F410852

General Info

Members Datasets Scaffolds Average Seq Length
332 191 332 203

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_100062353|Ga0070707_1000623532
Length 226
Sequence MTEGFLQWGRGGPHHSRRDGGTLETMEPFRVHKGRVAPLDRANVDTDQIIPKQFLKRIERTGFGEFLFYDWRRSSDGTPDLSFPLNQPRYAGASVLVAGKNFGCGSSREHAVWALEDFGFRAVITPSFADIFANNCGKNGVLAVVLAEEEVGEIVSRAEKMPDYHVTVDLEQRKVHDERGFSATFEIDEFTRHCLLNGLDDIGLTLQHEPEIAAYESRHPVPQSTK

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
148 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
149 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
152 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
153 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
154 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
155 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
156 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
157 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
158 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
159 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
160 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
161 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
162 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
163 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
164 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
165 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
166 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
167 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
168 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
169 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
170 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
171 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
172 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
173 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
174 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
175 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
176 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
177 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
178 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
179 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
180 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
181 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
182 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
183 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
184 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
185 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
186 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
187 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
188 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
189 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
190 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
191 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.49
Metatranscriptomes 1.51
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.83
Rhizosphere 91.87
Stem 0
Stem Tuber 0
Unclassified 0.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_501321 2162886012 Bacteria 2111
2 JGI24752J21851_1002003 3300001976 Bacteria 2712
3 JGI24737J22298_10037399 3300001990 Bacteria 1496
4 JGI24743J22301_10002414 3300001991 Bacteria 2811
5 JGI24034J26672_10007702 3300002239 Bacteria 1567
6 JGI24751J29686_10026544 3300002459 Bacteria 1202
7 Ga0065712_10112424 3300005290 Bacteria 1800
8 Ga0065715_10034969 3300005293 Bacteria 1287
9 Ga0070658_10030686 3300005327 Bacteria 4317
10 Ga0070676_10008364 3300005328 Bacteria 5575
11 Ga0070683_100003154 3300005329 Bacteria 13284
12 Ga0070670_100042105 3300005331 Bacteria 3925
13 Ga0070677_10001242 3300005333 Bacteria 8199
14 Ga0068869_100003138 3300005334 Bacteria 10078
15 Ga0068869_100319232 3300005334 Bacteria 1259
16 Ga0070682_100009609 3300005337 Bacteria 5475
17 Ga0068868_100005860 3300005338 Bacteria 8667
18 Ga0068868_100023863 3300005338 Bacteria 4634
19 Ga0070660_100014762 3300005339 Bacteria 5635
20 Ga0070689_100228640 3300005340 Bacteria 1528
21 Ga0070661_100003185 3300005344 Bacteria 11309
22 Ga0070668_100003135 3300005347 Bacteria 12195
23 Ga0070669_100010156 3300005353 Bacteria 6694
24 Ga0070675_100043638 3300005354 Bacteria 3665
25 Ga0070673_100091999 3300005364 Bacteria 2480
26 Ga0070688_100003495 3300005365 Bacteria 8096
27 Ga0070659_100046043 3300005366 Bacteria 3419
28 Ga0070709_10117411 3300005434 Bacteria 1798
29 Ga0070714_100011197 3300005435 Bacteria 7111
30 Ga0070714_100028111 3300005435 Bacteria 4662
31 Ga0070714_100618241 3300005435 Bacteria 1041
32 Ga0070713_100011561 3300005436 Bacteria 6434
33 Ga0070713_100037216 3300005436 Bacteria 3933
34 Ga0070713_100102341 3300005436 Bacteria 2484
35 Ga0070711_100113107 3300005439 Bacteria 1996
36 Ga0070711_100115503 3300005439 Bacteria 1977
37 Ga0070700_100537207 3300005441 Bacteria 906
38 Ga0070694_100181502 3300005444 Bacteria 1557
39 Ga0070708_100002211 3300005445 Bacteria 15036
40 Ga0070708_100002318 3300005445 Bacteria 14730
41 Ga0070708_100017296 3300005445 Bacteria 6010
42 Ga0070662_100207838 3300005457 Bacteria 1556
