F410280

General Info

Members Datasets Scaffolds Average Seq Length
330 97 660 166

Family's Representative Sequence

Representative Sequence 3300049587|Ga0501071_1452997|Ga0501071_1452997_32_511
Length 159
Sequence VTWKIPNALALVGSRAGEEWNAMTTSWITQLSMEPVLIGVGVDNRAVTHRLISSGGSFTVNLWSADNSRVFVKFSKPAVLATDGGVTTLNGLVVQPAPSGAPVFADAIAWFDCEVRQSIDFGTHTLFAGEITAAAIVDDDARAAAMSDTRMKYGGVKRH

Samples

Sample ID Description Type Environment
1 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
4 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
5 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
6 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
7 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
8 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
9 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
10 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
11 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
12 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
13 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
14 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
15 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
16 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
17 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
18 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
19 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
20 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
21 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
22 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
32 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
34 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
35 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
36 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
37 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
38 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
39 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
40 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
41 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
42 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
43 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
44 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
45 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
46 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
47 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
48 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
49 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
50 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
51 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
52 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
53 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
54 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
55 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
56 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
57 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
58 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
59 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
60 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
61 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
62 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
63 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
64 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
65 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
66 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
67 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
68 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
69 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
70 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
71 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
72 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
73 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
74 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
75 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
76 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
77 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
78 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
79 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
80 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
81 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
82 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
83 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
84 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
85 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
86 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
87 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
88 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
89 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
90 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
91 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
92 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
93 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
94 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
95 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
96 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
97 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.45
Nodule 0
Rhizoplane 2.12
Rhizosphere 91.52
Stem 0
Stem Tuber 0
Unclassified 5.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501071_1452997 3300049587 Bacteria 529
2 Ga0070670_100096285 3300005331 Bacteria 2546
3 Ga0070675_101214364 3300005354 Bacteria 694
4 Ga0070671_100010580 3300005355 Bacteria 7408
5 Ga0070671_100578494 3300005355 Bacteria 970
6 Ga0070672_100635436 3300005543 Unclassified 932
7 Ga0068859_100255792 3300005617 Bacteria 1842
8 Ga0068858_100018985 3300005842 Bacteria 6434
9 Ga0068860_100656327 3300005843 Bacteria 1057
10 Ga0075365_10118847 3300006038 Bacteria 1822
11 Ga0075365_10164400 3300006038 Bacteria 1548
12 Ga0075365_10278266 3300006038 Bacteria 1177
13 Ga0075368_10060217 3300006042 Bacteria 1520
14 Ga0075364_10011253 3300006051 Bacteria 5432
15 Ga0075367_10046914 3300006178 Bacteria 2540
16 Ga0075367_10091230 3300006178 Bacteria 1853
17 Ga0075366_10579621 3300006195 Unclassified 695
18 Ga0097620_100255787 3300006931 Bacteria 1842
19 Ga0097620_101137916 3300006931 Bacteria 859
20 Ga0105243_10153044 3300009148 Bacteria 1981
21 Ga0105249_11118708 3300009553 Bacteria 858
22 Ga0163162_11641505 3300013306 Bacteria 734
23 Ga0163163_10184282 3300014325 Bacteria 2135
24 Ga0163163_11536430 3300014325 Bacteria 727
25 Ga0157380_10110129 3300014326 Bacteria 2312
26 Ga0157380_10357695 3300014326 Bacteria 1369
27 Ga0157380_10916225 3300014326 Bacteria 904
28 Ga0157379_10541904 3300014968 Bacteria 1082
29 Ga0157376_10910532 3300014969 Bacteria 898
30 Ga0207681_10185236 3300025923 Bacteria 1589
31 Ga0207650_10247593 3300025925 Bacteria 1442
32 Ga0207650_10287100 3300025925 Bacteria 1341
33 Ga0207659_10711909 3300025926 Bacteria 860
34 Ga0207644_10055152 3300025931 Bacteria 2864
35 Ga0207644_10451561 3300025931 Unclassified 1056
36 Ga0207644_10531949 3300025931 Bacteria 972
37 Ga0207644_11102616 3300025931 Bacteria 667
38 Ga0207691_10393662 3300025940 Bacteria 1182
39 Ga0207661_10426147 3300025944 Bacteria 1206
40 Ga0207712_10292536 3300025961 Bacteria 1333
41 Ga0207668_10247514 3300025972 Bacteria 1446
42 Ga0207675_100075581 3300026118 Bacteria 3153
43 Ga0209813_10200671 3300027866 Unclassified 738
44 Ga0268264_10540285 3300028381 Bacteria 1142
45 Ga0316579_10070209 3300031691 Bacteria 1659
46 Ga0316576_10010548 3300031727 Bacteria 6009
