F410229

General Info

Members Datasets Scaffolds Average Seq Length
330 135 319 221

Family's Representative Sequence

Representative Sequence 3300046519|Ga0495632_0000280|Ga0495632_0000280_36166_36882
Length 238
Sequence MTPRPLRRLLCTFLLGLAAVLAAVLAPSAGAAEPKEYAGYLTLPSSQPTDTGRKIEVIEFFAYYCPHCYAFEPQLSAWVKKQGDNIVFKRVHVPRDANVAPQQRLFFTLEALGLLEQYHDKVFAAMHVERLRLNSDEQVFDWITKNGIDRARFIDTYRSFGIQARLRRADTMIDAYRVDRWPVVVIDGRFLTSPSHANENKADAGTEAQQQQVALQVMDTLVAKARAEKGMADKNRAN

Samples

Sample ID Description Type Environment
1 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
2 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
3 2821131069 Duganella sp. 1224 Isolate Unclassified
4 2842711865 Duganella sp. R-73148 Isolate Unclassified
5 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
6 2857553236 Duganella sp. R-74557 Isolate Unclassified
7 2857558681 Duganella sp. R-74565 Isolate Unclassified
8 2904424332 Duganella sp. 1411 Isolate Rhizosphere
9 2919476304 Duganella sp. 3397 Isolate Unclassified
10 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
11 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
12 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
13 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
14 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
15 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
16 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
17 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
18 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
19 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
20 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
23 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
24 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
25 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
26 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
27 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
28 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
29 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
30 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
31 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
32 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
33 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
34 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
35 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
36 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
37 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
38 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
39 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
40 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
41 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
42 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
46 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
47 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
48 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
49 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
50 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
51 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
52 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
53 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
54 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
55 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
56 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
57 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
58 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
59 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
60 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