43 Ga0070662_100277006 3300005457 Bacteria 1356
44 Ga0068867_100029578 3300005459 Bacteria 3947
45 Ga0068867_100107652 3300005459 Bacteria 2137
46 Ga0068867_100752097 3300005459 Bacteria 865
47 Ga0070685_10001409 3300005466 Bacteria 12591
48 Ga0070706_100001249 3300005467 Bacteria 27215
49 Ga0070706_100002917 3300005467 Bacteria 17028
50 Ga0070706_100003337 3300005467 Bacteria 15839
51 Ga0070706_100369626 3300005467 Bacteria 1336
52 Ga0070707_100004406 3300005468 Bacteria 13195
53 Ga0070707_100008917 3300005468 Bacteria 9303
54 Ga0070707_100031608 3300005468 Bacteria 5044
55 Ga0070707_100062353 3300005468 Bacteria 3577
56 Ga0070707_100312401 3300005468 Bacteria 1528
57 Ga0070707_100456397 3300005468 Bacteria 1238
58 Ga0070707_100732654 3300005468 Bacteria 952
59 Ga0070707_100796980 3300005468 Bacteria 908
60 Ga0070698_100000091 3300005471 Bacteria 71604
61 Ga0070698_100006156 3300005471 Bacteria 13066
62 Ga0070698_100247845 3300005471 Bacteria 1714
63 Ga0070699_100001679 3300005518 Bacteria 20176
64 Ga0070699_100076619 3300005518 Bacteria 2911
65 Ga0070699_100544943 3300005518 Bacteria 1056
66 Ga0070684_100003440 3300005535 Bacteria 11880
67 Ga0070697_100001267 3300005536 Bacteria 19065
68 Ga0070697_100001538 3300005536 Bacteria 17569
69 Ga0070697_100004847 3300005536 Bacteria 10317
70 Ga0070697_100068795 3300005536 Bacteria 2899
71 Ga0070697_100121448 3300005536 Bacteria 2185
72 Ga0070697_100259196 3300005536 Bacteria 1488
73 Ga0070697_100324276 3300005536 Bacteria 1327
74 Ga0070697_101049828 3300005536 Bacteria 725
75 Ga0068853_100065031 3300005539 Bacteria 3164
76 Ga0070672_100003094 3300005543 Bacteria 10738
77 Ga0070672_100232230 3300005543 Bacteria 1550
78 Ga0070665_100229558 3300005548 Bacteria 1856
79 Ga0068855_100066732 3300005563 Bacteria 4194
80 Ga0070664_100047198 3300005564 Bacteria 3638
81 Ga0068857_100001862 3300005577 Bacteria 16990
82 Ga0068854_100253557 3300005578 Bacteria 1406
83 Ga0068856_100410558 3300005614 Unclassified 1374
84 Ga0070702_100001029 3300005615 Bacteria 11058
85 Ga0068852_100003843 3300005616 Bacteria 10550
86 Ga0068859_100019211 3300005617 Bacteria 6865
87 Ga0068859_100053368 3300005617 Bacteria 4066
88 Ga0068864_100048853 3300005618 Bacteria 3638
89 Ga0068861_100952789 3300005719 Unclassified 816
90 Ga0068863_100042740 3300005841 Bacteria 4306
91 Ga0068863_100046161 3300005841 Bacteria 4135
92 Ga0068858_100005535 3300005842 Bacteria 12367
93 Ga0068858_100005999 3300005842 Bacteria 11865
94 Ga0068860_100562536 3300005843 Bacteria 1143
95 Ga0068860_100610627 3300005843 Bacteria 1097
96 Ga0068862_100052375 3300005844 Bacteria 3492
97 Ga0068862_100124771 3300005844 Bacteria 2272
98 Ga0081455_10141170 3300005937 Bacteria 1870
99 Ga0070717_10001290 3300006028 Bacteria 17132
100 Ga0070717_10009846 3300006028 Bacteria 7200
101 Ga0070717_10014846 3300006028 Bacteria 5994
102 Ga0070717_10181795 3300006028 Bacteria 1833
103 Ga0070717_10360986 3300006028 Bacteria 1300
104 Ga0070715_10573017 3300006163 Bacteria 658
105 Ga0070716_100134130 3300006173 Bacteria 1570
106 Ga0097621_100198346 3300006237 Bacteria 1741
107 Ga0097621_100205221 3300006237 Bacteria 1712
108 Ga0097621_100416976 3300006237 Bacteria 1204
109 Ga0097621_100590211 3300006237 Bacteria 1014
110 Ga0068871_100294672 3300006358 Bacteria 1422
111 Ga0068871_100379694 3300006358 Bacteria 1255
112 Ga0068871_101092357 3300006358 Bacteria 746
113 Ga0075433_10852794 3300006852 Bacteria 795
114 Ga0075434_100003171 3300006871 Bacteria 14661
115 Ga0075434_100006917 3300006871 Bacteria 10453
116 Ga0068865_100020208 3300006881 Bacteria 4318
117 Ga0068865_100740141 3300006881 Bacteria 843
118 Ga0097620_100019211 3300006931 Bacteria 6865
119 Ga0097620_100053364 3300006931 Bacteria 4066
120 Ga0075435_100051461 3300007076 Bacteria 3318
121 Ga0075435_100185866 3300007076 Bacteria 1757
122 Ga0075435_100236667 3300007076 Bacteria 1552
123 Ga0105250_10017978 3300009092 Bacteria 2868
124 Ga0105250_10232561 3300009092 Bacteria 784
125 Ga0105245_10003694 3300009098 Bacteria 13659
126 Ga0105245_10018803 3300009098 Bacteria 6046
127 Ga0105247_10025937 3300009101 Bacteria 3538
128 Ga0114129_10882114 3300009147 Bacteria 1135
129 Ga0105241_10087385 3300009174 Bacteria 2454
130 Ga0105241_10732050 3300009174 Bacteria 905
131 Ga0105248_10146996 3300009177 Bacteria 2660
132 Ga0105248_10821580 3300009177 Unclassified 1049
133 Ga0105248_10961255 3300009177 Bacteria 965
134 Ga0105237_10206241 3300009545 Bacteria 1966
135 Ga0105237_10227489 3300009545 Bacteria 1866
136 Ga0105238_10438001 3300009551 Bacteria 1303
137 Ga0105249_10056661 3300009553 Bacteria 3588
138 Ga0105239_10019815 3300010375 Bacteria 7424
139 Ga0105246_10008033 3300011119 Bacteria 6475
140 Ga0157373_10005319 3300013100 Bacteria 9671
141 Ga0157371_10024359 3300013102 Bacteria 4420
142 Ga0157369_10006236 3300013105 Bacteria 13839
143 Ga0157374_10001313 3300013296 Bacteria 21164
144 Ga0157374_10004674 3300013296 Bacteria 11492
145 Ga0157374_10062823 3300013296 Bacteria 3482
146 Ga0157374_10728615 3300013296 Bacteria 1006
147 Ga0157378_10335654 3300013297 Bacteria 1472
148 Ga0157378_10878741 3300013297 Bacteria 926
