646_10312812 | Ga0207646_103128122 | 206 |
| 212 | 3300025928 | Ga0207700_10129763 | Ga0207700_101297633 | 206 |
| 213 | 3300032005 | Ga0307411_10701055 | Ga0307411_107010552 | 206 |
| 214 | 3300046472 | Ga0495580_0011121 | Ga0495580_0011121_5736_6359 | 206 |
| 215 | 2162886012 | MBSR1b_contig_501321 | MBSR1b_0468.00003480 | 207 |
| 216 | 3300001976 | JGI24752J21851_1002003 | JGI24752J21851_10020032 | 207 |
| 217 | 3300001990 | JGI24737J22298_10037399 | JGI24737J22298_100373992 | 207 |
| 218 | 3300001991 | JGI24743J22301_10002414 | JGI24743J22301_100024142 | 207 |
| 219 | 3300002239 | JGI24034J26672_10007702 | JGI24034J26672_100077022 | 207 |
| 220 | 3300002459 | JGI24751J29686_10026544 | JGI24751J29686_100265441 | 207 |
| 221 | 3300005290 | Ga0065712_10112424 | Ga0065712_101124242 | 207 |
| 222 | 3300005293 | Ga0065715_10034969 | Ga0065715_100349692 | 207 |
| 223 | 3300005327 | Ga0070658_10030686 | Ga0070658_100306862 | 207 |
| 224 | 3300005328 | Ga0070676_10008364 | Ga0070676_100083645 | 207 |
| 225 | 3300005329 | Ga0070683_100003154 | Ga0070683_1000031544 | 207 |
| 226 | 3300005331 | Ga0070670_100042105 | Ga0070670_1000421052 | 207 |
| 227 | 3300005333 | Ga0070677_10001242 | Ga0070677_100012424 | 207 |
| 228 | 3300005337 | Ga0070682_100009609 | Ga0070682_1000096094 | 207 |
| 229 | 3300005338 | Ga0068868_100023863 | Ga0068868_1000238632 | 207 |
| 230 | 3300005339 | Ga0070660_100014762 | Ga0070660_1000147622 | 207 |
| 231 | 3300005344 | Ga0070661_100003185 | Ga0070661_1000031852 | 207 |
| 232 | 3300005347 | Ga0070668_100003135 | Ga0070668_1000031357 | 207 |
| 233 | 3300005353 | Ga0070669_100010156 | Ga0070669_1000101566 | 207 |
| 234 | 3300005354 | Ga0070675_100043638 | Ga0070675_1000436381 | 207 |
| 235 | 3300005364 | Ga0070673_100091999 | Ga0070673_1000919992 | 207 |
| 236 | 3300005365 | Ga0070688_100003495 | Ga0070688_1000034956 | 207 |
| 237 | 3300005366 | Ga0070659_100046043 | Ga0070659_1000460433 | 207 |
| 238 | 3300005441 | Ga0070700_100537207 | Ga0070700_1005372072 | 207 |
| 239 | 3300005457 | Ga0070662_100277006 | Ga0070662_1002770062 | 207 |
| 240 | 3300005459 | Ga0068867_100029578 | Ga0068867_1000295784 | 207 |
| 241 | 3300005466 | Ga0070685_10001409 | Ga0070685_100014092 | 207 |
| 242 | 3300005535 | Ga0070684_100003440 | Ga0070684_1000034402 | 207 |
| 243 | 3300005539 | Ga0068853_100065031 | Ga0068853_1000650312 | 207 |
| 244 | 3300005543 | Ga0070672_100003094 | Ga0070672_1000030945 | 207 |
| 245 | 3300005563 | Ga0068855_100066732 | Ga0068855_1000667322 | 207 |
| 246 | 3300005564 | Ga0070664_100047198 | Ga0070664_1000471982 | 207 |
| 247 | 3300005577 | Ga0068857_100001862 | Ga0068857_10000186210 | 207 |
| 248 | 3300005578 | Ga0068854_100253557 | Ga0068854_1002535571 | 207 |
| 249 | 3300005615 | Ga0070702_100001029 | Ga0070702_1000010298 | 207 |
| 250 | 3300005616 | Ga0068852_100003843 | Ga0068852_1000038435 | 207 |
| 251 | 3300005617 | Ga0068859_100053368 | Ga0068859_1000533682 | 207 |
| 252 | 3300005618 | Ga0068864_100048853 | Ga0068864_1000488532 | 207 |
| 253 | 3300005842 | Ga0068858_100005535 | Ga0068858_1000055355 | 207 |
| 254 | 3300005843 | Ga0068860_100610627 | Ga0068860_1006106272 | 207 |
| 255 | 3300005844 | Ga0068862_100124771 | Ga0068862_1001247712 | 207 |
| 256 | 3300006237 | Ga0097621_100205221 | Ga0097621_1002052212 | 207 |
| 257 | 3300006881 | Ga0068865_100020208 | Ga0068865_1000202082 | 207 |
| 258 | 3300006931 | Ga0097620_100053364 | Ga0097620_1000533642 | 207 |
| 259 | 3300009092 | Ga0105250_10017978 | Ga0105250_100179782 | 207 |