61 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
62 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
63 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
64 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
65 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
66 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
67 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
68 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
69 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
70 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
71 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
72 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
73 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
74 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
75 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
76 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
77 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
78 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
79 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
80 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
81 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
82 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
83 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
84 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
85 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
86 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
87 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
88 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
89 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
90 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
91 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
92 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
93 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
94 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
95 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
96 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
97 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
98 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
99 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
100 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
101 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
102 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
103 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
104 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
105 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
106 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
107 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
108 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
109 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
110 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
111 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
112 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
113 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
114 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
115 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
116 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
117 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
118 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
119 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
120 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
121 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
122 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
123 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
124 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
125 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
126 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
127 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
128 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
129 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
130 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
131 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
132 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
133 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
134 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
135 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.06
Metatranscriptomes 0.61
Isolates 3.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.58
Nodule 1.21
Rhizoplane 2.73
Rhizosphere 82.42
Stem 0
Stem Tuber 0
Unclassified 6.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25158J39367_1017419 3300002739 Bacteria 899
2 JGI25159J45721_1003176 3300002987 Bacteria 5900
3 rootL2_10023251 3300003322 Bacteria 6848
4 rootH1_10202298 3300003323 Bacteria 3461
5 JGI25161J50226_1001671 3300003374 Bacteria 6360
6 Ga0055529_1000027 3300003763 Bacteria 292744
7 Ga0055526_1001365 3300003771 Bacteria 17475
8 Ga0055526_1001772 3300003771 Bacteria 14997
9 Ga0055524_1000022 3300003775 Bacteria 224103
10 Ga0055543_1001989 3300004625 Bacteria 7272
11 Ga0065165_1006296 3300005262 Bacteria 6291
12 Ga0065165_1027554 3300005262 Bacteria 1850
13 Ga0075364_10435820 3300006051 Bacteria 895
14 Ga0079104_1016367 3300006946 Bacteria 2170
15 Ga0099826_10000006 3300006948 Bacteria 432260
16 Ga0105244_10005151 3300009036 Bacteria 8763
17 Ga0105244_10008499 3300009036 Bacteria 6406
18 Ga0157372_10167979 3300013307 Bacteria 2537
19 Ga0157375_11365567 3300013308 Bacteria 834
20 Ga0182006_1000138 3300015261 Bacteria 78470
21 Ga0182005_1000046 3300015265 Bacteria 138133
22 Ga0163161_10004787 3300017792 Bacteria 9426
23 Ga0213872_10000065 3300021361 Bacteria 96648
24 Ga0213872_10001325 3300021361 Bacteria 16383
25 Ga0213872_10008754 3300021361 Bacteria 4884
26 Ga0209436_102296 3300025208 Bacteria 5862
27 Ga0209437_119840 3300025233 Bacteria 837
28 Ga0207425_1004461 3300025245 Bacteria 4192
29 Ga0209646_1000120 3300025246 Bacteria 146035
30 Ga0209455_1000033 3300025272 Bacteria 504606
31 Ga0209130_1001299 3300025284 Bacteria 17162
32 Ga0209025_1004990 3300025294 Bacteria 11100
33 Ga0209564_1000028 3300025295 Bacteria 510986
34 Ga0209564_1000154 3300025295 Bacteria 166849
35 Ga0209758_1000354 3300025297 Bacteria 83217
36 Ga0209256_1000035 3300025299 Bacteria 386754
37 Ga0207655_1003180 3300025728 Bacteria 12394
38 Ga0207655_1004659 3300025728 Bacteria 9620
39 Ga0207705_10352718 3300025909 Bacteria 1134
40 Ga0207706_10326987 3300025933 Bacteria 1334
41 Ga0209281_1012657 3300027111 Bacteria 1845
42 Ga0209282_1000003 3300027666 Bacteria 856377
43 Ga0316181_1231410 3300030744 Bacteria 4194
44 Ga0307416_100001560 3300032002 Bacteria 12546
45 Ga0307411_10953029 3300032005 Bacteria 766
46 Ga0395900_0397946 3300037418 Bacteria 1342
47 Ga0436361_0094991 3300039447 Bacteria 18798
48 Ga0436361_0247969 3300039447 Bacteria 1747
49 Ga0436361_0283126 3300039447 Bacteria 5523
50 Ga0436361_0584638 3300039447 Bacteria 1917
51 Ga0436361_0900144 3300039447 Bacteria 143515
52 Ga0495617_001118 3300046452 Bacteria 12161
53 Ga0495627_000006 3300046453 Bacteria 581750
54 Ga0495627_001231 3300046453 Bacteria 15945
55 Ga0495590_0000022 3300046457 Bacteria 205122
56 Ga0495590_0014991 3300046457 Bacteria 2821
57 Ga0495638_0000099 3300046460 Bacteria 139325
58 Ga0495638_0000354 3300046460 Bacteria 57368
59 Ga0495638_0049829 3300046460 Bacteria 2617