47 Ga0316576_10023826 3300031727 Bacteria 4269
48 Ga0316576_10077940 3300031727 Bacteria 2455
49 Ga0316576_10101000 3300031727 Bacteria 2156
50 Ga0316576_10429525 3300031727 Bacteria 977
51 Ga0316576_10726251 3300031727 Bacteria 718
52 Ga0316578_10010930 3300031728 Bacteria 4730
53 Ga0316578_10064872 3300031728 Bacteria 2156
54 Ga0316578_10125146 3300031728 Bacteria 1546
55 Ga0316578_10306939 3300031728 Bacteria 948
56 Ga0316577_10585743 3300031733 Bacteria 634
57 Ga0307415_101394758 3300032126 Bacteria 667
58 Ga0316580_10012434 3300032139 Bacteria 2594
59 Ga0316574_0021754 3300035398 Bacteria 3812
60 Ga0316574_0072270 3300035398 Bacteria 2180
61 Ga0316574_0074818 3300035398 Bacteria 2144
62 Ga0316574_0087245 3300035398 Bacteria 1986
63 Ga0316574_0166399 3300035398 Bacteria 1420
64 Ga0316574_0230014 3300035398 Unclassified 1187
65 Ga0316574_0288758 3300035398 Bacteria 1044
66 Ga0316574_0464626 3300035398 Archaea 792
67 Ga0316582_0014069 3300036647 Bacteria 4530
68 Ga0316582_0125031 3300036647 Bacteria 1724
69 Ga0316582_0403490 3300036647 Unclassified 942
70 Ga0316584_0596171 3300036712 Unclassified 767
71 Ga0316584_0710103 3300036712 Bacteria 689
72 Ga0316584_0734957 3300036712 Bacteria 674
73 Ga0395905_0499336 3300037471 Bacteria 1117
74 Ga0400483_064737 3300039062 Bacteria 2591
75 Ga0400483_251783 3300039062 Unclassified 1723
76 Ga0439465_0415832 3300041413 Bacteria 513
77 Ga0451837_0530891 3300041494 Bacteria 3131
78 Ga0439445_0151201 3300042004 Bacteria 676
79 Ga0450907_018459 3300042146 Bacteria 1167
80 Ga0439446_0219182 3300042156 Bacteria 648
81 Ga0439434_0019588 3300042435 Bacteria 2029
82 Ga0466967_0396002 3300045976 Bacteria 1343
83 Ga0466967_0501548 3300045976 Bacteria 1191
84 Ga0496100_0444051 3300048903 Bacteria 994
85 Ga0496101_0409343 3300048904 Unclassified 1069
86 Ga0496105_0643672 3300048908 Bacteria 819
87 Ga0496110_0160358 3300048913 Bacteria 2039
88 Ga0496111_0547038 3300048914 Bacteria 850
89 Ga0496114_0144741 3300048917 Bacteria 2060
90 Ga0496114_0378207 3300048917 Bacteria 1254
91 Ga0501031_0001457 3300049568 Bacteria 14691
92 Ga0501031_0007330 3300049568 Bacteria 7195
93 Ga0501031_0038039 3300049568 Bacteria 3140
94 Ga0501032_0065995 3300049569 Bacteria 2419
95 Ga0501032_0177496 3300049569 Bacteria 1395
96 Ga0501033_0130671 3300049570 Bacteria 1819
97 Ga0501033_0203107 3300049570 Bacteria 1415
98 Ga0501033_0862790 3300049570 Unclassified 610
99 Ga0501034_0000034 3300049571 Bacteria 242608
100 Ga0501034_0045334 3300049571 Bacteria 4443
101 Ga0501034_0523997 3300049571 Bacteria 1097
102 Ga0501034_0638967 3300049571 Bacteria 967
103 Ga0501036_0007037 3300049572 Bacteria 9153
104 Ga0501036_0008618 3300049572 Bacteria 8368
105 Ga0501036_0026015 3300049572 Bacteria 4938
106 Ga0501036_0070137 3300049572 Bacteria 2963
107 Ga0501037_0015025 3300049573 Bacteria 5694
108 Ga0501037_0036061 3300049573 Bacteria 3646
109 Ga0501037_0211388 3300049573 Bacteria 1368
110 Ga0501037_0252584 3300049573 Bacteria 1234
111 Ga0501037_0428019 3300049573 Bacteria 905
112 Ga0501037_0784854 3300049573 Bacteria 630
113 Ga0501038_0000682 3300049574 Bacteria 30246
114 Ga0501038_0003318 3300049574 Bacteria 15016
115 Ga0501038_0024111 3300049574 Bacteria 5431
116 Ga0501038_0028769 3300049574 Bacteria 4934
117 Ga0501038_0157830 3300049574 Bacteria 1846
118 Ga0501039_0014846 3300049575 Bacteria 5955
119 Ga0501039_0080782 3300049575 Bacteria 2530
120 Ga0501039_0126655 3300049575 Bacteria 2003
121 Ga0501039_0162083 3300049575 Bacteria 1758
122 Ga0501039_0167513 3300049575 Bacteria 1727
123 Ga0501039_0178175 3300049575 Unclassified 1672
124 Ga0501039_0182142 3300049575 Bacteria 1652
125 Ga0501039_0205648 3300049575 Bacteria 1548
126 Ga0501040_0001139 3300049576 Bacteria 16873
127 Ga0501040_0006863 3300049576 Bacteria 7378