149 Ga0163162_10009076 3300013306 Bacteria 9668
150 Ga0163162_10026375 3300013306 Bacteria 5742
151 Ga0163162_10465664 3300013306 Bacteria 1395
152 Ga0163162_10533405 3300013306 Bacteria 1303
153 Ga0157372_10040974 3300013307 Bacteria 5119
154 Ga0157372_10168395 3300013307 Bacteria 2534
155 Ga0157375_10016877 3300013308 Bacteria 6574
156 Ga0157375_10040731 3300013308 Bacteria 4481
157 Ga0157375_10960766 3300013308 Bacteria 996
158 Ga0163163_10004144 3300014325 Bacteria 12345
159 Ga0163163_10320673 3300014325 Bacteria 1603
160 Ga0163163_10999658 3300014325 Bacteria 900
161 Ga0157380_10006082 3300014326 Bacteria 8460
162 Ga0182008_10005338 3300014497 Bacteria 7337
163 Ga0157377_10004637 3300014745 Bacteria 6357
164 Ga0157379_10006245 3300014968 Bacteria 10258
165 Ga0157379_10115694 3300014968 Bacteria 2411
166 Ga0157379_10118730 3300014968 Bacteria 2379
167 Ga0157379_10222087 3300014968 Bacteria 1712
168 Ga0157376_10010434 3300014969 Bacteria 6794
169 Ga0157376_10077980 3300014969 Bacteria 2835
170 Ga0157376_10368569 3300014969 Bacteria 1380
171 Ga0157376_10527826 3300014969 Bacteria 1165
172 Ga0182007_10008958 3300015262 Bacteria 4076
173 Ga0163161_10005306 3300017792 Bacteria 8970
174 Ga0207682_10002315 3300025893 Bacteria 8586
175 Ga0207642_10020278 3300025899 Bacteria 2591
176 Ga0207688_10019744 3300025901 Bacteria 3673
177 Ga0207680_10051753 3300025903 Bacteria 2458
178 Ga0207647_10002827 3300025904 Bacteria 13100
179 Ga0207647_10006665 3300025904 Bacteria 8392
180 Ga0207699_10109627 3300025906 Bacteria 1767
181 Ga0207699_10302234 3300025906 Bacteria 1118
182 Ga0207645_10002059 3300025907 Bacteria 16116
183 Ga0207643_10002962 3300025908 Bacteria 9161
184 Ga0207684_10000383 3300025910 Bacteria 59620
185 Ga0207684_10001626 3300025910 Bacteria 23847
186 Ga0207684_10007732 3300025910 Bacteria 9626
187 Ga0207684_10104450 3300025910 Bacteria 2422
188 Ga0207684_10105016 3300025910 Bacteria 2416
189 Ga0207684_10331979 3300025910 Bacteria 1310
190 Ga0207695_10298589 3300025913 Bacteria 1502
191 Ga0207671_10061200 3300025914 Bacteria 2793
192 Ga0207671_10116356 3300025914 Bacteria 2039
193 Ga0207693_10024267 3300025915 Bacteria 4813
194 Ga0207663_10566887 3300025916 Bacteria 889
195 Ga0207657_10002970 3300025919 Bacteria 18184
196 Ga0207649_10000566 3300025920 Bacteria 25447
197 Ga0207646_10000229 3300025922 Bacteria 77035
198 Ga0207646_10001190 3300025922 Bacteria 32778
199 Ga0207646_10067226 3300025922 Bacteria 3200
200 Ga0207646_10157807 3300025922 Bacteria 2047
201 Ga0207646_10196754 3300025922 Bacteria 1820
202 Ga0207646_10312812 3300025922 Bacteria 1419
203 Ga0207646_10597850 3300025922 Bacteria 990
204 Ga0207694_10317093 3300025924 Bacteria 1286
205 Ga0207650_10000051 3300025925 Bacteria 168652
206 Ga0207659_10014645 3300025926 Bacteria 5064
207 Ga0207687_10051257 3300025927 Bacteria 2876
208 Ga0207700_10058419 3300025928 Bacteria 2913
209 Ga0207700_10080276 3300025928 Bacteria 2543
210 Ga0207700_10108058 3300025928 Bacteria 2233
211 Ga0207700_10129763 3300025928 Bacteria 2056
212 Ga0207700_10234847 3300025928 Bacteria 1561
213 Ga0207664_10006501 3300025929 Bacteria 8045
214 Ga0207664_10050646 3300025929 Bacteria 3276
215 Ga0207664_10284323 3300025929 Bacteria 1452
216 Ga0207644_10009032 3300025931 Bacteria 6532
217 Ga0207706_10022854 3300025933 Bacteria 5611
218 Ga0207706_10233407 3300025933 Bacteria 1609
219 Ga0207670_10025075 3300025936 Bacteria 3737
220 Ga0207669_10151727 3300025937 Bacteria 1624
221 Ga0207704_10009101 3300025938 Bacteria 4776
222 Ga0207704_10045113 3300025938 Bacteria 2616
223 Ga0207665_10029441 3300025939 Bacteria 3630
224 Ga0207665_10162423 3300025939 Bacteria 1608
225 Ga0207665_10263247 3300025939 Bacteria 1278
226 Ga0207711_10020175 3300025941 Bacteria 5553
227 Ga0207689_10000184 3300025942 Bacteria 54232
228 Ga0207689_10040050 3300025942 Bacteria 3879
229 Ga0207689_10305004 3300025942 Bacteria 1320
230 Ga0207661_10003823 3300025944 Bacteria 10499
231 Ga0207679_10000101 3300025945 Bacteria 71096
232 Ga0207667_10413749 3300025949 Bacteria 1372
233 Ga0207667_11003050 3300025949 Unclassified 822
234 Ga0207651_10036492 3300025960 Bacteria 3209
235 Ga0207668_10048796 3300025972 Bacteria 2907
236 Ga0207658_10004998 3300025986 Bacteria 9137
237 Ga0207677_10007786 3300026023 Bacteria 5947
238 Ga0207677_10052655 3300026023 Bacteria 2766
239 Ga0207677_10053693 3300026023 Bacteria 2745
240 Ga0207703_10001248 3300026035 Bacteria 23840
241 Ga0207703_10023924 3300026035 Bacteria 4804
242 Ga0207639_10072220 3300026041 Bacteria 2701
243 Ga0207678_10004418 3300026067 Bacteria 12647
244 Ga0207641_10000006 3300026088 Bacteria 442569
245 Ga0207641_10041235 3300026088 Bacteria 3868
246 Ga0207641_10226143 3300026088 Bacteria 1737
247 Ga0207641_10606424 3300026088 Bacteria 1072
248 Ga0207641_11287570 3300026088 Bacteria 731
249 Ga0207648_10000664 3300026089 Bacteria 38538
250 Ga0207648_10079508 3300026089 Bacteria 2860
251 Ga0207648_10384311 3300026089 Bacteria 1270
252 Ga0207676_10000155 3300026095 Bacteria 59757
253 Ga0207674_10002842 3300026116 Bacteria 21530
254 Ga0207675_100003987 3300026118 Bacteria 14322