60 Ga0495638_0064673 3300046460 Bacteria 2253
61 Ga0495650_0000356 3300046471 Bacteria 80805
62 Ga0495650_0001404 3300046471 Bacteria 23556
63 Ga0495650_0002354 3300046471 Bacteria 15586
64 Ga0495582_0093499 3300046473 Bacteria 1678
65 Ga0495605_0000041 3300046474 Bacteria 193873
66 Ga0495605_0000614 3300046474 Bacteria 27775
67 Ga0495605_0009371 3300046474 Bacteria 5502
68 Ga0495605_0017265 3300046474 Bacteria 3889
69 Ga0495605_0057915 3300046474 Bacteria 1863
70 Ga0495639_0007054 3300046475 Bacteria 4827
71 Ga0495584_0000972 3300046491 Bacteria 17980
72 Ga0495584_0008991 3300046491 Bacteria 5160
73 Ga0495585_0001416 3300046492 Bacteria 18867
74 Ga0495585_0007138 3300046492 Bacteria 6860
75 Ga0495585_0030245 3300046492 Bacteria 3080
76 Ga0495585_0033882 3300046492 Bacteria 2888
77 Ga0495585_0057244 3300046492 Bacteria 2151
78 Ga0495585_0064454 3300046492 Bacteria 2009
79 Ga0495585_0090584 3300046492 Bacteria 1647
80 Ga0495585_0139290 3300046492 Bacteria 1271
81 Ga0495594_0001996 3300046499 Bacteria 10636
82 Ga0495594_0006952 3300046499 Bacteria 5819
83 Ga0495596_0002418 3300046500 Bacteria 10074
84 Ga0495596_0007681 3300046500 Bacteria 4847
85 Ga0495596_0019052 3300046500 Bacteria 2824
86 Ga0495607_0001687 3300046501 Bacteria 19018
87 Ga0495607_0002004 3300046501 Bacteria 17081
88 Ga0495607_0005783 3300046501 Bacteria 8796
89 Ga0495607_0008758 3300046501 Bacteria 6892
90 Ga0495607_0028840 3300046501 Bacteria 3418
91 Ga0495607_0082236 3300046501 Bacteria 1767
92 Ga0495607_0082710 3300046501 Bacteria 1760
93 Ga0495607_0191271 3300046501 Bacteria 1019
94 Ga0495583_0000063 3300046506 Bacteria 194362
95 Ga0495583_0000220 3300046506 Bacteria 96267
96 Ga0495583_0000839 3300046506 Bacteria 37397
97 Ga0495583_0005535 3300046506 Bacteria 8544
98 Ga0495583_0035201 3300046506 Bacteria 2391
99 Ga0495583_0150401 3300046506 Bacteria 965
100 Ga0495606_0000169 3300046507 Bacteria 115434
101 Ga0495606_0000494 3300046507 Bacteria 64410
102 Ga0495606_0000609 3300046507 Bacteria 56606
103 Ga0495606_0001166 3300046507 Bacteria 37155
104 Ga0495606_0004324 3300046507 Bacteria 14290
105 Ga0495606_0033740 3300046507 Bacteria 3525
106 Ga0495606_0187186 3300046507 Bacteria 1189
107 Ga0495606_0344810 3300046507 Bacteria 792
108 Ga0495610_0001852 3300046512 Bacteria 18334
109 Ga0495610_0002889 3300046512 Bacteria 13903
110 Ga0495610_0003861 3300046512 Bacteria 11386
111 Ga0495610_0033608 3300046512 Bacteria 2649
112 Ga0495610_0034538 3300046512 Bacteria 2604
113 Ga0495610_0043411 3300046512 Bacteria 2240
114 Ga0495616_0002053 3300046513 Bacteria 13533
115 Ga0495616_0008112 3300046513 Bacteria 6250
116 Ga0495616_0026777 3300046513 Bacteria 3064
117 Ga0495616_0029470 3300046513 Bacteria 2897
118 Ga0495616_0038165 3300046513 Bacteria 2467
119 Ga0495616_0169445 3300046513 Bacteria 977
120 Ga0495631_0003758 3300046518 Bacteria 8259
121 Ga0495631_0003796 3300046518 Bacteria 8218
122 Ga0495631_0006084 3300046518 Bacteria 6264
123 Ga0495631_0025860 3300046518 Bacteria 2699
124 Ga0495631_0072420 3300046518 Bacteria 1488
125 Ga0495632_0000280 3300046519 Bacteria 50071
126 Ga0495632_0001304 3300046519 Bacteria 21096
127 Ga0495632_0023622 3300046519 Bacteria 3280
128 Ga0495632_0083850 3300046519 Bacteria 1517
129 Ga0495637_0001558 3300046520 Bacteria 13371
130 Ga0495637_0071533 3300046520 Bacteria 1398
131 Ga0495637_0113136 3300046520 Bacteria 1050
132 Ga0495643_0000245 3300046522 Bacteria 80531
133 Ga0495643_0002014 3300046522 Bacteria 16943
134 Ga0495643_0010788 3300046522 Bacteria 5603
135 Ga0495644_0001901 3300046523 Bacteria 8391
136 Ga0495644_0003440 3300046523 Bacteria 6262
137 Ga0495644_0004210 3300046523 Bacteria 5652