| 260 | 3300009092 | Ga0105250_10232561 | Ga0105250_102325611 | 207 |
| 261 | 3300009098 | Ga0105245_10003694 | Ga0105245_100036941 | 207 |
| 262 | 3300009098 | Ga0105245_10018803 | Ga0105245_100188035 | 207 |
| 263 | 3300009101 | Ga0105247_10025937 | Ga0105247_100259373 | 207 |
| 264 | 3300009174 | Ga0105241_10087385 | Ga0105241_100873852 | 207 |
| 265 | 3300009177 | Ga0105248_10146996 | Ga0105248_101469963 | 207 |
| 266 | 3300009553 | Ga0105249_10056661 | Ga0105249_100566612 | 207 |
| 267 | 3300011119 | Ga0105246_10008033 | Ga0105246_100080336 | 207 |
| 268 | 3300013100 | Ga0157373_10005319 | Ga0157373_100053194 | 207 |
| 269 | 3300013102 | Ga0157371_10024359 | Ga0157371_100243594 | 207 |
| 270 | 3300013105 | Ga0157369_10006236 | Ga0157369_1000623614 | 207 |
| 271 | 3300013296 | Ga0157374_10062823 | Ga0157374_100628233 | 207 |
| 272 | 3300013306 | Ga0163162_10465664 | Ga0163162_104656642 | 207 |
| 273 | 3300013306 | Ga0163162_10533405 | Ga0163162_105334051 | 207 |
| 274 | 3300013307 | Ga0157372_10040974 | Ga0157372_100409745 | 207 |
| 275 | 3300014325 | Ga0163163_10004144 | Ga0163163_100041444 | 207 |
| 276 | 3300014325 | Ga0163163_10320673 | Ga0163163_103206732 | 207 |
| 277 | 3300014745 | Ga0157377_10004637 | Ga0157377_100046374 | 207 |
| 278 | 3300014969 | Ga0157376_10077980 | Ga0157376_100779802 | 207 |
| 279 | 3300017792 | Ga0163161_10005306 | Ga0163161_100053066 | 207 |
| 280 | 3300025893 | Ga0207682_10002315 | Ga0207682_100023154 | 207 |
| 281 | 3300025899 | Ga0207642_10020278 | Ga0207642_100202782 | 207 |
| 282 | 3300025901 | Ga0207688_10019744 | Ga0207688_100197442 | 207 |
| 283 | 3300025903 | Ga0207680_10051753 | Ga0207680_100517532 | 207 |
| 284 | 3300025904 | Ga0207647_10006665 | Ga0207647_100066655 | 207 |
| 285 | 3300025907 | Ga0207645_10002059 | Ga0207645_100020595 | 207 |
| 286 | 3300025908 | Ga0207643_10002962 | Ga0207643_100029625 | 207 |
| 287 | 3300025914 | Ga0207671_10116356 | Ga0207671_101163562 | 207 |
| 288 | 3300025919 | Ga0207657_10002970 | Ga0207657_1000297014 | 207 |
| 289 | 3300025920 | Ga0207649_10000566 | Ga0207649_1000056618 | 207 |
| 290 | 3300025925 | Ga0207650_10000051 | Ga0207650_10000051132 | 207 |
| 291 | 3300025926 | Ga0207659_10014645 | Ga0207659_100146452 | 207 |
| 292 | 3300025927 | Ga0207687_10051257 | Ga0207687_100512572 | 207 |
| 293 | 3300025931 | Ga0207644_10009032 | Ga0207644_100090322 | 207 |
| 294 | 3300025933 | Ga0207706_10022854 | Ga0207706_100228542 | 207 |
| 295 | 3300025936 | Ga0207670_10025075 | Ga0207670_100250752 | 207 |
| 296 | 3300025937 | Ga0207669_10151727 | Ga0207669_101517272 | 207 |
| 297 | 3300025938 | Ga0207704_10009101 | Ga0207704_100091015 | 207 |
| 298 | 3300025941 | Ga0207711_10020175 | Ga0207711_100201752 | 207 |
| 299 | 3300025942 | Ga0207689_10000184 | Ga0207689_1000018431 | 207 |
| 300 | 3300025944 | Ga0207661_10003823 | Ga0207661_100038237 | 207 |
| 301 | 3300025945 | Ga0207679_10000101 | Ga0207679_1000010122 | 207 |
| 302 | 3300025949 | Ga0207667_10413749 | Ga0207667_104137492 | 207 |
| 303 | 3300025960 | Ga0207651_10036492 | Ga0207651_100364921 | 207 |
| 304 | 3300025972 | Ga0207668_10048796 | Ga0207668_100487963 | 207 |
| 305 | 3300025986 | Ga0207658_10004998 | Ga0207658_100049986 | 207 |
| 306 | 3300026023 | Ga0207677_10007786 | Ga0207677_100077865 | 207 |
| 307 | 3300026023 | Ga0207677_10053693 | Ga0207677_100536932 | 207 |
| 308 | 3300026035 | Ga0207703_10023924 | Ga0207703_100239241 | 207 |
| 309 | 3300026041 | Ga0207639_10072220 | Ga0207639_100722201 | 207 |
| 310 | 3300026067 | Ga0207678_10004418 | Ga0207678_100044186 | 207 |