255 Ga0207675_100622781 3300026118 Bacteria 1084
256 Ga0207683_10200743 3300026121 Bacteria 1813
257 Ga0207698_10846578 3300026142 Bacteria 919
258 Ga0268266_10008965 3300028379 Bacteria 8854
259 Ga0268266_10181978 3300028379 Bacteria 1914
260 Ga0268266_10296721 3300028379 Bacteria 1507
261 Ga0268265_10012477 3300028380 Bacteria 5758
262 Ga0268265_10087399 3300028380 Bacteria 2480
263 Ga0268264_10029796 3300028381 Bacteria 4472
264 Ga0268264_10757182 3300028381 Bacteria 968
265 Ga0265338_10008023 3300028800 Bacteria 12919
266 Ga0265338_10126122 3300028800 Bacteria 2031
267 Ga0265762_1000716 3300030760 Bacteria 5876
268 Ga0265770_1010654 3300030878 Bacteria 1338
269 Ga0265765_1006286 3300030879 Bacteria 1261
270 Ga0265760_10000743 3300031090 Bacteria 9310
271 Ga0265760_10004105 3300031090 Bacteria 4194
272 Ga0265340_10021238 3300031247 Bacteria 3330
273 Ga0265331_10120107 3300031250 Bacteria 1202
274 Ga0265316_10009351 3300031344 Bacteria 9032
275 Ga0265314_10000920 3300031711 Bacteria 34667
276 Ga0265314_10039715 3300031711 Bacteria 3386
277 Ga0307411_10701055 3300032005 Bacteria 882
278 Ga0316214_1005083 3300033545 Bacteria 1715
279 Ga0373931_0074163 3300035691 Bacteria 1864
280 Ga0373935_0001316 3300035692 Bacteria 13737
281 Ga0373927_0064074 3300035695 Bacteria 2378
282 Ga0373947_0010322 3300035725 Bacteria 5359
283 Ga0373947_0089317 3300035725 Bacteria 1919
284 Ga0373925_0005124 3300037068 Bacteria 9817
285 Ga0451577_0051781 3300042876 Bacteria 3666
286 Ga0453684_0726894 3300044712 Bacteria 1077
287 Ga0451576_0069484 3300045051 Bacteria 3665
288 Ga0466967_0060877 3300045976 Bacteria 3348
289 Ga0495603_0110476 3300046455 Bacteria 1604
290 Ga0495580_0002349 3300046472 Bacteria 16510
291 Ga0495580_0002714 3300046472 Bacteria 15301
292 Ga0495580_0011121 3300046472 Bacteria 6975
293 Ga0495580_0033833 3300046472 Bacteria 3681
294 Ga0495582_0002549 3300046473 Bacteria 10144
295 Ga0495665_0004192 3300046531 Bacteria 7778
296 Ga0495659_0021209 3300046664 Bacteria 2188
297 Ga0496100_0074931 3300048903 Bacteria 2268
298 Ga0496100_0090856 3300048903 Bacteria 2083
299 Ga0496101_0110561 3300048904 Bacteria 2068
300 Ga0496101_0272760 3300048904 Bacteria 1321
301 Ga0496102_0030118 3300048905 Bacteria 4857
302 Ga0496102_0955933 3300048905 Bacteria 778
303 Ga0496102_1088099 3300048905 Bacteria 719
304 Ga0496103_0001542 3300048906 Bacteria 15338
305 Ga0496103_0304456 3300048906 Bacteria 1025
306 Ga0496104_0005846 3300048907 Bacteria 10775
307 Ga0496104_0115809 3300048907 Bacteria 2572
308 Ga0496105_0180605 3300048908 Bacteria 1728
309 Ga0496105_0359112 3300048908 Bacteria 1162
310 Ga0496106_0140787 3300048909 Bacteria 1897
311 Ga0496107_0034480 3300048910 Bacteria 3626
312 Ga0496108_0001035 3300048911 Bacteria 21687
313 Ga0496109_0000126 3300048912 Bacteria 77920
314 Ga0496110_0000429 3300048913 Bacteria 28526
315 Ga0496111_0000748 3300048914 Bacteria 17329
316 Ga0496112_0000615 3300048915 Bacteria 24595
317 Ga0496112_0030673 3300048915 Bacteria 5207
318 Ga0496112_1001552 3300048915 Bacteria 755
319 Ga0496113_0000595 3300048916 Bacteria 18025
320 Ga0496114_0260418 3300048917 Bacteria 1527
321 Ga0496115_0105197 3300048918 Bacteria 2316
322 Ga0496115_0226486 3300048918 Bacteria 1542
323 nmdc:mga0n895_135157_c1 3300050512 Bacteria 2492
324 nmdc:mga0n895_2407_c1 3300050512 Bacteria 14583
325 nmdc:mga0n895_3709_c1 3300050512 Bacteria 12351
326 nmdc:mga0rr50_128382_c1 3300050513 Bacteria 2027
327 nmdc:mga0rr50_169095_c1 3300050513 Bacteria 1780
328 nmdc:mga0rr50_286999_c1 3300050513 Bacteria 1374
329 nmdc:mga0rr50_35979_c1 3300050513 Bacteria 3561
330 nmdc:mga08x19_108246_c1 3300050514 Bacteria 1851
331 nmdc:mga08x19_16534_c1 3300050514 Bacteria 4501
332 nmdc:mga0a205_26435_c3 3300050515 Bacteria 832

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028800 Ga0265338_10126122 Ga0265338_101261221 184
2 3300025939 Ga0207665_10029441 Ga0207665_100294412 188
3 3300005459 Ga0068867_100752097 Ga0068867_1007520971 193
4 3300014326 Ga0157380_10006082 Ga0157380_100060824 193
5 3300026089 Ga0207648_10384311 Ga0207648_103843111 193
6 3300005334 Ga0068869_100003138 Ga0068869_1000031382 194
7 3300005338 Ga0068868_100005860 Ga0068868_1000058603 194
8 3300005340 Ga0070689_100228640 Ga0070689_1002286402 194
9 3300005457 Ga0070662_100207838 Ga0070662_1002078382 194
10 3300005459 Ga0068867_100107652 Ga0068867_1001076522 194
11 3300005543 Ga0070672_100232230 Ga0070672_1002322302 194
12 3300005617 Ga0068859_100019211 Ga0068859_1000192114 194
13 3300005719 Ga0068861_100952789 Ga0068861_1009527891 194
14 3300005841 Ga0068863_100042740 Ga0068863_1000427403 194
15 3300005842 Ga0068858_100005999 Ga0068858_10000599913 194
16 3300005844 Ga0068862_100052375 Ga0068862_1000523752 194
17 3300006237 Ga0097621_100416976 Ga0097621_1004169762 194
18 3300006358 Ga0068871_101092357 Ga0068871_1010923571 194
19 3300006881 Ga0068865_100740141 Ga0068865_1007401412 194
20 3300006931 Ga0097620_100019211 Ga0097620_1000192114 194
21 3300009545 Ga0105237_10206241 Ga0105237_102062411 194
22 3300009545 Ga0105237_10227489 Ga0105237_102274892 194
23 3300010375 Ga0105239_10019815 Ga0105239_100198157 194