138 Ga0495644_0006795 3300046523 Bacteria 4432
139 Ga0495648_0000004 3300046524 Bacteria 373639
140 Ga0495648_0004096 3300046524 Bacteria 12575
141 Ga0495648_0009089 3300046524 Bacteria 7752
142 Ga0495648_0011106 3300046524 Bacteria 6815
143 Ga0495648_0013728 3300046524 Bacteria 5970
144 Ga0495648_0033082 3300046524 Bacteria 3383
145 Ga0495648_0050604 3300046524 Bacteria 2536
146 Ga0495663_0002068 3300046525 Bacteria 6146
147 Ga0495666_0002294 3300046526 Bacteria 9529
148 Ga0495666_0040784 3300046526 Bacteria 2250
149 Ga0495642_0000707 3300046528 Bacteria 16603
150 Ga0495642_0011486 3300046528 Bacteria 3403
151 Ga0495642_0057247 3300046528 Bacteria 1611
152 Ga0495642_0060277 3300046528 Bacteria 1573
153 Ga0495642_0086693 3300046528 Bacteria 1322
154 Ga0495654_0006998 3300046530 Bacteria 6353
155 Ga0495654_0074553 3300046530 Bacteria 1602
156 Ga0495665_0027345 3300046531 Bacteria 3061
157 Ga0495609_0001551 3300046538 Bacteria 15042
158 Ga0495609_0002738 3300046538 Bacteria 10611
159 Ga0495609_0005176 3300046538 Bacteria 6939
160 Ga0495609_0010503 3300046538 Bacteria 4439
161 Ga0495609_0049533 3300046538 Bacteria 1875
162 Ga0495609_0073190 3300046538 Bacteria 1503
163 Ga0495597_0000563 3300046542 Bacteria 30796
164 Ga0495597_0001057 3300046542 Bacteria 21005
165 Ga0495597_0002893 3300046542 Bacteria 10470
166 Ga0495597_0008536 3300046542 Bacteria 5127
167 Ga0495597_0018660 3300046542 Bacteria 3252
168 Ga0495597_0039564 3300046542 Bacteria 2111
169 Ga0495622_0000157 3300046557 Bacteria 57030
170 Ga0495622_0000500 3300046557 Bacteria 24597
171 Ga0495622_0011242 3300046557 Bacteria 4133
172 Ga0495633_0000327 3300046558 Bacteria 53707
173 Ga0495633_0000472 3300046558 Bacteria 40822
174 Ga0495633_0003329 3300046558 Bacteria 10790
175 Ga0495633_0003462 3300046558 Bacteria 10494
176 Ga0495633_0010130 3300046558 Bacteria 5160
177 Ga0495633_0013903 3300046558 Bacteria 4220
178 Ga0495633_0014355 3300046558 Bacteria 4145
179 Ga0495633_0018291 3300046558 Bacteria 3562
180 Ga0495633_0026733 3300046558 Bacteria 2828
181 Ga0495633_0088055 3300046558 Bacteria 1444
182 Ga0495656_0014463 3300046615 Bacteria 2959
183 Ga0495656_0037727 3300046615 Bacteria 1998
184 Ga0495656_0057824 3300046615 Bacteria 1680
185 Ga0495656_0101542 3300046615 Bacteria 1331
186 Ga0495668_0000219 3300046616 Bacteria 83081
187 Ga0495668_0000333 3300046616 Bacteria 64401
188 Ga0495668_0004052 3300046616 Bacteria 10657
189 Ga0495668_0008046 3300046616 Bacteria 6639
190 Ga0495668_0048489 3300046616 Bacteria 2356
191 Ga0495668_0149137 3300046616 Bacteria 1280
192 Ga0495668_0193636 3300046616 Bacteria 1113
193 Ga0495611_0001565 3300046648 Bacteria 11204
194 Ga0495611_0002679 3300046648 Bacteria 8029
195 Ga0495611_0004039 3300046648 Bacteria 6386
196 Ga0495611_0006807 3300046648 Bacteria 4856
197 Ga0495625_0000412 3300046660 Bacteria 64883
198 Ga0495625_0000821 3300046660 Bacteria 42765
199 Ga0495625_0008334 3300046660 Bacteria 8851
200 Ga0495625_0025809 3300046660 Bacteria 4449
201 Ga0495625_0027110 3300046660 Bacteria 4319
202 Ga0495625_0034727 3300046660 Bacteria 3719
203 Ga0495625_0165967 3300046660 Bacteria 1476
204 Ga0495625_0260496 3300046660 Bacteria 1122
205 Ga0495659_0001811 3300046664 Bacteria 7094
206 Ga0495661_0004087 3300046665 Bacteria 10626
207 Ga0495661_0041814 3300046665 Bacteria 2832
208 Ga0495661_0069664 3300046665 Bacteria 2060
209 Ga0495661_0095687 3300046665 Bacteria 1680
210 Ga0495588_0024158 3300046674 Bacteria 3017
211 Ga0495623_0067680 3300046679 Bacteria 2229
212 Ga0495669_0005123 3300046684 Bacteria 5453
213 Ga0495670_0033134 3300046691 Bacteria 2570
214 Ga0495670_0054635 3300046691 Bacteria 2001