128 Ga0501040_0051315 3300049576 Bacteria 2821
129 Ga0501040_0063844 3300049576 Bacteria 2534
130 Ga0501040_0084440 3300049576 Bacteria 2203
131 Ga0501040_0123019 3300049576 Bacteria 1821
132 Ga0501040_0125999 3300049576 Bacteria 1799
133 Ga0501040_0165206 3300049576 Bacteria 1566
134 Ga0501040_0208656 3300049576 Bacteria 1388
135 Ga0501041_0001557 3300049577 Bacteria 12762
136 Ga0501041_0010460 3300049577 Bacteria 5467
137 Ga0501041_0013594 3300049577 Bacteria 4827
138 Ga0501041_0051004 3300049577 Bacteria 2521
139 Ga0501041_0068948 3300049577 Bacteria 2168
140 Ga0501041_0110281 3300049577 Bacteria 1707
141 Ga0501041_0155651 3300049577 Bacteria 1428
142 Ga0501041_0194667 3300049577 Unclassified 1270
143 Ga0501042_0000635 3300049578 Bacteria 18768
144 Ga0501042_0006206 3300049578 Bacteria 7756
145 Ga0501042_0037058 3300049578 Bacteria 3460
146 Ga0501042_0114762 3300049578 Bacteria 1939
147 Ga0501042_0443766 3300049578 Bacteria 941
148 Ga0501043_0006169 3300049579 Bacteria 9627
149 Ga0501043_0013125 3300049579 Bacteria 6478
150 Ga0501043_0604584 3300049579 Unclassified 810
151 Ga0501046_0000365 3300049580 Bacteria 45681
152 Ga0501046_0002786 3300049580 Bacteria 16268
153 Ga0501046_0005602 3300049580 Bacteria 11209
154 Ga0501046_0006708 3300049580 Bacteria 10165
155 Ga0501047_0329578 3300049581 Bacteria 1365
156 Ga0501047_0428429 3300049581 Bacteria 1154
157 Ga0501047_0664629 3300049581 Bacteria 861
158 Ga0501048_0004670 3300049582 Bacteria 10427
159 Ga0501048_0007670 3300049582 Bacteria 8179
160 Ga0501048_0011123 3300049582 Bacteria 6710
161 Ga0501048_0061956 3300049582 Bacteria 2648
162 Ga0501048_0140834 3300049582 Bacteria 1705
163 Ga0501067_0151072 3300049583 Bacteria 1294
164 Ga0501068_0018816 3300049584 Bacteria 4002
165 Ga0501068_0022510 3300049584 Bacteria 3686
166 Ga0501068_0102294 3300049584 Bacteria 1776
167 Ga0501068_0362669 3300049584 Bacteria 932
168 Ga0501069_0000034 3300049585 Bacteria 92080
169 Ga0501069_0010032 3300049585 Bacteria 5008
170 Ga0501069_0215157 3300049585 Bacteria 1116
171 Ga0501070_0000013 3300049586 Bacteria 180554
172 Ga0501070_0019801 3300049586 Bacteria 5643
173 Ga0501070_0036188 3300049586 Bacteria 4123
174 Ga0501070_0042214 3300049586 Bacteria 3799
175 Ga0501070_0483712 3300049586 Bacteria 995
176 Ga0501071_0000690 3300049587 Bacteria 17660
177 Ga0501071_0005835 3300049587 Bacteria 7954
178 Ga0501071_0009340 3300049587 Bacteria 6528
179 Ga0501071_0029203 3300049587 Bacteria 3890
180 Ga0501071_0031414 3300049587 Bacteria 3764
181 Ga0501071_0031482 3300049587 Bacteria 3760
182 Ga0501071_0037459 3300049587 Bacteria 3463
183 Ga0501071_0040224 3300049587 Bacteria 3345
184 Ga0501071_0050806 3300049587 Bacteria 2987
185 Ga0501071_0067836 3300049587 Bacteria 2595
186 Ga0501071_0083189 3300049587 Bacteria 2344
187 Ga0501071_0203830 3300049587 Bacteria 1486
188 Ga0501071_0222022 3300049587 Bacteria 1422
189 Ga0501071_0252960 3300049587 Bacteria 1330
190 Ga0501071_0403958 3300049587 Bacteria 1043
191 Ga0501072_0002058 3300049588 Bacteria 14955
192 Ga0501072_0006686 3300049588 Bacteria 8766
193 Ga0501072_0008437 3300049588 Bacteria 7820
194 Ga0501072_0010867 3300049588 Bacteria 6943
195 Ga0501072_0050267 3300049588 Bacteria 3282
196 Ga0501072_0106004 3300049588 Bacteria 2235
197 Ga0501072_0115205 3300049588 Bacteria 2140
198 Ga0501072_0156736 3300049588 Bacteria 1815
199 Ga0501072_0493565 3300049588 Bacteria 968
200 Ga0501073_0014811 3300049589 Bacteria 5660
201 Ga0501073_0028167 3300049589 Bacteria 4014
202 Ga0501073_0080511 3300049589 Bacteria 2266
203 Ga0501073_0125067 3300049589 Bacteria 1782
204 Ga0501074_0001484 3300049590 Bacteria 15779
205 Ga0501074_0003983 3300049590 Bacteria 10527
206 Ga0501074_0005508 3300049590 Bacteria 9110
207 Ga0501074_0040971 3300049590 Bacteria 3353