24 3300013296 Ga0157374_10001313 Ga0157374_100013132 194
25 3300013306 Ga0163162_10009076 Ga0163162_1000907611 194
26 3300013307 Ga0157372_10168395 Ga0157372_101683953 194
27 3300013308 Ga0157375_10016877 Ga0157375_100168774 194
28 3300013308 Ga0157375_10040731 Ga0157375_100407312 194
29 3300014968 Ga0157379_10115694 Ga0157379_101156942 194
30 3300014968 Ga0157379_10222087 Ga0157379_102220872 194
31 3300014969 Ga0157376_10010434 Ga0157376_100104348 194
32 3300025904 Ga0207647_10002827 Ga0207647_100028276 194
33 3300025914 Ga0207671_10061200 Ga0207671_100612001 194
34 3300025933 Ga0207706_10233407 Ga0207706_102334072 194
35 3300025938 Ga0207704_10045113 Ga0207704_100451132 194
36 3300025942 Ga0207689_10040050 Ga0207689_100400501 194
37 3300025949 Ga0207667_11003050 Ga0207667_110030502 194
38 3300026023 Ga0207677_10052655 Ga0207677_100526552 194
39 3300026035 Ga0207703_10001248 Ga0207703_1000124817 194
40 3300026088 Ga0207641_10041235 Ga0207641_100412352 194
41 3300026088 Ga0207641_10226143 Ga0207641_102261432 194
42 3300026089 Ga0207648_10079508 Ga0207648_100795082 194
43 3300026118 Ga0207675_100622781 Ga0207675_1006227812 194
44 3300028379 Ga0268266_10296721 Ga0268266_102967212 194
45 3300028380 Ga0268265_10087399 Ga0268265_100873992 194
46 3300048915 Ga0496112_1001552 Ga0496112_1001552_98_685 194
47 3300005937 Ga0081455_10141170 Ga0081455_101411702 195
48 3300046664 Ga0495659_0021209 Ga0495659_0021209_1588_2178 195
49 3300005435 Ga0070714_100618241 Ga0070714_1006182411 196
50 3300009147 Ga0114129_10882114 Ga0114129_108821142 196
51 3300025928 Ga0207700_10108058 Ga0207700_101080581 196
52 3300042876 Ga0451577_0051781 Ga0451577_0051781_1598_2191 196
53 3300045051 Ga0451576_0069484 Ga0451576_0069484_1053_1646 196
54 3300005434 Ga0070709_10117411 Ga0070709_101174112 198
55 3300006237 Ga0097621_100198346 Ga0097621_1001983463 198
56 3300006358 Ga0068871_100379694 Ga0068871_1003796942 198
57 3300006852 Ga0075433_10852794 Ga0075433_108527941 198
58 3300006871 Ga0075434_100003171 Ga0075434_10000317111 198
59 3300007076 Ga0075435_100185866 Ga0075435_1001858661 198
60 3300025906 Ga0207699_10109627 Ga0207699_101096272 198
61 3300025939 Ga0207665_10162423 Ga0207665_101624232 198
62 3300030878 Ga0265770_1010654 Ga0265770_10106542 198
63 3300031090 Ga0265760_10000743 Ga0265760_100007432 198
64 3300045976 Ga0466967_0060877 Ga0466967_0060877_181_780 198
65 3300046455 Ga0495603_0110476 Ga0495603_0110476_596_1195 198
66 3300046472 Ga0495580_0002714 Ga0495580_0002714_12529_13128 198
67 3300050512 nmdc:mga0n895_2407_c1 nmdc:mga0n895_2407_c1_6449_7048 198
68 3300050513 nmdc:mga0rr50_169095_c1 nmdc:mga0rr50_169095_c1_1128_1727 198
69 3300050515 nmdc:mga0a205_26435_c3 nmdc:mga0a205_26435_c3_205_804 198
70 3300005468 Ga0070707_100312401 Ga0070707_1003124012 199
71 3300005471 Ga0070698_100247845 Ga0070698_1002478452 199
72 3300005536 Ga0070697_100259196 Ga0070697_1002591962 199
73 3300006028 Ga0070717_10009846 Ga0070717_100098468 199
74 3300025910 Ga0207684_10105016 Ga0207684_101050165 199
75 3300025939 Ga0207665_10263247 Ga0207665_102632472 199
76 3300005334 Ga0068869_100319232 Ga0068869_1003192322 200
77 3300005444 Ga0070694_100181502 Ga0070694_1001815022 200
78 3300005468 Ga0070707_100062353 Ga0070707_1000623532 200
79 3300005548 Ga0070665_100229558 Ga0070665_1002295582 200
80 3300005614 Ga0068856_100410558 Ga0068856_1004105582 200
81 3300005841 Ga0068863_100046161 Ga0068863_1000461613 200
82 3300005843 Ga0068860_100562536 Ga0068860_1005625362 200
83 3300006163 Ga0070715_10573017 Ga0070715_105730171 200
84 3300006173 Ga0070716_100134130 Ga0070716_1001341302 200
85 3300006237 Ga0097621_100590211 Ga0097621_1005902112 200
86 3300006358 Ga0068871_100294672 Ga0068871_1002946722 200
87 3300007076 Ga0075435_100236667 Ga0075435_1002366672 200
88 3300009174 Ga0105241_10732050 Ga0105241_107320501 200
89 3300009177 Ga0105248_10821580 Ga0105248_108215802 200
90 3300009177 Ga0105248_10961255 Ga0105248_109612551 200
91 3300009551 Ga0105238_10438001 Ga0105238_104380012 200
92 3300013296 Ga0157374_10004674 Ga0157374_100046746 200
93 3300013296 Ga0157374_10728615 Ga0157374_107286152 200
94 3300013297 Ga0157378_10335654 Ga0157378_103356542 200
95 3300013297 Ga0157378_10878741 Ga0157378_108787411 200
96 3300013306 Ga0163162_10026375 Ga0163162_100263754 200
97 3300013308 Ga0157375_10960766 Ga0157375_109607662 200
98 3300014325 Ga0163163_10999658 Ga0163163_109996581 200
99 3300014968 Ga0157379_10006245 Ga0157379_100062452 200
100 3300014968 Ga0157379_10118730 Ga0157379_101187302 200
101 3300014969 Ga0157376_10368569 Ga0157376_103685692 200
102 3300014969 Ga0157376_10527826 Ga0157376_105278262 200
103 3300025906 Ga0207699_10302234 Ga0207699_103022342 200
104 3300025913 Ga0207695_10298589 Ga0207695_102985892 200
105 3300025922 Ga0207646_10067226 Ga0207646_100672262 200
106 3300025924 Ga0207694_10317093 Ga0207694_103170932 200
107 3300025942 Ga0207689_10305004 Ga0207689_103050042 200
108 3300026088 Ga0207641_10606424 Ga0207641_106064242 200
109 3300028379 Ga0268266_10181978 Ga0268266_101819782 200
110 3300028381 Ga0268264_10757182 Ga0268264_107571821 200
111 3300035691 Ga0373931_0074163 Ga0373931_0074163_1242_1847 200
112 3300046472 Ga0495580_0033833 Ga0495580_0033833_61_699 200
113 3300048903 Ga0496100_0074931 Ga0496100_0074931_698_1303 200
114 3300048903 Ga0496100_0090856 Ga0496100_0090856_55_660 200
115 3300048904 Ga0496101_0110561 Ga0496101_0110561_910_1515 200
116 3300048904 Ga0496101_0272760 Ga0496101_0272760_530_1135 200
117 3300048905 Ga0496102_0955933 Ga0496102_0955933_31_636 200
118 3300048906 Ga0496103_0001542 Ga0496103_0001542_4352_4957 200
119 3300048907 Ga0496104_0005846 Ga0496104_0005846_4105_4710 200
120 3300048908 Ga0496105_0180605 Ga0496105_0180605_959_1564 200
121 3300048908 Ga0496105_0359112 Ga0496105_0359112_392_997 200
122 3300048909 Ga0496106_0140787 Ga0496106_0140787_1102_1707 200
123 3300048910 Ga0496107_0034480 Ga0496107_0034480_530_1135 200
124 3300048915 Ga0496112_0030673 Ga0496112_0030673_507_1112 200
125 3300048917 Ga0496114_0260418 Ga0496114_0260418_693_1298 200
126 3300048918 Ga0496115_0105197 Ga0496115_0105197_1585_2190 200
127 3300048918 Ga0496115_0226486 Ga0496115_0226486_375_980 200
128 3300050513 nmdc:mga0rr50_286999_c1 nmdc:mga0rr50_286999_c1_525_1130 200
129 3300005435 Ga0070714_100011197 Ga0070714_1000111975 201
130 3300005435 Ga0070714_100028111 Ga0070714_1000281112 201
131 3300005436 Ga0070713_100011561 Ga0070713_1000115615 201
132 3300005436 Ga0070713_100102341 Ga0070713_1001023412 201
133 3300005439 Ga0070711_100113107 Ga0070711_1001131074 201
134 3300005445 Ga0070708_100002211 Ga0070708_1000022118 201
135 3300005467 Ga0070706_100001249 Ga0070706_10000124928 201
136 3300005468 Ga0070707_100008917 Ga0070707_1000089172 201
137 3300005471 Ga0070698_100000091 Ga0070698_10000009114 201
138 3300005518 Ga0070699_100076619 Ga0070699_1000766192 201
139 3300005536 Ga0070697_100004847 Ga0070697_1000048477 201
140 3300006028 Ga0070717_10001290 Ga0070717_100012904 201
141 3300006028 Ga0070717_10360986 Ga0070717_103609862 201
142 3300006871 Ga0075434_100006917 Ga0075434_1000069179 201
143 3300007076 Ga0075435_100051461 Ga0075435_1000514612 201
144 3300025910 Ga0207684_10000383 Ga0207684_1000038348 201
145 3300025915 Ga0207693_10024267 Ga0207693_100242675 201
146 3300025922 Ga0207646_10000229 Ga0207646_1000022963 201
147 3300025928 Ga0207700_10080276 Ga0207700_100802763 201
148 3300025928 Ga0207700_10234847 Ga0207700_102348472 201
149 3300025929 Ga0207664_10050646 Ga0207664_100506464 201
150 3300025929 Ga0207664_10284323 Ga0207664_102843232 201
151 3300035692 Ga0373935_0001316 Ga0373935_0001316_6634_7242 201
152 3300035695 Ga0373927_0064074 Ga0373927_0064074_354_962 201
153 3300035725 Ga0373947_0010322 Ga0373947_0010322_2187_2795 201
154 3300035725 Ga0373947_0089317 Ga0373947_0089317_1267_1875 201
155 3300037068 Ga0373925_0005124 Ga0373925_0005124_2952_3560 201
156 3300046472 Ga0495580_0002349 Ga0495580_0002349_6263_6871 201
157 3300046473 Ga0495582_0002549 Ga0495582_0002549_76_684 201
158 3300046531 Ga0495665_0004192 Ga0495665_0004192_219_827 201
159 3300048907 Ga0496104_0115809 Ga0496104_0115809_436_1044 201
160 3300050512 nmdc:mga0n895_135157_c1 nmdc:mga0n895_135157_c1_503_1111 201
161 3300050512 nmdc:mga0n895_3709_c1 nmdc:mga0n895_3709_c1_4328_4936 201
162 3300050513 nmdc:mga0rr50_128382_c1 nmdc:mga0rr50_128382_c1_1276_1884 201
163 3300050513 nmdc:mga0rr50_35979_c1 nmdc:mga0rr50_35979_c1_2668_3276 201
164 3300050514 nmdc:mga08x19_108246_c1 nmdc:mga08x19_108246_c1_727_1335 201
165 3300050514 nmdc:mga08x19_16534_c1 nmdc:mga08x19_16534_c1_3066_3674 201
166 3300005468 Ga0070707_100456397 Ga0070707_1004563972 202
167 3300025922 Ga0207646_10597850 Ga0207646_105978501 202
168 3300025929 Ga0207664_10006501 Ga0207664_100065017 202
169 3300030760 Ga0265762_1000716 Ga0265762_10007163 202
170 3300030879 Ga0265765_1006286 Ga0265765_10062861 202
171 3300031090 Ga0265760_10004105 Ga0265760_100041053 202
172 3300005445 Ga0070708_100017296 Ga0070708_1000172965 203
173 3300005467 Ga0070706_100003337 Ga0070706_1000033374 203
174 3300005467 Ga0070706_100369626 Ga0070706_1003696262 203
175 3300005536 Ga0070697_100001267 Ga0070697_10000126711 203
176 3300005536 Ga0070697_100121448 Ga0070697_1001214482 203
177 3300005536 Ga0070697_100324276 Ga0070697_1003242762 203
178 3300005536 Ga0070697_101049828 Ga0070697_1010498281 203
179 3300006028 Ga0070717_10014846 Ga0070717_100148464 203
180 3300025910 Ga0207684_10007732 Ga0207684_100077323 203
181 3300025910 Ga0207684_10331979 Ga0207684_103319792 203
182 3300048905 Ga0496102_0030118 Ga0496102_0030118_2378_2992 203
183 3300048906 Ga0496103_0304456 Ga0496103_0304456_126_740 203
184 3300005445 Ga0070708_100002318 Ga0070708_1000023185 204
185 3300005467 Ga0070706_100002917 Ga0070706_1000029179 204
186 3300005468 Ga0070707_100004406 Ga0070707_1000044068 204
187 3300005471 Ga0070698_100006156 Ga0070698_1000061566 204
188 3300005518 Ga0070699_100001679 Ga0070699_10000167913 204
189 3300005536 Ga0070697_100001538 Ga0070697_1000015384 204
190 3300025910 Ga0207684_10001626 Ga0207684_1000162624 204
191 3300025922 Ga0207646_10001190 Ga0207646_1000119025 204
192 3300005439 Ga0070711_100115503 Ga0070711_1001155032 205
193 3300005468 Ga0070707_100031608 Ga0070707_1000316084 205
194 3300005536 Ga0070697_100068795 Ga0070697_1000687952 205
195 3300014497 Ga0182008_10005338 Ga0182008_100053386 205
196 3300015262 Ga0182007_10008958 Ga0182007_100089582 205
197 3300025910 Ga0207684_10104450 Ga0207684_101044502 205
198 3300025916 Ga0207663_10566887 Ga0207663_105668871 205
199 3300025922 Ga0207646_10157807 Ga0207646_101578072 205
200 3300025928 Ga0207700_10058419 Ga0207700_100584194 205
201 3300031247 Ga0265340_10021238 Ga0265340_100212382 205
202 3300031711 Ga0265314_10000920 Ga0265314_1000092013 205
203 3300031711 Ga0265314_10039715 Ga0265314_100397153 205
204 3300033545 Ga0316214_1005083 Ga0316214_10050832 205
205 3300005436 Ga0070713_100037216 Ga0070713_1000372163 206
206 3300005468 Ga0070707_100732654 Ga0070707_1007326542 206
207 3300005468 Ga0070707_100796980 Ga0070707_1007969801 206
208 3300005518 Ga0070699_100544943 Ga0070699_1005449432 206
209 3300006028 Ga0070717_10181795 Ga0070717_101817952 206
210 3300025922 Ga0207646_10196754 Ga0207646_101967542 206
211 3300025922 Ga0207646_10312812 Ga0207646_103128122 206
212 3300025928 Ga0207700_10129763 Ga0207700_101297633 206
213 3300032005 Ga0307411_10701055 Ga0307411_107010552 206
214 3300046472 Ga0495580_0011121 Ga0495580_0011121_5736_6359 206
215 2162886012 MBSR1b_contig_501321 MBSR1b_0468.00003480 207
216 3300001976 JGI24752J21851_1002003 JGI24752J21851_10020032 207
217 3300001990 JGI24737J22298_10037399 JGI24737J22298_100373992 207
218 3300001991 JGI24743J22301_10002414 JGI24743J22301_100024142 207
219 3300002239 JGI24034J26672_10007702 JGI24034J26672_100077022 207
220 3300002459 JGI24751J29686_10026544 JGI24751J29686_100265441 207
221 3300005290 Ga0065712_10112424 Ga0065712_101124242 207
222 3300005293 Ga0065715_10034969 Ga0065715_100349692 207
223 3300005327 Ga0070658_10030686 Ga0070658_100306862 207
224 3300005328 Ga0070676_10008364 Ga0070676_100083645 207
225 3300005329 Ga0070683_100003154 Ga0070683_1000031544 207
226 3300005331 Ga0070670_100042105 Ga0070670_1000421052 207
227 3300005333 Ga0070677_10001242 Ga0070677_100012424 207
228 3300005337 Ga0070682_100009609 Ga0070682_1000096094 207
229 3300005338 Ga0068868_100023863 Ga0068868_1000238632 207
230 3300005339 Ga0070660_100014762 Ga0070660_1000147622 207
231 3300005344 Ga0070661_100003185 Ga0070661_1000031852 207
232 3300005347 Ga0070668_100003135 Ga0070668_1000031357 207
233 3300005353 Ga0070669_100010156 Ga0070669_1000101566 207
234 3300005354 Ga0070675_100043638 Ga0070675_1000436381 207
235 3300005364 Ga0070673_100091999 Ga0070673_1000919992 207
236 3300005365 Ga0070688_100003495 Ga0070688_1000034956 207
237 3300005366 Ga0070659_100046043 Ga0070659_1000460433 207
238 3300005441 Ga0070700_100537207 Ga0070700_1005372072 207
239 3300005457 Ga0070662_100277006 Ga0070662_1002770062 207
240 3300005459 Ga0068867_100029578 Ga0068867_1000295784 207
241 3300005466 Ga0070685_10001409 Ga0070685_100014092 207
242 3300005535 Ga0070684_100003440 Ga0070684_1000034402 207
243 3300005539 Ga0068853_100065031 Ga0068853_1000650312 207
244 3300005543 Ga0070672_100003094 Ga0070672_1000030945 207
245 3300005563 Ga0068855_100066732 Ga0068855_1000667322 207
246 3300005564 Ga0070664_100047198 Ga0070664_1000471982 207
247 3300005577 Ga0068857_100001862 Ga0068857_10000186210 207
248 3300005578 Ga0068854_100253557 Ga0068854_1002535571 207
249 3300005615 Ga0070702_100001029 Ga0070702_1000010298 207
250 3300005616 Ga0068852_100003843 Ga0068852_1000038435 207
251 3300005617 Ga0068859_100053368 Ga0068859_1000533682 207
252 3300005618 Ga0068864_100048853 Ga0068864_1000488532 207
253 3300005842 Ga0068858_100005535 Ga0068858_1000055355 207
254 3300005843 Ga0068860_100610627 Ga0068860_1006106272 207
255 3300005844 Ga0068862_100124771 Ga0068862_1001247712 207
256 3300006237 Ga0097621_100205221 Ga0097621_1002052212 207
257 3300006881 Ga0068865_100020208 Ga0068865_1000202082 207
258 3300006931 Ga0097620_100053364 Ga0097620_1000533642 207
259 3300009092 Ga0105250_10017978 Ga0105250_100179782 207
260 3300009092 Ga0105250_10232561 Ga0105250_102325611 207
261 3300009098 Ga0105245_10003694 Ga0105245_100036941 207
262 3300009098 Ga0105245_10018803 Ga0105245_100188035 207
263 3300009101 Ga0105247_10025937 Ga0105247_100259373 207
264 3300009174 Ga0105241_10087385 Ga0105241_100873852 207
265 3300009177 Ga0105248_10146996 Ga0105248_101469963 207
266 3300009553 Ga0105249_10056661 Ga0105249_100566612 207
267 3300011119 Ga0105246_10008033 Ga0105246_100080336 207
268 3300013100 Ga0157373_10005319 Ga0157373_100053194 207
269 3300013102 Ga0157371_10024359 Ga0157371_100243594 207
270 3300013105 Ga0157369_10006236 Ga0157369_1000623614 207
271 3300013296 Ga0157374_10062823 Ga0157374_100628233 207
272 3300013306 Ga0163162_10465664 Ga0163162_104656642 207
273 3300013306 Ga0163162_10533405 Ga0163162_105334051 207
274 3300013307 Ga0157372_10040974 Ga0157372_100409745 207
275 3300014325 Ga0163163_10004144 Ga0163163_100041444 207
276 3300014325 Ga0163163_10320673 Ga0163163_103206732 207
277 3300014745 Ga0157377_10004637 Ga0157377_100046374 207
278 3300014969 Ga0157376_10077980 Ga0157376_100779802 207
279 3300017792 Ga0163161_10005306 Ga0163161_100053066 207
280 3300025893 Ga0207682_10002315 Ga0207682_100023154 207
281 3300025899 Ga0207642_10020278 Ga0207642_100202782 207
282 3300025901 Ga0207688_10019744 Ga0207688_100197442 207
283 3300025903 Ga0207680_10051753 Ga0207680_100517532 207
284 3300025904 Ga0207647_10006665 Ga0207647_100066655 207
285 3300025907 Ga0207645_10002059 Ga0207645_100020595 207
286 3300025908 Ga0207643_10002962 Ga0207643_100029625 207
287 3300025914 Ga0207671_10116356 Ga0207671_101163562 207
288 3300025919 Ga0207657_10002970 Ga0207657_1000297014 207
289 3300025920 Ga0207649_10000566 Ga0207649_1000056618 207
290 3300025925 Ga0207650_10000051 Ga0207650_10000051132 207
291 3300025926 Ga0207659_10014645 Ga0207659_100146452 207
292 3300025927 Ga0207687_10051257 Ga0207687_100512572 207
293 3300025931 Ga0207644_10009032 Ga0207644_100090322 207
294 3300025933 Ga0207706_10022854 Ga0207706_100228542 207
295 3300025936 Ga0207670_10025075 Ga0207670_100250752 207
296 3300025937 Ga0207669_10151727 Ga0207669_101517272 207
297 3300025938 Ga0207704_10009101 Ga0207704_100091015 207
298 3300025941 Ga0207711_10020175 Ga0207711_100201752 207
299 3300025942 Ga0207689_10000184 Ga0207689_1000018431 207
300 3300025944 Ga0207661_10003823 Ga0207661_100038237 207
301 3300025945 Ga0207679_10000101 Ga0207679_1000010122 207
302 3300025949 Ga0207667_10413749 Ga0207667_104137492 207
303 3300025960 Ga0207651_10036492 Ga0207651_100364921 207
304 3300025972 Ga0207668_10048796 Ga0207668_100487963 207
305 3300025986 Ga0207658_10004998 Ga0207658_100049986 207
306 3300026023 Ga0207677_10007786 Ga0207677_100077865 207
307 3300026023 Ga0207677_10053693 Ga0207677_100536932 207
308 3300026035 Ga0207703_10023924 Ga0207703_100239241 207
309 3300026041 Ga0207639_10072220 Ga0207639_100722201 207
310 3300026067 Ga0207678_10004418 Ga0207678_100044186 207
311 3300026088 Ga0207641_10000006 Ga0207641_10000006342 207
312 3300026088 Ga0207641_11287570 Ga0207641_112875701 207
313 3300026089 Ga0207648_10000664 Ga0207648_1000066414 207
314 3300026095 Ga0207676_10000155 Ga0207676_1000015558 207
315 3300026116 Ga0207674_10002842 Ga0207674_1000284213 207
316 3300026118 Ga0207675_100003987 Ga0207675_1000039875 207
317 3300026121 Ga0207683_10200743 Ga0207683_102007432 207
318 3300026142 Ga0207698_10846578 Ga0207698_108465782 207
319 3300028379 Ga0268266_10008965 Ga0268266_100089653 207
320 3300028380 Ga0268265_10012477 Ga0268265_100124774 207
321 3300028381 Ga0268264_10029796 Ga0268264_100297964 207
322 3300028800 Ga0265338_10008023 Ga0265338_100080232 207
323 3300031250 Ga0265331_10120107 Ga0265331_101201072 207
324 3300031344 Ga0265316_10009351 Ga0265316_100093518 207
325 3300044712 Ga0453684_0726894 Ga0453684_0726894_143_766 207
326 3300048905 Ga0496102_1088099 Ga0496102_1088099_47_670 207
327 3300048911 Ga0496108_0001035 Ga0496108_0001035_13882_14505 207
328 3300048912 Ga0496109_0000126 Ga0496109_0000126_36706_37329 207
329 3300048913 Ga0496110_0000429 Ga0496110_0000429_13955_14578 207
330 3300048914 Ga0496111_0000748 Ga0496111_0000748_9502_10125 207
331 3300048915 Ga0496112_0000615 Ga0496112_0000615_22351_22974 207
332 3300048916 Ga0496113_0000595 Ga0496113_0000595_2025_2648 207

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00694

Aconitase_C

Aconitase C-terminal domain

26

149

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5j4d-assembly1.cif.gz_M e. coli release factor 1 bound to the 70s ribosome in response to a pseudouridylated stop codon 0.9012 97 121
5t5h-assembly1.cif.gz_b structure and assembly model for the trypanosoma cruzi 60s ribosomal subunit 0.8288 97 122
6swa-assembly1.cif.gz_Y mus musculus brain neocortex ribosome 60s bound to ebp1 0.8154 97 122
3h5j-assembly1.cif.gz_A leud_1-168 small subunit of isopropylmalate isomerase (rv2987c) from mycobacterium tuberculosis 0.8149 1 174
8eui-assembly1.cif.gz_a ytm1 associated nascent 60s ribosome (-fkbp39) state 3 0.8109 97 122
ID Description Score Start End Superfamily
af_Q4E4Q8_58_145_3.100.10.10 Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2; 0.8162 97 122 3.100.10.10
3h5jA00 Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 0.8149 1 174 3.20.19.10
af_P0A0F8_66_146_3.100.10.10 Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2; 0.812 97 121 3.100.10.10
3h5jA00 Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 0.8103 1 174 3.20.19.10
af_O14289_535_712_3.20.19.10 Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 0.8055 1 177 3.20.19.10
ID Description Score Start End GO Terms
AF-J8RST4-F1-model_v4 deleted 0.9789 99 193
AF-W1Y1Y2-F1-model_v4 3-isopropylmalate dehydratase (EC 4.2.1.33) 0.9575 65 134 GO:0003861
GO:0009098
GO:0009316
AF-A0A661H4V0-F1-model_v4 3-isopropylmalate dehydratase (EC 4.2.1.33) 0.9559 85 192 GO:0003861
GO:0009098
GO:0009316
AF-A0A2E3QQN6-F1-model_v4 3-isopropylmalate dehydratase 0.9511 101 192 GO:0009098
GO:0016829
AF-A0A659SHW6-F1-model_v4 3-isopropylmalate dehydratase (EC 4.2.1.33) 0.9501 63 195 GO:0003861
GO:0009098
GO:0009316

Feature Viewer

pLDDT pTM Quality
85.72 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map