215 Ga0495670_0080915 3300046691 Bacteria 1655
216 Ga0495670_0104539 3300046691 Bacteria 1461
217 Ga0495670_0128019 3300046691 Bacteria 1322
218 Ga0495671_0000609 3300046692 Bacteria 26284
219 Ga0495671_0006883 3300046692 Bacteria 6523
220 Ga0495671_0051290 3300046692 Bacteria 2052
221 Ga0495671_0109640 3300046692 Bacteria 1348
222 Ga0495671_0202243 3300046692 Bacteria 963
223 Ga0495649_0003103 3300046694 Bacteria 11372
224 Ga0495649_0012981 3300046694 Bacteria 4821
225 Ga0495649_0013776 3300046694 Bacteria 4656
226 Ga0495649_0035937 3300046694 Bacteria 2724
227 Ga0495649_0063720 3300046694 Bacteria 1980
228 Ga0495649_0073705 3300046694 Bacteria 1829
229 Ga0495649_0095094 3300046694 Bacteria 1586
230 Ga0495589_0001945 3300046794 Bacteria 11691
231 Ga0495589_0018234 3300046794 Bacteria 3601
232 Ga0495589_0019398 3300046794 Bacteria 3486
233 Ga0495589_0049135 3300046794 Bacteria 2087
234 Ga0495660_0001147 3300046810 Bacteria 18835
235 Ga0495660_0002698 3300046810 Bacteria 11212
236 Ga0495660_0013887 3300046810 Bacteria 4667
237 Ga0495660_0017542 3300046810 Bacteria 4120
238 Ga0495660_0026381 3300046810 Bacteria 3294
239 Ga0495660_0036461 3300046810 Bacteria 2743
240 Ga0495660_0136668 3300046810 Bacteria 1224
241 Ga0495604_0253921 3300047317 Bacteria 1197
242 Ga0495636_0000972 3300047318 Bacteria 10710
243 Ga0495636_0140198 3300047318 Bacteria 1079
244 Ga0495672_0000431 3300047320 Bacteria 50205
245 Ga0495672_0001709 3300047320 Bacteria 21262
246 Ga0495672_0001925 3300047320 Bacteria 19641
247 Ga0495672_0010140 3300047320 Bacteria 6736
248 Ga0495676_0018280 3300047321 Bacteria 6180
249 Ga0495683_0002282 3300047323 Bacteria 11694
250 Ga0495683_0002939 3300047323 Bacteria 10088
251 Ga0495683_0055512 3300047323 Bacteria 1971
252 Ga0495683_0073443 3300047323 Bacteria 1677
253 Ga0495687_000562 3300047443 Bacteria 43714
254 Ga0495687_000917 3300047443 Bacteria 30658
255 Ga0495687_002375 3300047443 Bacteria 15204
256 Ga0495687_007174 3300047443 Bacteria 6637
257 Ga0495687_009901 3300047443 Bacteria 5277
258 Ga0495687_146055 3300047443 Bacteria 815
259 Ga0495675_0079103 3300047444 Bacteria 2071
260 Ga0495677_0001426 3300047445 Bacteria 9585
261 Ga0495677_0001516 3300047445 Bacteria 9349
262 Ga0495677_0016413 3300047445 Bacteria 2687
263 Ga0495677_0018611 3300047445 Bacteria 2517
264 Ga0495677_0031305 3300047445 Bacteria 1936
265 Ga0495677_0079285 3300047445 Bacteria 1229
266 Ga0495677_0090268 3300047445 Bacteria 1154
267 Ga0495679_003276 3300047446 Bacteria 7843
268 Ga0495679_043479 3300047446 Bacteria 1381
269 Ga0495679_049124 3300047446 Bacteria 1273
270 Ga0495685_000345 3300047447 Bacteria 14907
271 Ga0495685_015044 3300047447 Bacteria 2634
272 Ga0495673_0000074 3300047469 Bacteria 210788
273 Ga0495673_0020003 3300047469 Bacteria 3341
274 Ga0495681_0000642 3300047470 Bacteria 26610
275 Ga0495681_0001763 3300047470 Bacteria 15948
276 Ga0495681_0029791 3300047470 Bacteria 2787
277 Ga0495686_0007778 3300047472 Bacteria 7977
278 Ga0495686_0021324 3300047472 Bacteria 4305
279 Ga0495686_0246598 3300047472 Bacteria 1005
280 Ga0495615_0089205 3300048090 Bacteria 857
281 Ga0495626_0028194 3300048091 Bacteria 2724
282 Ga0495626_0068753 3300048091 Bacteria 1596
283 Ga0495626_0096622 3300048091 Bacteria 1293
284 Ga0496102_0000097 3300048905 Bacteria 124414
285 Ga0496103_0020922 3300048906 Bacteria 3933
286 Ga0496103_0046644 3300048906 Bacteria 2676
287 Ga0496105_0349454 3300048908 Bacteria 1181
288 Ga0496107_0327169 3300048910 Bacteria 1140
289 Ga0496110_0170190 3300048913 Bacteria 1976
290 Ga0496110_0396095 3300048913 Bacteria 1259
291 Ga0496114_0291035 3300048917 Bacteria 1441