208 Ga0501074_0059980 3300049590 Bacteria 2740
209 Ga0501074_0086342 3300049590 Bacteria 2248
210 Ga0501074_0092001 3300049590 Bacteria 2172
211 Ga0501074_0154343 3300049590 Bacteria 1641
212 Ga0501074_0159556 3300049590 Bacteria 1611
213 Ga0501074_0218873 3300049590 Bacteria 1356
214 Ga0501074_0232569 3300049590 Bacteria 1312
215 Ga0501074_0553738 3300049590 Bacteria 814
216 Ga0501075_0000618 3300049591 Bacteria 21768
217 Ga0501075_0002301 3300049591 Bacteria 12679
218 Ga0501075_0014185 3300049591 Bacteria 5710
219 Ga0501075_0020459 3300049591 Bacteria 4816
220 Ga0501075_0045659 3300049591 Bacteria 3289
221 Ga0501075_0054639 3300049591 Bacteria 3004
222 Ga0501075_0077174 3300049591 Bacteria 2521
223 Ga0501075_0107499 3300049591 Bacteria 2120
224 Ga0501075_0121808 3300049591 Bacteria 1985
225 Ga0501076_0003471 3300049592 Bacteria 11071
226 Ga0501076_0005439 3300049592 Bacteria 9161
227 Ga0501076_0011593 3300049592 Bacteria 6575
228 Ga0501076_0012960 3300049592 Bacteria 6241
229 Ga0501076_0015284 3300049592 Bacteria 5798
230 Ga0501076_0017163 3300049592 Bacteria 5499
231 Ga0501076_0062171 3300049592 Bacteria 2973
232 Ga0501076_0077529 3300049592 Bacteria 2666
233 Ga0501076_0208998 3300049592 Bacteria 1594
234 Ga0501077_0001373 3300049593 Bacteria 14652
235 Ga0501077_0008301 3300049593 Bacteria 6421
236 Ga0501077_0051216 3300049593 Bacteria 2624
237 Ga0501077_0059826 3300049593 Bacteria 2418
238 Ga0501077_0256606 3300049593 Bacteria 1112
239 Ga0501077_0549042 3300049593 Unclassified 741
240 Ga0501077_1003859 3300049593 Unclassified 537
241 Ga0501079_0001665 3300049741 Bacteria 15794
242 Ga0501079_0004069 3300049741 Bacteria 10829
243 Ga0501079_0005102 3300049741 Bacteria 9751
244 Ga0501079_0025130 3300049741 Bacteria 4569
245 Ga0501079_0030889 3300049741 Bacteria 4116
246 Ga0501079_0048380 3300049741 Bacteria 3281
247 Ga0501079_0091443 3300049741 Bacteria 2358
248 Ga0501079_0161791 3300049741 Bacteria 1746
249 Ga0501079_0176040 3300049741 Bacteria 1668
250 Ga0501079_0362876 3300049741 Bacteria 1135
251 Ga0501079_0496639 3300049741 Bacteria 959
252 Ga0501080_0002466 3300049742 Bacteria 16196
253 Ga0501080_0012429 3300049742 Bacteria 7805
254 Ga0501080_0051516 3300049742 Bacteria 3830
255 Ga0501080_0097228 3300049742 Bacteria 2733
256 Ga0501080_0122657 3300049742 Bacteria 2407
257 Ga0501081_0000409 3300049743 Bacteria 23836
258 Ga0501081_0011595 3300049743 Bacteria 5770
259 Ga0501081_0022037 3300049743 Bacteria 4259
260 Ga0501081_0026406 3300049743 Bacteria 3915
261 Ga0501081_0027720 3300049743 Bacteria 3819
262 Ga0501081_0036799 3300049743 Bacteria 3337
263 Ga0501081_0104774 3300049743 Bacteria 2003
264 Ga0501081_0239736 3300049743 Bacteria 1322
265 Ga0501081_0257982 3300049743 Bacteria 1273
266 Ga0501081_0611349 3300049743 Bacteria 816
267 Ga0501083_0003974 3300049744 Bacteria 10383
268 Ga0501083_0054111 3300049744 Bacteria 2694
269 Ga0501083_0072240 3300049744 Bacteria 2294
270 Ga0501083_0152267 3300049744 Bacteria 1514
271 Ga0501083_0220717 3300049744 Bacteria 1235
272 Ga0501035_0021538 3300049822 Bacteria 5926
273 Ga0501035_0131236 3300049822 Bacteria 2184
274 Ga0501035_0136855 3300049822 Bacteria 2132
275 Ga0501035_0150762 3300049822 Bacteria 2018
276 Ga0501035_0177123 3300049822 Bacteria 1839
277 Ga0501035_0216974 3300049822 Bacteria 1635
278 Ga0501044_0034319 3300049823 Bacteria 5321
279 Ga0501044_0042546 3300049823 Bacteria 4724
280 Ga0501044_0242677 3300049823 Bacteria 1745
281 Ga0501044_0815144 3300049823 Unclassified 812
282 Ga0501045_0000070 3300049824 Bacteria 47689
283 Ga0501045_0000620 3300049824 Bacteria 22450
284 Ga0501045_0004626 3300049824 Bacteria 9500
285 Ga0501045_0007792 3300049824 Bacteria 7448
286 Ga0501045_0072688 3300049824 Bacteria 2532
287 Ga0501045_0114713 3300049824 Bacteria 1998