| 311 | 3300026088 | Ga0207641_10000006 | Ga0207641_10000006342 | 207 |
| 312 | 3300026088 | Ga0207641_11287570 | Ga0207641_112875701 | 207 |
| 313 | 3300026089 | Ga0207648_10000664 | Ga0207648_1000066414 | 207 |
| 314 | 3300026095 | Ga0207676_10000155 | Ga0207676_1000015558 | 207 |
| 315 | 3300026116 | Ga0207674_10002842 | Ga0207674_1000284213 | 207 |
| 316 | 3300026118 | Ga0207675_100003987 | Ga0207675_1000039875 | 207 |
| 317 | 3300026121 | Ga0207683_10200743 | Ga0207683_102007432 | 207 |
| 318 | 3300026142 | Ga0207698_10846578 | Ga0207698_108465782 | 207 |
| 319 | 3300028379 | Ga0268266_10008965 | Ga0268266_100089653 | 207 |
| 320 | 3300028380 | Ga0268265_10012477 | Ga0268265_100124774 | 207 |
| 321 | 3300028381 | Ga0268264_10029796 | Ga0268264_100297964 | 207 |
| 322 | 3300028800 | Ga0265338_10008023 | Ga0265338_100080232 | 207 |
| 323 | 3300031250 | Ga0265331_10120107 | Ga0265331_101201072 | 207 |
| 324 | 3300031344 | Ga0265316_10009351 | Ga0265316_100093518 | 207 |
| 325 | 3300044712 | Ga0453684_0726894 | Ga0453684_0726894_143_766 | 207 |
| 326 | 3300048905 | Ga0496102_1088099 | Ga0496102_1088099_47_670 | 207 |
| 327 | 3300048911 | Ga0496108_0001035 | Ga0496108_0001035_13882_14505 | 207 |
| 328 | 3300048912 | Ga0496109_0000126 | Ga0496109_0000126_36706_37329 | 207 |
| 329 | 3300048913 | Ga0496110_0000429 | Ga0496110_0000429_13955_14578 | 207 |
| 330 | 3300048914 | Ga0496111_0000748 | Ga0496111_0000748_9502_10125 | 207 |
| 331 | 3300048915 | Ga0496112_0000615 | Ga0496112_0000615_22351_22974 | 207 |
| 332 | 3300048916 | Ga0496113_0000595 | Ga0496113_0000595_2025_2648 | 207 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5j4d-assembly1.cif.gz_M | e. coli release factor 1 bound to the 70s ribosome in response to a pseudouridylated stop codon | 0.9012 | 97 | 121 |
| 5t5h-assembly1.cif.gz_b | structure and assembly model for the trypanosoma cruzi 60s ribosomal subunit | 0.8288 | 97 | 122 |
| 6swa-assembly1.cif.gz_Y | mus musculus brain neocortex ribosome 60s bound to ebp1 | 0.8154 | 97 | 122 |
| 3h5j-assembly1.cif.gz_A | leud_1-168 small subunit of isopropylmalate isomerase (rv2987c) from mycobacterium tuberculosis | 0.8149 | 1 | 174 |
| 8eui-assembly1.cif.gz_a | ytm1 associated nascent 60s ribosome (-fkbp39) state 3 | 0.8109 | 97 | 122 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q4E4Q8_58_145_3.100.10.10 | Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2; | 0.8162 | 97 | 122 | 3.100.10.10 |
| 3h5jA00 | Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 | 0.8149 | 1 | 174 | 3.20.19.10 |
| af_P0A0F8_66_146_3.100.10.10 | Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2; | 0.812 | 97 | 121 | 3.100.10.10 |
| 3h5jA00 | Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 | 0.8103 | 1 | 174 | 3.20.19.10 |
| af_O14289_535_712_3.20.19.10 | Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 | 0.8055 | 1 | 177 | 3.20.19.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-J8RST4-F1-model_v4 | deleted | 0.9789 | 99 | 193 |
|
| AF-W1Y1Y2-F1-model_v4 | 3-isopropylmalate dehydratase (EC 4.2.1.33) | 0.9575 | 65 | 134 |
GO:0003861
GO:0009098 GO:0009316 |
| AF-A0A661H4V0-F1-model_v4 | 3-isopropylmalate dehydratase (EC 4.2.1.33) | 0.9559 | 85 | 192 |
GO:0003861
GO:0009098 GO:0009316 |
| AF-A0A2E3QQN6-F1-model_v4 | 3-isopropylmalate dehydratase | 0.9511 | 101 | 192 |
GO:0009098
GO:0016829 |
| AF-A0A659SHW6-F1-model_v4 | 3-isopropylmalate dehydratase (EC 4.2.1.33) | 0.9501 | 63 | 195 |
GO:0003861
GO:0009098 GO:0009316 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar