F410483

General Info

Members Datasets Scaffolds Average Seq Length
331 169 662 507

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_10000919|Ga0105248_100009196
Length 545
Sequence MQSTVHPLIRSQTSIRFANKTLHSHAFTHHRTQGIPMNAFRKKRAIALAITGLLFAGSAFASSHREALAVLNEPCADNTDTYAWVSPGAHDKLYLFMNFNPLHEPGQGNQGLRVCTGYRYEFHIAKGASLADRYVYRIEFKVTPPTDGAAGPNDPLGGGNELLWQLSGGTETYTVTRINVATGVATVLGKDLPVAPNDHGPQTDRLVNGLGAFKGYDSGDPTVREKDLYSDKFIADHFIHTLSNGGRAFSGERDDPYYLDEKGIFDLVNLCRAGVGGILGARRSACEDVFTGFNIFTIGLELPISDVFPKGIPHNGVITQNDKSTNSLLRIWDSISKQSLQVVDPNNVVTGYSSFGAWKQVGRNALPLFDAGVVGTMRQTSYLRSTPMTDVSKFGNDILYPVLVRDADALGIYKALGLSPTTVASLKGPRTDIVKTINLGRNIPIADGYSGDVLTIDASQDSHFPNGRRIDGGPAPNKENVDVSDVMISLIVAGDPAAGIGDGVNGNDKDYLTVFPFMAAPWSGLNGGHGGTNNIHPTATTSNPR

Samples

Sample ID Description Type Environment
1 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
91 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
129 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
130 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
131 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
134 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
135 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
136 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
137 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
138 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
139 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
140 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
141 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
142 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
143 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
144 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
145 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
146 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
147 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
148 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
149 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
150 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
151 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
152 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
153 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
154 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
155 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
156 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
157 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
158 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
159 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
160 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
161 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
162 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
163 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
164 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
165 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
166 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
167 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
168 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
169 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.6
Nodule 0
Rhizoplane 0.91
Rhizosphere 96.98
Stem 0
Stem Tuber 0
Unclassified 19.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105248_10000919 3300009177 Bacteria 32789
2 JGI25406J46586_10000547 3300003203 Bacteria 17634
3 Ga0065712_10007704 3300005290 Bacteria 5045
4 Ga0065707_10113423 3300005295 Bacteria 2328
5 Ga0070676_10036103 3300005328 Bacteria 2846
6 Ga0070683_100000099 3300005329 Bacteria 56845
7 Ga0070683_100017498 3300005329 Bacteria 6335
8 Ga0070690_100005153 3300005330 Bacteria 7318
9 Ga0070670_100000040 3300005331 Bacteria 149939
10 Ga0070670_100000802 3300005331 Bacteria 24446
11 Ga0070670_100007974 3300005331 Bacteria 9007
12 Ga0068869_100011061 3300005334 Bacteria 5910
13 Ga0068869_100055144 3300005334 Unclassified 2896
14 Ga0068869_100057969 3300005334 Bacteria 2829
15 Ga0070682_100000035 3300005337 Bacteria 150016
16 Ga0068868_100000528 3300005338 Bacteria 25598
17 Ga0068868_100001186 3300005338 Bacteria 17863
18 Ga0068868_100005391 3300005338 Bacteria 8985
19 Ga0070689_100000901 3300005340 Bacteria 18551
20 Ga0070689_100091699 3300005340 Bacteria 2396
21 Ga0070692_10007935 3300005345 Bacteria 4706
22 Ga0070669_100064245 3300005353 Bacteria 2703
23 Ga0070675_100000001 3300005354 Bacteria 448137
24 Ga0070675_100053754 3300005354 Bacteria 3313
25 Ga0070675_100086236 3300005354 Bacteria 2624
26 Ga0070675_100105461 3300005354 Bacteria 2378
27 Ga0070671_100055510 3300005355 Unclassified 3295
28 Ga0070674_100060864 3300005356 Bacteria 2633
29 Ga0070673_100023101 3300005364 Unclassified 4540
30 Ga0070673_100119328 3300005364 Bacteria 2197
31 Ga0070688_100110014 3300005365 Bacteria 1831
32 Ga0070667_100024811 3300005367 Bacteria 4982
33 Ga0070667_100034861 3300005367 Bacteria 4213
34 Ga0070701_10003066 3300005438 Bacteria 6548
35 Ga0070701_10014082 3300005438 Unclassified 3658
36 Ga0070700_100000519 3300005441 Bacteria 19238
37 Ga0070700_100036539 3300005441 Bacteria 2980
38 Ga0070694_100002164 3300005444 Bacteria 11642
39 Ga0070694_100003156 3300005444 Bacteria 9821
40 Ga0070708_100132345 3300005445 Bacteria 2309
41 Ga0070678_100073121 3300005456 Unclassified 2572
42 Ga0070662_100035778 3300005457 Unclassified 3509
43 Ga0070662_100047215 3300005457 Bacteria 3097
44 Ga0070706_100000049 3300005467 Bacteria 141287
45 Ga0070706_100046297 3300005467 Bacteria 4016
46 Ga0070707_100003684 3300005468 Bacteria 14453
47 Ga0070707_100088903 3300005468 Bacteria 2988
48 Ga0070707_100154481 3300005468 Bacteria 2235
49 Ga0070698_100008299 3300005471 Bacteria 11231
50 Ga0070698_100022994 3300005471 Bacteria 6518
51 Ga0070698_100135377 3300005471 Unclassified 2418
52 Ga0070699_100005512 3300005518 Bacteria 11090
53 Ga0070699_100022130 3300005518 Bacteria 5477
54 Ga0070699_100025915 3300005518 Bacteria 5055
55 Ga0070684_100000104 3300005535 Bacteria 54663
56 Ga0070684_100010581 3300005535 Bacteria 7314
57 Ga0070684_100078411 3300005535 Unclassified 2919
58 Ga0070697_100001380 3300005536 Bacteria 18380
59 Ga0070697_100017012 3300005536 Bacteria 5717
60 Ga0068853_100035278 3300005539 Bacteria 4247
61 Ga0070672_100000295 3300005543 Bacteria 28160
62 Ga0070672_100002699 3300005543 Bacteria 11341
63 Ga0070672_100050117 3300005543 Bacteria 3251
64 Ga0070672_100055408 3300005543 Bacteria 3106
65 Ga0070686_100022948 3300005544 Bacteria 3723
66 Ga0070695_100000509 3300005545 Bacteria 20390
67 Ga0070696_100016577 3300005546 Bacteria 4966
68 Ga0070704_100086813 3300005549 Unclassified 2320
69 Ga0068855_100091463 3300005563 Unclassified 3509
70 Ga0070664_100008222 3300005564 Bacteria 8437
71 Ga0068857_100000966 3300005577 Bacteria 21966
72 Ga0068854_100031429 3300005578 Unclassified 3689
73 Ga0068854_100136191 3300005578 Unclassified 1880
74 Ga0068856_100085963 3300005614 Unclassified 3125
75 Ga0068856_100154434 3300005614 Bacteria 2305
76 Ga0070702_100009247 3300005615 Bacteria 4816
77 Ga0070702_100067230 3300005615 Unclassified 2105
78 Ga0068852_100051709 3300005616 Unclassified 3528
79 Ga0068859_100000004 3300005617 Bacteria 470249
80 Ga0068859_100013009 3300005617 Bacteria 8360
81 Ga0068859_100056854 3300005617 Bacteria 3939
82 Ga0068859_100137603 3300005617 Unclassified 2516
83 Ga0068864_100000007 3300005618 Bacteria 392187
84 Ga0068866_10070622 3300005718 Unclassified 1844
85 Ga0068861_100023477 3300005719 Bacteria 4448
86 Ga0068863_100001533 3300005841 Bacteria 22834
87 Ga0068858_100000710 3300005842 Bacteria 34761
88 Ga0068858_100001139 3300005842 Bacteria 27509
89 Ga0068858_100221028 3300005842 Unclassified 1794
90 Ga0068860_100003536 3300005843 Bacteria 16076
91 Ga0068860_100009464 3300005843 Bacteria 9675
92 Ga0068860_100022604 3300005843 Bacteria 6080
93 Ga0068862_100000903 3300005844 Bacteria 28796
94 Ga0081455_10045364 3300005937 Unclassified 3825
95 Ga0081539_10000010 3300005985 Bacteria 484386
96 Ga0081539_10000237 3300005985 Bacteria 129370
97 Ga0081539_10004762 3300005985 Bacteria 14650
98 Ga0081539_10020040 3300005985 Bacteria 4546
99 Ga0070717_10000335 3300006028 Bacteria 30291
100 Ga0097621_100003952 3300006237 Bacteria 10267
101 Ga0097621_100036699 3300006237 Unclassified 3922
102 Ga0097621_100043065 3300006237 Unclassified 3639
103 Ga0068871_100001892 3300006358 Bacteria 14166
104 Ga0068871_100014616 3300006358 Bacteria 5856
105 Ga0068871_100094055 3300006358 Unclassified 2502
106 Ga0075428_100003085 3300006844 Bacteria 18177
107 Ga0075428_100039936 3300006844 Bacteria 5165
108 Ga0075428_100050343 3300006844 Bacteria 4569
109 Ga0075431_100004712 3300006847 Bacteria 13395
110 Ga0075431_100014135 3300006847 Bacteria 8070
111 Ga0075431_100210510 3300006847 Unclassified 1986
112 Ga0075433_10012524 3300006852 Bacteria 6857
113 Ga0075433_10037965 3300006852 Bacteria 4158
114 Ga0075433_10112555 3300006852 Unclassified 2414
115 Ga0075434_100128903 3300006871 Unclassified 2548
116 Ga0075434_100167518 3300006871 Bacteria 2217
117 Ga0075429_100008248 3300006880 Bacteria 9058
118 Ga0075436_100001068 3300006914 Bacteria 18420
119 Ga0097620_100000004 3300006931 Bacteria 470249
120 Ga0097620_100013009 3300006931 Bacteria 8360
121 Ga0097620_100056856 3300006931 Bacteria 3939
122 Ga0097620_100137595 3300006931 Unclassified 2516
123 Ga0075435_100000114 3300007076 Bacteria 44457
124 Ga0075435_100004057 3300007076 Bacteria 10017
125 Ga0075435_100022882 3300007076 Bacteria 4825
126 Ga0105244_10010608 3300009036 Bacteria 5572
127 Ga0111539_10000017 3300009094 Bacteria 275456
128 Ga0111539_10022002 3300009094 Bacteria 7837
129 Ga0111539_10030113 3300009094 Bacteria 6601
130 Ga0111539_10097250 3300009094 Unclassified 3458
131 Ga0111539_10098884 3300009094 Bacteria 3427
132 Ga0105245_10000634 3300009098 Bacteria 31983
133 Ga0105245_10000880 3300009098 Bacteria 27265
134 Ga0105245_10001694 3300009098 Bacteria 20055
135 Ga0105245_10007705 3300009098 Bacteria 9431
136 Ga0105245_10011578 3300009098 Bacteria 7685
137 Ga0105245_10077372 3300009098 Bacteria 3033
138 Ga0114129_10000372 3300009147 Bacteria 52177
139 Ga0114129_10007490 3300009147 Bacteria 15549
140 Ga0114129_10010949 3300009147 Bacteria 12920
141 Ga0114129_10018969 3300009147 Bacteria 9798
142 Ga0114129_10027169 3300009147 Bacteria 8101
143 Ga0114129_10027327 3300009147 Bacteria 8079
144 Ga0114129_10030292 3300009147 Bacteria 7659
145 Ga0114129_10033701 3300009147 Bacteria 7236
146 Ga0114129_10094822 3300009147 Bacteria 4133
147 Ga0114129_10146891 3300009147 Unclassified 3229
148 Ga0114129_10321489 3300009147 Unclassified 2057
149 Ga0114129_10427209 3300009147 Unclassified 1741
150 Ga0114129_10443622 3300009147 Unclassified 1703
151 Ga0105243_10044531 3300009148 Bacteria 3482
152 Ga0105241_10167648 3300009174 Unclassified 1811
153 Ga0105242_10006127 3300009176 Bacteria 9267
154 Ga0105242_10009293 3300009176 Bacteria 7548
155 Ga0105242_10082401 3300009176 Unclassified 2692
156 Ga0105248_10001018 3300009177 Bacteria 30990
157 Ga0105248_10004037 3300009177 Bacteria 16214
158 Ga0105248_10009183 3300009177 Bacteria 10876
159 Ga0105248_10019274 3300009177 Bacteria 7549
160 Ga0105248_10071487 3300009177 Bacteria 3898
161 Ga0105237_10015196 3300009545 Bacteria 8020
162 Ga0105238_10000001 3300009551 Bacteria 2036163
163 Ga0105238_10007611 3300009551 Bacteria 10852
164 Ga0105238_10041689 3300009551 Unclassified 4650
165 Ga0105249_10094532 3300009553 Bacteria 2801
166 Ga0105239_10006049 3300010375 Bacteria 14090
167 Ga0157369_10000215 3300013105 Bacteria 80181
168 Ga0157374_10000021 3300013296 Bacteria 272840
169 Ga0157374_10030146 3300013296 Unclassified 4922
170 Ga0157378_10000248 3300013297 Bacteria 52575
171 Ga0157378_10001802 3300013297 Bacteria 19242
172 Ga0157378_10003780 3300013297 Bacteria 13413
173 Ga0157378_10008826 3300013297 Bacteria 8773
174 Ga0157378_10033070 3300013297 Bacteria 4570
175 Ga0157378_10042458 3300013297 Bacteria 4036
176 Ga0157378_10053417 3300013297 Bacteria 3597
177 Ga0163162_10004485 3300013306 Bacteria 13449
178 Ga0157372_10036391 3300013307 Bacteria 5425
179 Ga0157372_10043616 3300013307 Unclassified 4966
180 Ga0157372_10189697 3300013307 Unclassified 2381
181 Ga0157375_10000007 3300013308 Bacteria 377743
182 Ga0157375_10000198 3300013308 Bacteria 56235
183 Ga0157375_10011704 3300013308 Bacteria 7754
184 Ga0157375_10020859 3300013308 Bacteria 5997
185 Ga0157375_10030628 3300013308 Bacteria 5076
186 Ga0157375_10065758 3300013308 Bacteria 3616
187 Ga0157375_10203528 3300013308 Unclassified 2136
188 Ga0157375_10268236 3300013308 Bacteria 1869
189 Ga0163163_10024618 3300014325 Bacteria 5730
190 Ga0163163_10033761 3300014325 Bacteria 4952
191 Ga0163163_10063844 3300014325 Bacteria 3653
192 Ga0157380_10037150 3300014326 Bacteria 3772
193 Ga0157380_10040251 3300014326 Unclassified 3639
194 Ga0157377_10000009 3300014745 Bacteria 385287
195 Ga0157377_10000090 3300014745 Bacteria 66429
196 Ga0157379_10069309 3300014968 Bacteria 3154
197 Ga0157376_10000024 3300014969 Bacteria 220018
198 Ga0163161_10138577 3300017792 Unclassified 1841
199 Ga0213876_10000014 3300021384 Bacteria 310412
200 Ga0207655_1021101 3300025728 Bacteria 3319
201 Ga0207645_10035470 3300025907 Bacteria 3203
202 Ga0207643_10031409 3300025908 Bacteria 2961
203 Ga0207684_10000011 3300025910 Bacteria 502991
204 Ga0207684_10000890 3300025910 Bacteria 33979
205 Ga0207654_10003872 3300025911 Bacteria 7542
206 Ga0207646_10026094 3300025922 Bacteria 5338
207 Ga0207646_10026920 3300025922 Bacteria 5243
208 Ga0207681_10056268 3300025923 Bacteria 2682
209 Ga0207694_10000001 3300025924 Bacteria 4078485
210 Ga0207694_10067686 3300025924 Unclassified 2788
211 Ga0207650_10000335 3300025925 Bacteria 45551
212 Ga0207650_10022879 3300025925 Bacteria 4428
213 Ga0207650_10070199 3300025925 Bacteria 2633
214 Ga0207659_10000004 3300025926 Bacteria 476977
215 Ga0207659_10039268 3300025926 Bacteria 3300
216 Ga0207687_10000003 3300025927 Bacteria 875159
217 Ga0207687_10000387 3300025927 Bacteria 29766
218 Ga0207687_10001506 3300025927 Bacteria 15959
219 Ga0207687_10004405 3300025927 Bacteria 9395
220 Ga0207687_10053241 3300025927 Bacteria 2826
221 Ga0207644_10036858 3300025931 Bacteria 3436
222 Ga0207706_10060826 3300025933 Bacteria 3326
223 Ga0207686_10005155 3300025934 Bacteria 7026
224 Ga0207670_10004231 3300025936 Bacteria 7701
225 Ga0207704_10049037 3300025938 Bacteria 2537
226 Ga0207691_10002758 3300025940 Bacteria 17123
227 Ga0207691_10023415 3300025940 Bacteria 5813
228 Ga0207691_10024555 3300025940 Bacteria 5669
229 Ga0207691_10048555 3300025940 Bacteria 3891
230 Ga0207711_10004091 3300025941 Bacteria 12505
231 Ga0207711_10005760 3300025941 Bacteria 10462
232 Ga0207689_10026100 3300025942 Bacteria 4891
233 Ga0207689_10065529 3300025942 Bacteria 2987
234 Ga0207689_10070512 3300025942 Bacteria 2871
235 Ga0207661_10000001 3300025944 Bacteria 937688
236 Ga0207661_10050960 3300025944 Unclassified 3301
237 Ga0207651_10107955 3300025960 Bacteria 2082
238 Ga0207668_10052869 3300025972 Bacteria 2812
239 Ga0207640_10003558 3300025981 Bacteria 8402
240 Ga0207640_10011262 3300025981 Bacteria 5060
241 Ga0207677_10000001 3300026023 Bacteria 534789
242 Ga0207677_10000315 3300026023 Bacteria 35425
243 Ga0207677_10066579 3300026023 Bacteria 2519
244 Ga0207703_10000249 3300026035 Bacteria 60645
245 Ga0207703_10009029 3300026035 Bacteria 7851
246 Ga0207703_10016020 3300026035 Bacteria 5846
247 Ga0207639_10000214 3300026041 Bacteria 43190
248 Ga0207639_10026236 3300026041 Bacteria 4233
249 Ga0207708_10000059 3300026075 Bacteria 94590
250 Ga0207708_10008131 3300026075 Bacteria 7768
251 Ga0207708_10026057 3300026075 Bacteria 4424
252 Ga0207708_10031933 3300026075 Bacteria 3999
253 Ga0207702_10142068 3300026078 Unclassified 2174
254 Ga0207702_10180358 3300026078 Unclassified 1944
255 Ga0207641_10016597 3300026088 Bacteria 6028
256 Ga0207641_10028970 3300026088 Bacteria 4578
257 Ga0207648_10159472 3300026089 Bacteria 1992
258 Ga0207676_10000015 3300026095 Bacteria 329100
259 Ga0207674_10048155 3300026116 Bacteria 4364
260 Ga0207675_100103105 3300026118 Unclassified 2688
261 Ga0207683_10059070 3300026121 Bacteria 3368
262 Ga0207428_10000010 3300027907 Bacteria 397329
263 Ga0207428_10062458 3300027907 Bacteria 2945
264 Ga0268265_10001616 3300028380 Bacteria 18588
265 Ga0268265_10052280 3300028380 Bacteria 3088
266 Ga0268265_10091754 3300028380 Bacteria 2430
267 Ga0268265_10155632 3300028380 Unclassified 1934
268 Ga0268264_10002564 3300028381 Bacteria 15930
269 Ga0268264_10002687 3300028381 Bacteria 15530
270 Ga0265338_10169830 3300028800 Bacteria 1674
271 Ga0307511_10009012 3300030521 Bacteria 9957
272 Ga0265332_10004406 3300031238 Bacteria 6616
273 Ga0307516_10101036 3300031730 Bacteria 2700
274 Ga0307416_100130255 3300032002 Unclassified 2263
275 Ga0373937_0034321 3300036401 Unclassified 4615
276 Ga0436365_0077460 3300039437 Bacteria 1892
277 Ga0436365_0236662 3300039437 Bacteria 205513
278 Ga0436362_0513989 3300039453 Unclassified 1966
279 Ga0453683_0009087 3300044673 Bacteria 6636
280 Ga0453683_0034761 3300044673 Bacteria 3177
281 Ga0453683_0099764 3300044673 Unclassified 1823
282 Ga0495592_0075940 3300046454 Bacteria 2439
283 Ga0495590_0009680 3300046457 Bacteria 3655
284 Ga0495580_0030431 3300046472 Unclassified 3909
285 Ga0495664_0073728 3300046477 Bacteria 2041
286 Ga0495608_0039695 3300046511 Bacteria 3155
287 Ga0495618_0062979 3300046514 Bacteria 2354
288 Ga0495620_0007450 3300046515 Bacteria 5937
289 Ga0495628_0002377 3300046516 Bacteria 16990
290 Ga0495640_0026376 3300046533 Unclassified 4200
291 Ga0495587_0027530 3300046536 Unclassified 3461
292 Ga0495667_0014080 3300046559 Bacteria 5397
293 Ga0495634_0026994 3300046642 Unclassified 4001
294 Ga0495635_0019698 3300046663 Unclassified 4699
295 Ga0495613_0012465 3300046689 Bacteria 6317
296 Ga0495636_0028058 3300047318 Unclassified 2293
297 Ga0495674_0037960 3300047319 Unclassified 4327
298 Ga0495684_0022837 3300047471 Unclassified 4811
299 Ga0495684_0050983 3300047471 Unclassified 3159
300 Ga0496108_0104804 3300048911 Bacteria 2414
301 Ga0496110_0052104 3300048913 Bacteria 3597
302 Ga0496112_0039879 3300048915 Unclassified 4590
303 Ga0501073_0004414 3300049589 Bacteria 10572
304 Ga0501080_0007877 3300049742 Bacteria 9643
305 nmdc:mga05p37_118235_c1 3300050507 Bacteria 3257
306 nmdc:mga05p37_1869_c1 3300050507 Bacteria 24520
307 nmdc:mga05p37_199289_c1 3300050507 Unclassified 2426
308 nmdc:mga05p37_21802_c1 3300050507 Bacteria 7760
309 nmdc:mga05p37_28527_c1 3300050507 Bacteria 6806
310 nmdc:mga05p37_342242_c1 3300050507 Bacteria 1763
311 nmdc:mga05p37_591_c1 3300050507 Bacteria 39971
312 nmdc:mga05p37_60357_c1 3300050507 Bacteria 4670
313 nmdc:mga05p37_8156_c1 3300050507 Bacteria 11741
314 nmdc:mga06r32_122306_c1 3300050510 Unclassified 2568
315 nmdc:mga06r32_6737_c1 3300050510 Bacteria 10323
316 nmdc:mga06r32_802_c1 3300050510 Bacteria 27860
317 nmdc:mga06r32_84354_c1 3300050510 Bacteria 3096
318 nmdc:mga08y16_15_c1 3300050511 Bacteria 397324
319 nmdc:mga08y16_24568_c1 3300050511 Bacteria 6358
320 nmdc:mga0n895_96770_c1 3300050512 Unclassified 2957
321 nmdc:mga0rr50_117_c1 3300050513 Bacteria 43647
322 nmdc:mga0rr50_18178_c1 3300050513 Unclassified 3744
323 nmdc:mga0rr50_18188_c1 3300050513 Bacteria 4715
324 nmdc:mga0a205_23694_c1 3300050515 Bacteria 5823
325 nmdc:mga0a205_77764_c1 3300050515 Unclassified 3206
326 nmdc:mga0a205_98995_c1 3300050515 Bacteria 2814
327 Ga0495655_0000061 3300053083 Bacteria 21970
328 Ga0495619_0117731 3300053085 Unclassified 1820
329 Ga0500592_003093 3300053116 Bacteria 2659
330 Ga0500568_0007600 3300053139 Bacteria 5302
331 Ga0501082_0002734 3300060353 Bacteria 15412
332 Ga0105248_10000919
333 JGI25406J46586_10000547
334 Ga0065712_10007704
335 Ga0065707_10113423
336 Ga0070676_10036103
337 Ga0070683_100000099
338 Ga0070683_100017498
339 Ga0070690_100005153
340 Ga0070670_100000040
341 Ga0070670_100000802
342 Ga0070670_100007974
343 Ga0068869_100011061
344 Ga0068869_100055144
345 Ga0068869_100057969
346 Ga0070682_100000035
347 Ga0068868_100000528
348 Ga0068868_100001186
349 Ga0068868_100005391
350 Ga0070689_100000901
351 Ga0070689_100091699
352 Ga0070692_10007935
353 Ga0070669_100064245
354 Ga0070675_100000001
355 Ga0070675_100053754
356 Ga0070675_100086236
357 Ga0070675_100105461
358 Ga0070671_100055510
359 Ga0070674_100060864
360 Ga0070673_100023101
361 Ga0070673_100119328
362 Ga0070688_100110014
363 Ga0070667_100024811
364 Ga0070667_100034861
365 Ga0070701_10003066
366 Ga0070701_10014082
367 Ga0070700_100000519
368 Ga0070700_100036539
369 Ga0070694_100002164
370 Ga0070694_100003156
371 Ga0070708_100132345
372 Ga0070678_100073121
373 Ga0070662_100035778
374 Ga0070662_100047215
375 Ga0070706_100000049
376 Ga0070706_100046297
377 Ga0070707_100003684
378 Ga0070707_100088903
379 Ga0070707_100154481
380 Ga0070698_100008299
381 Ga0070698_100022994
382 Ga0070698_100135377
383 Ga0070699_100005512
384 Ga0070699_100022130
385 Ga0070699_100025915
386 Ga0070684_100000104
387 Ga0070684_100010581
388 Ga0070684_100078411
389 Ga0070697_100001380
390 Ga0070697_100017012
391 Ga0068853_100035278
392 Ga0070672_100000295
393 Ga0070672_100002699
394 Ga0070672_100050117
395 Ga0070672_100055408
396 Ga0070686_100022948
397 Ga0070695_100000509
398 Ga0070696_100016577
399 Ga0070704_100086813
400 Ga0068855_100091463
401 Ga0070664_100008222
402 Ga0068857_100000966
403 Ga0068854_100031429
404 Ga0068854_100136191
405 Ga0068856_100085963
406 Ga0068856_100154434
407 Ga0070702_100009247
408 Ga0070702_100067230
409 Ga0068852_100051709
410 Ga0068859_100000004
411 Ga0068859_100013009
412 Ga0068859_100056854
413 Ga0068859_100137603
414 Ga0068864_100000007
415 Ga0068866_10070622
416 Ga0068861_100023477
417 Ga0068863_100001533
418 Ga0068858_100000710
419 Ga0068858_100001139
420 Ga0068858_100221028
421 Ga0068860_100003536
422 Ga0068860_100009464
423 Ga0068860_100022604
424 Ga0068862_100000903
425 Ga0081455_10045364
426 Ga0081539_10000010
427 Ga0081539_10000237
428 Ga0081539_10004762
429 Ga0081539_10020040
430 Ga0070717_10000335
431 Ga0097621_100003952
432 Ga0097621_100036699
433 Ga0097621_100043065
434 Ga0068871_100001892
435 Ga0068871_100014616
436 Ga0068871_100094055
437 Ga0075428_100003085
438 Ga0075428_100039936
439 Ga0075428_100050343
440 Ga0075431_100004712
441 Ga0075431_100014135
442 Ga0075431_100210510
443 Ga0075433_10012524
444 Ga0075433_10037965
445 Ga0075433_10112555
446 Ga0075434_100128903
447 Ga0075434_100167518
448 Ga0075429_100008248
449 Ga0075436_100001068
450 Ga0097620_100000004
451 Ga0097620_100013009
452 Ga0097620_100056856
453 Ga0097620_100137595
454 Ga0075435_100000114
455 Ga0075435_100004057
456 Ga0075435_100022882
457 Ga0105244_10010608
458 Ga0111539_10000017
459 Ga0111539_10022002
460 Ga0111539_10030113
461 Ga0111539_10097250
462 Ga0111539_10098884
463 Ga0105245_10000634
464 Ga0105245_10000880
465 Ga0105245_10001694
466 Ga0105245_10007705
467 Ga0105245_10011578
468 Ga0105245_10077372
469 Ga0114129_10000372
470 Ga0114129_10007490
471 Ga0114129_10010949
472 Ga0114129_10018969
473 Ga0114129_10027169
474 Ga0114129_10027327
475 Ga0114129_10030292
476 Ga0114129_10033701
477 Ga0114129_10094822
478 Ga0114129_10146891
479 Ga0114129_10321489
480 Ga0114129_10427209
481 Ga0114129_10443622
482 Ga0105243_10044531
483 Ga0105241_10167648
484 Ga0105242_10006127
485 Ga0105242_10009293
486 Ga0105242_10082401
487 Ga0105248_10001018
488 Ga0105248_10004037
489 Ga0105248_10009183
490 Ga0105248_10019274
491 Ga0105248_10071487
492 Ga0105237_10015196
493 Ga0105238_10000001
494 Ga0105238_10007611
495 Ga0105238_10041689
496 Ga0105249_10094532
497 Ga0105239_10006049
498 Ga0157369_10000215
499 Ga0157374_10000021
500 Ga0157374_10030146
501 Ga0157378_10000248
502 Ga0157378_10001802
503 Ga0157378_10003780
504 Ga0157378_10008826
505 Ga0157378_10033070
506 Ga0157378_10042458
507 Ga0157378_10053417
508 Ga0163162_10004485
509 Ga0157372_10036391
510 Ga0157372_10043616
511 Ga0157372_10189697
512 Ga0157375_10000007
513 Ga0157375_10000198
514 Ga0157375_10011704
515 Ga0157375_10020859
516 Ga0157375_10030628
517 Ga0157375_10065758
518 Ga0157375_10203528
519 Ga0157375_10268236
520 Ga0163163_10024618
521 Ga0163163_10033761
522 Ga0163163_10063844
523 Ga0157380_10037150
524 Ga0157380_10040251
525 Ga0157377_10000009
526 Ga0157377_10000090
527 Ga0157379_10069309
528 Ga0157376_10000024
529 Ga0163161_10138577
530 Ga0213876_10000014
531 Ga0207655_1021101
532 Ga0207645_10035470
533 Ga0207643_10031409
534 Ga0207684_10000011
535 Ga0207684_10000890
536 Ga0207654_10003872
537 Ga0207646_10026094
538 Ga0207646_10026920
539 Ga0207681_10056268
540 Ga0207694_10000001
541 Ga0207694_10067686
542 Ga0207650_10000335
543 Ga0207650_10022879
544 Ga0207650_10070199
545 Ga0207659_10000004
546 Ga0207659_10039268
547 Ga0207687_10000003
548 Ga0207687_10000387
549 Ga0207687_10001506
550 Ga0207687_10004405
551 Ga0207687_10053241
552 Ga0207644_10036858
553 Ga0207706_10060826
554 Ga0207686_10005155
555 Ga0207670_10004231
556 Ga0207704_10049037
557 Ga0207691_10002758
558 Ga0207691_10023415
559 Ga0207691_10024555
560 Ga0207691_10048555
561 Ga0207711_10004091
562 Ga0207711_10005760
563 Ga0207689_10026100
564 Ga0207689_10065529
565 Ga0207689_10070512
566 Ga0207661_10000001
567 Ga0207661_10050960
568 Ga0207651_10107955
569 Ga0207668_10052869
570 Ga0207640_10003558
571 Ga0207640_10011262
572 Ga0207677_10000001
573 Ga0207677_10000315
574 Ga0207677_10066579
575 Ga0207703_10000249
576 Ga0207703_10009029
577 Ga0207703_10016020
578 Ga0207639_10000214
579 Ga0207639_10026236
580 Ga0207708_10000059
581 Ga0207708_10008131
582 Ga0207708_10026057
583 Ga0207708_10031933
584 Ga0207702_10142068
585 Ga0207702_10180358
586 Ga0207641_10016597
587 Ga0207641_10028970
588 Ga0207648_10159472
589 Ga0207676_10000015
590 Ga0207674_10048155
591 Ga0207675_100103105
592 Ga0207683_10059070
593 Ga0207428_10000010
594 Ga0207428_10062458
595 Ga0268265_10001616
596 Ga0268265_10052280
597 Ga0268265_10091754
598 Ga0268265_10155632
599 Ga0268264_10002564
600 Ga0268264_10002687
601 Ga0265338_10169830
602 Ga0307511_10009012
603 Ga0265332_10004406
604 Ga0307516_10101036
605 Ga0307416_100130255
606 Ga0373937_0034321
607 Ga0436365_0077460
608 Ga0436365_0236662
609 Ga0436362_0513989
610 Ga0453683_0009087
611 Ga0453683_0034761
612 Ga0453683_0099764
613 Ga0495592_0075940
614 Ga0495590_0009680
615 Ga0495580_0030431
616 Ga0495664_0073728
617 Ga0495608_0039695
618 Ga0495618_0062979
619 Ga0495620_0007450
620 Ga0495628_0002377
621 Ga0495640_0026376
622 Ga0495587_0027530
623 Ga0495667_0014080
624 Ga0495634_0026994
625 Ga0495635_0019698
626 Ga0495613_0012465
627 Ga0495636_0028058
628 Ga0495674_0037960
629 Ga0495684_0022837
630 Ga0495684_0050983
631 Ga0496108_0104804
632 Ga0496110_0052104
633 Ga0496112_0039879
634 Ga0501073_0004414
635 Ga0501080_0007877
636 nmdc:mga05p37_118235_c1
637 nmdc:mga05p37_1869_c1
638 nmdc:mga05p37_199289_c1
639 nmdc:mga05p37_21802_c1
640 nmdc:mga05p37_28527_c1
641 nmdc:mga05p37_342242_c1
642 nmdc:mga05p37_591_c1
643 nmdc:mga05p37_60357_c1
644 nmdc:mga05p37_8156_c1
645 nmdc:mga06r32_122306_c1
646 nmdc:mga06r32_6737_c1
647 nmdc:mga06r32_802_c1
648 nmdc:mga06r32_84354_c1
649 nmdc:mga08y16_15_c1
650 nmdc:mga08y16_24568_c1
651 nmdc:mga0n895_96770_c1
652 nmdc:mga0rr50_117_c1
653 nmdc:mga0rr50_18178_c1
654 nmdc:mga0rr50_18188_c1
655 nmdc:mga0a205_23694_c1
656 nmdc:mga0a205_77764_c1
657 nmdc:mga0a205_98995_c1
658 Ga0495655_0000061
659 Ga0495619_0117731
660 Ga0500592_003093
661 Ga0500568_0007600
662 Ga0501082_0002734

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14224

DUF4331

Domain of unknown function (DUF4331)

62

521

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
4aez-assembly2.cif.gz_E crystal structure of mitotic checkpoint complex 0.6901 81 103
7zau-assembly2.cif.gz_D fascin-1 in complex with nb 3e11 0.5724 41 97
5g5r-assembly1.cif.gz_B cbs domain tandem of site-2 protease from archaeoglobus fulgidus in complex with llama nanobody - apo form 0.5241 41 97
4fvs-assembly5.cif.gz_E crystal structure of a putative lipoprotein (bdi_3050) from parabacteroides distasonis atcc 8503 at 2.70 a resolution 0.5206 77 151
3k3q-assembly1.cif.gz_A crystal structure of a llama antibody complexed with the c. botulinum neurotoxin serotype a catalytic domain 0.4656 41 97
ID Description Score Start End Superfamily
4aezE00 Alpha Beta;2-Layer Sandwich;Cell Cycle, Spindle Assembly Checkpoint Protein; Chain A;HORMA domain 0.6901 81 103 3.30.900.10
af_A0A0R4IW73_144_233_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.5541 38 86 2.60.40.10
af_D3ZDI9_19_167_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.5067 94 153 3.30.40.10
af_A0A0R0GZA3_1_182_2.60.40.1170 Mainly Beta;Sandwich;Immunoglobulin-like;Mu homology domain, subdomain B 0.4668 25 86 2.60.40.1170
af_B2RYI0_394_554_2.40.128.630 Mainly Beta;Beta Barrel;Lipocalin; 0.4658 86 149 2.40.128.630
ID Description Score Start End GO Terms
AF-A0A2V8IZ09-F1-model_v4 DUF4198 domain-containing protein 0.9105 60 495
AF-A0A2V8BD20-F1-model_v4 DUF4331 domain-containing protein 0.895 160 503
AF-A0A7X2PQN9-F1-model_v4 DUF4331 domain-containing protein 0.8906 242 503
AF-A0A536X4Z5-F1-model_v4 DUF4331 domain-containing protein 0.8891 14 503
AF-A0A7X2PQN9-F1-model_v4 DUF4331 domain-containing protein 0.8779 242 503

Map