288 Ga0501045_0166652 3300049824 Bacteria 1641
289 Ga0501045_0206644 3300049824 Bacteria 1463
290 Ga0501045_0314048 3300049824 Bacteria 1166
291 Ga0501045_0415073 3300049824 Bacteria 1001
292 Ga0501045_0434217 3300049824 Bacteria 977
293 nmdc:mga00v17_113126_c1 3300050491 Bacteria 1723
294 nmdc:mga00v17_4840_c1 3300050491 Bacteria 7052
295 nmdc:mga0yw44_204382_c1 3300050492 Bacteria 1305
296 nmdc:mga0yw44_248256_c1 3300050492 Bacteria 1184
297 nmdc:mga0k408_139313_c1 3300050493 Bacteria 1442
298 nmdc:mga06z11_106913_c1 3300050494 Bacteria 1543
299 nmdc:mga06z11_257642_c1 3300050494 Unclassified 1029
300 nmdc:mga04h51_72179_c1 3300050495 Bacteria 1207
301 Ga0500616_0001313 3300053153 Bacteria 24565
302 Ga0501084_0002761 3300054114 Bacteria 14171
303 Ga0501084_0007329 3300054114 Bacteria 9086
304 Ga0501084_0048493 3300054114 Bacteria 3555
305 Ga0501084_0064396 3300054114 Bacteria 3068
306 Ga0501084_0069623 3300054114 Bacteria 2945
307 Ga0501084_0077755 3300054114 Bacteria 2781
308 Ga0501084_0091929 3300054114 Bacteria 2548
309 Ga0501084_0135920 3300054114 Bacteria 2069
310 Ga0501084_0147644 3300054114 Bacteria 1981
311 Ga0501084_0780650 3300054114 Bacteria 805
312 Ga0501082_0000537 3300060353 Bacteria 33718
313 Ga0501082_0001605 3300060353 Bacteria 19918
314 Ga0501082_0009894 3300060353 Bacteria 8217
315 Ga0501082_0015163 3300060353 Bacteria 6639
316 Ga0501082_0020659 3300060353 Bacteria 5676
317 Ga0501082_0038318 3300060353 Bacteria 4135
318 Ga0501082_0060784 3300060353 Bacteria 3253
319 Ga0501082_0067844 3300060353 Bacteria 3072
320 Ga0501082_0118863 3300060353 Bacteria 2290
321 Ga0501082_0672066 3300060353 Bacteria 906
322 Ga0530510_0002675 3300061734 Bacteria 12244
323 Ga0530510_0028905 3300061734 Bacteria 3976
324 Ga0530510_0031218 3300061734 Bacteria 3830
325 Ga0530510_0063242 3300061734 Bacteria 2679
326 Ga0530510_0067311 3300061734 Bacteria 2598
327 Ga0530510_0070528 3300061734 Bacteria 2537
328 Ga0530510_0123785 3300061734 Bacteria 1900
329 Ga0530510_0346455 3300061734 Bacteria 1116
330 Ga0530510_0366546 3300061734 Bacteria 1083
331 Ga0501071_1452997
332 Ga0070670_100096285
333 Ga0070675_101214364
334 Ga0070671_100010580
335 Ga0070671_100578494
336 Ga0070672_100635436
337 Ga0068859_100255792
338 Ga0068858_100018985
339 Ga0068860_100656327
340 Ga0075365_10118847
341 Ga0075365_10164400
342 Ga0075365_10278266
343 Ga0075368_10060217
344 Ga0075364_10011253
345 Ga0075367_10046914
346 Ga0075367_10091230
347 Ga0075366_10579621
348 Ga0097620_100255787
349 Ga0097620_101137916
350 Ga0105243_10153044
351 Ga0105249_11118708
352 Ga0163162_11641505
353 Ga0163163_10184282
354 Ga0163163_11536430
355 Ga0157380_10110129
356 Ga0157380_10357695
357 Ga0157380_10916225
358 Ga0157379_10541904
359 Ga0157376_10910532
360 Ga0207681_10185236
361 Ga0207650_10247593
362 Ga0207650_10287100
363 Ga0207659_10711909
364 Ga0207644_10055152
365 Ga0207644_10451561
366 Ga0207644_10531949
367 Ga0207644_11102616
368 Ga0207691_10393662
369 Ga0207661_10426147
370 Ga0207712_10292536
371 Ga0207668_10247514
372 Ga0207675_100075581
373 Ga0209813_10200671
374 Ga0268264_10540285
375 Ga0316579_10070209
376 Ga0316576_10010548
377 Ga0316576_10023826
378 Ga0316576_10077940
379 Ga0316576_10101000
380 Ga0316576_10429525
381 Ga0316576_10726251
382 Ga0316578_10010930
383 Ga0316578_10064872
384 Ga0316578_10125146
385 Ga0316578_10306939
386 Ga0316577_10585743
387 Ga0307415_101394758
388 Ga0316580_10012434
389 Ga0316574_0021754
390 Ga0316574_0072270
391 Ga0316574_0074818
392 Ga0316574_0087245
393 Ga0316574_0166399
394 Ga0316574_0230014
395 Ga0316574_0288758
396 Ga0316574_0464626
397 Ga0316582_0014069
398 Ga0316582_0125031
399 Ga0316582_0403490
400 Ga0316584_0596171
401 Ga0316584_0710103
402 Ga0316584_0734957
403 Ga0395905_0499336
404 Ga0400483_064737
405 Ga0400483_251783
406 Ga0439465_0415832
407 Ga0451837_0530891
408 Ga0439445_0151201
409 Ga0450907_018459
410 Ga0439446_0219182
411 Ga0439434_0019588
412 Ga0466967_0396002
413 Ga0466967_0501548
414 Ga0496100_0444051
415 Ga0496101_0409343
416 Ga0496105_0643672
417 Ga0496110_0160358
418 Ga0496111_0547038
419 Ga0496114_0144741
420 Ga0496114_0378207
421 Ga0501031_0001457
422 Ga0501031_0007330
423 Ga0501031_0038039
424 Ga0501032_0065995
425 Ga0501032_0177496
426 Ga0501033_0130671
427 Ga0501033_0203107
428 Ga0501033_0862790
429 Ga0501034_0000034
430 Ga0501034_0045334
431 Ga0501034_0523997
432 Ga0501034_0638967
433 Ga0501036_0007037
434 Ga0501036_0008618
435 Ga0501036_0026015
436 Ga0501036_0070137
437 Ga0501037_0015025
438 Ga0501037_0036061
439 Ga0501037_0211388
440 Ga0501037_0252584
441 Ga0501037_0428019
442 Ga0501037_0784854
443 Ga0501038_0000682
444 Ga0501038_0003318
445 Ga0501038_0024111
446 Ga0501038_0028769
447 Ga0501038_0157830
448 Ga0501039_0014846
449 Ga0501039_0080782
450 Ga0501039_0126655
451 Ga0501039_0162083
452 Ga0501039_0167513
453 Ga0501039_0178175
454 Ga0501039_0182142
455 Ga0501039_0205648
456 Ga0501040_0001139
457 Ga0501040_0006863
458 Ga0501040_0051315
459 Ga0501040_0063844
460 Ga0501040_0084440
461 Ga0501040_0123019
462 Ga0501040_0125999
463 Ga0501040_0165206
464 Ga0501040_0208656
465 Ga0501041_0001557
466 Ga0501041_0010460
467 Ga0501041_0013594
468 Ga0501041_0051004
469 Ga0501041_0068948
470 Ga0501041_0110281
471 Ga0501041_0155651
472 Ga0501041_0194667
473 Ga0501042_0000635
474 Ga0501042_0006206
475 Ga0501042_0037058
476 Ga0501042_0114762
477 Ga0501042_0443766
478 Ga0501043_0006169
479 Ga0501043_0013125
480 Ga0501043_0604584
481 Ga0501046_0000365
482 Ga0501046_0002786
483 Ga0501046_0005602
484 Ga0501046_0006708
485 Ga0501047_0329578
486 Ga0501047_0428429
487 Ga0501047_0664629
488 Ga0501048_0004670
489 Ga0501048_0007670
490 Ga0501048_0011123
491 Ga0501048_0061956
492 Ga0501048_0140834
493 Ga0501067_0151072
494 Ga0501068_0018816
495 Ga0501068_0022510
496 Ga0501068_0102294
497 Ga0501068_0362669
498 Ga0501069_0000034
499 Ga0501069_0010032
500 Ga0501069_0215157
501 Ga0501070_0000013
502 Ga0501070_0019801
503 Ga0501070_0036188
504 Ga0501070_0042214
505 Ga0501070_0483712
506 Ga0501071_0000690
507 Ga0501071_0005835
508 Ga0501071_0009340
509 Ga0501071_0029203
510 Ga0501071_0031414
511 Ga0501071_0031482
512 Ga0501071_0037459
513 Ga0501071_0040224
514 Ga0501071_0050806
515 Ga0501071_0067836
516 Ga0501071_0083189
517 Ga0501071_0203830
518 Ga0501071_0222022
519 Ga0501071_0252960
520 Ga0501071_0403958
521 Ga0501072_0002058
522 Ga0501072_0006686
523 Ga0501072_0008437
524 Ga0501072_0010867
525 Ga0501072_0050267
526 Ga0501072_0106004
527 Ga0501072_0115205
528 Ga0501072_0156736
529 Ga0501072_0493565
530 Ga0501073_0014811
531 Ga0501073_0028167
532 Ga0501073_0080511
533 Ga0501073_0125067
534 Ga0501074_0001484
535 Ga0501074_0003983
536 Ga0501074_0005508
537 Ga0501074_0040971
538 Ga0501074_0059980
539 Ga0501074_0086342
540 Ga0501074_0092001
541 Ga0501074_0154343
542 Ga0501074_0159556
543 Ga0501074_0218873
544 Ga0501074_0232569
545 Ga0501074_0553738
546 Ga0501075_0000618
547 Ga0501075_0002301
548 Ga0501075_0014185
549 Ga0501075_0020459
550 Ga0501075_0045659
551 Ga0501075_0054639
552 Ga0501075_0077174
553 Ga0501075_0107499
554 Ga0501075_0121808
555 Ga0501076_0003471
556 Ga0501076_0005439
557 Ga0501076_0011593
558 Ga0501076_0012960
559 Ga0501076_0015284
560 Ga0501076_0017163
561 Ga0501076_0062171
562 Ga0501076_0077529
563 Ga0501076_0208998
564 Ga0501077_0001373
565 Ga0501077_0008301
566 Ga0501077_0051216
567 Ga0501077_0059826
568 Ga0501077_0256606
569 Ga0501077_0549042
570 Ga0501077_1003859
571 Ga0501079_0001665
572 Ga0501079_0004069
573 Ga0501079_0005102
574 Ga0501079_0025130
575 Ga0501079_0030889
576 Ga0501079_0048380
577 Ga0501079_0091443
578 Ga0501079_0161791
579 Ga0501079_0176040
580 Ga0501079_0362876
581 Ga0501079_0496639
582 Ga0501080_0002466
583 Ga0501080_0012429
584 Ga0501080_0051516
585 Ga0501080_0097228
586 Ga0501080_0122657
587 Ga0501081_0000409
588 Ga0501081_0011595
589 Ga0501081_0022037
590 Ga0501081_0026406
591 Ga0501081_0027720
592 Ga0501081_0036799
593 Ga0501081_0104774
594 Ga0501081_0239736
595 Ga0501081_0257982
596 Ga0501081_0611349
597 Ga0501083_0003974
598 Ga0501083_0054111
599 Ga0501083_0072240
600 Ga0501083_0152267
601 Ga0501083_0220717
602 Ga0501035_0021538
603 Ga0501035_0131236
604 Ga0501035_0136855
605 Ga0501035_0150762
606 Ga0501035_0177123
607 Ga0501035_0216974
608 Ga0501044_0034319
609 Ga0501044_0042546
610 Ga0501044_0242677
611 Ga0501044_0815144
612 Ga0501045_0000070
613 Ga0501045_0000620
614 Ga0501045_0004626
615 Ga0501045_0007792
616 Ga0501045_0072688
617 Ga0501045_0114713
618 Ga0501045_0166652
619 Ga0501045_0206644
620 Ga0501045_0314048
621 Ga0501045_0415073
622 Ga0501045_0434217
623 nmdc:mga00v17_113126_c1
624 nmdc:mga00v17_4840_c1
625 nmdc:mga0yw44_204382_c1
626 nmdc:mga0yw44_248256_c1
627 nmdc:mga0k408_139313_c1
628 nmdc:mga06z11_106913_c1
629 nmdc:mga06z11_257642_c1
630 nmdc:mga04h51_72179_c1
631 Ga0500616_0001313
632 Ga0501084_0002761
633 Ga0501084_0007329
634 Ga0501084_0048493
635 Ga0501084_0064396
636 Ga0501084_0069623
637 Ga0501084_0077755
638 Ga0501084_0091929
639 Ga0501084_0135920
640 Ga0501084_0147644
641 Ga0501084_0780650
642 Ga0501082_0000537
643 Ga0501082_0001605
644 Ga0501082_0009894
645 Ga0501082_0015163
646 Ga0501082_0020659
647 Ga0501082_0038318
648 Ga0501082_0060784
649 Ga0501082_0067844
650 Ga0501082_0118863
651 Ga0501082_0672066
652 Ga0530510_0002675
653 Ga0530510_0028905
654 Ga0530510_0031218
655 Ga0530510_0063242
656 Ga0530510_0067311
657 Ga0530510_0070528
658 Ga0530510_0123785
659 Ga0530510_0346455
660 Ga0530510_0366546

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01613

Flavin_Reduct

Flavin reductase like domain

3

156

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wgb-assembly1.cif.gz_A crystal structure of a probable flavoprotein from thermus thermophilus hb8 0.944 18 161
2r0x-assembly1.cif.gz_A-2 crystal structure of a putative flavin reductase (ycdh, hs_1225) from haemophilus somnus 129pt at 1.06 a resolution 0.9021 17 142
2qck-assembly1.cif.gz_A crystal structure of flavin reductase domain protein (yp_831077.1) from arthrobacter sp. fb24 at 1.90 a resolution 0.8884 17 144
3zoe-assembly1.cif.gz_A crystal structure of fmn-binding protein (yp_005476) from thermus thermophilus with bound p-hydroxybenzaldehyde 0.8852 17 143
3zoe-assembly1.cif.gz_B crystal structure of fmn-binding protein (yp_005476) from thermus thermophilus with bound p-hydroxybenzaldehyde 0.8838 17 142
ID Description Score Start End Superfamily
1wgbA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9317 18 161 2.30.110.10
af_O53254_5_167_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8976 17 157 2.30.110.10
3zoeB00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8838 17 142 2.30.110.10
2qckA01 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8821 17 149 2.30.110.10
2r0xA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8787 17 142 2.30.110.10
ID Description Score Start End GO Terms
AF-A0A354BAU4-F1-model_v4 Flavin reductase like domain-containing protein 0.9792 26 165 GO:0010181
GO:0042602
AF-A0A7V4MTD4-F1-model_v4 Flavin reductase family protein 0.9672 18 161 GO:0010181
GO:0042602
AF-A0A7C1Q0K2-F1-model_v4 Flavin reductase 0.967 18 161 GO:0010181
GO:0042602
AF-A0A1G1KGX6-F1-model_v4 Flavin reductase like domain-containing protein 0.9662 18 161 GO:0010181
GO:0042602
AF-A0A3M1LYE1-F1-model_v4 Flavin reductase 0.9639 18 161 GO:0010181
GO:0042602

Map