292 Ga0496116_0082289 3300048919 Bacteria 1992
293 Ga0496118_0084408 3300048921 Bacteria 2216
294 Ga0496121_0055216 3300048924 Bacteria 3311
295 Ga0496123_0003832 3300048926 Bacteria 16407
296 Ga0496123_0182656 3300048926 Bacteria 1094
297 Ga0496124_0068210 3300048927 Bacteria 2957
298 Ga0496124_0088932 3300048927 Bacteria 2523
299 Ga0496124_0104723 3300048927 Bacteria 2287
300 Ga0496124_0175375 3300048927 Bacteria 1655
301 Ga0496124_0559071 3300048927 Bacteria 753
302 Ga0496126_0100605 3300048929 Bacteria 2530
303 Ga0495678_000013 3300049459 Bacteria 316375
304 Ga0495678_001534 3300049459 Bacteria 17833
305 Ga0495678_003140 3300049459 Bacteria 10447
306 Ga0495678_003481 3300049459 Bacteria 9716
307 Ga0495678_004469 3300049459 Bacteria 8077
308 Ga0495682_0001101 3300049460 Bacteria 15713
309 Ga0495682_0002294 3300049460 Bacteria 9141
310 Ga0495682_0005422 3300049460 Bacteria 5301
311 Ga0501321_015632 3300049537 Bacteria 895
312 Ga0501323_034414 3300049539 Bacteria 723
313 Ga0501238_003667 3300049671 Bacteria 1895
314 Ga0501269_001251 3300049766 Bacteria 3424
315 Ga0501279_001091 3300049775 Bacteria 3583
316 Ga0500594_0050002 3300053118 Bacteria 1174
317 Ga0500618_030571 3300053125 Bacteria 1266
318 Ga0500586_001795 3300053145 Bacteria 4652
319 Ga0500636_0197819 3300053177 Bacteria 1066

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046492 Ga0495585_0064454 Ga0495585_0064454_1261_1887 194
2 3300003322 rootL2_10023251 rootL2_100232512 199
3 3300046528 Ga0495642_0086693 Ga0495642_0086693_571_1251 203
4 3300047443 Ga0495687_009901 Ga0495687_009901_3360_4064 203
5 iso_pu_bacteria 2857558681 2857563504 203
6 3300046474 Ga0495605_0000041 Ga0495605_0000041_54370_55053 204
7 3300046558 Ga0495633_0026733 Ga0495633_0026733_721_1404 205
8 3300046616 Ga0495668_0000219 Ga0495668_0000219_58058_58741 205
9 3300046616 Ga0495668_0193636 Ga0495668_0193636_18_710 205
10 3300047472 Ga0495686_0007778 Ga0495686_0007778_3636_4319 205
11 3300013308 Ga0157375_11365567 Ga0157375_113655672 206
12 3300046491 Ga0495584_0000972 Ga0495584_0000972_12237_12917 207
13 3300046492 Ga0495585_0090584 Ga0495585_0090584_359_1039 207
14 3300046501 Ga0495607_0082710 Ga0495607_0082710_370_1050 207
15 3300046512 Ga0495610_0033608 Ga0495610_0033608_675_1355 207
16 3300046513 Ga0495616_0008112 Ga0495616_0008112_2258_2938 207
17 3300046558 Ga0495633_0000472 Ga0495633_0000472_27478_28155 207
18 3300046558 Ga0495633_0014355 Ga0495633_0014355_3086_3766 207
19 3300046665 Ga0495661_0069664 Ga0495661_0069664_391_1071 207
20 3300046691 Ga0495670_0033134 Ga0495670_0033134_124_804 207
21 3300003771 Ga0055526_1001772 Ga0055526_100177213 208
22 3300015261 Ga0182006_1000138 Ga0182006_100013848 208
23 3300015265 Ga0182005_1000046 Ga0182005_100004648 208
24 3300025295 Ga0209564_1000028 Ga0209564_1000028420 208
25 3300046453 Ga0495627_000006 Ga0495627_000006_529173_529814 208
26 3300046471 Ga0495650_0000356 Ga0495650_0000356_54479_55162 208
27 3300046501 Ga0495607_0005783 Ga0495607_0005783_6787_7470 208
28 3300046523 Ga0495644_0006795 Ga0495644_0006795_2424_3065 208
29 3300046616 Ga0495668_0008046 Ga0495668_0008046_1658_2341 208
30 3300046810 Ga0495660_0001147 Ga0495660_0001147_7178_7819 208
31 3300046810 Ga0495660_0002698 Ga0495660_0002698_1194_1835 208
32 3300047446 Ga0495679_043479 Ga0495679_043479_430_1071 208
33 3300048910 Ga0496107_0327169 Ga0496107_0327169_356_1039 208
34 3300048919 Ga0496116_0082289 Ga0496116_0082289_635_1276 208
35 3300048927 Ga0496124_0068210 Ga0496124_0068210_1459_2100 208
36 3300049459 Ga0495678_000013 Ga0495678_000013_264228_264869 208
37 3300049766 Ga0501269_001251 Ga0501269_001251_246_926 208
38 3300053177 Ga0500636_0197819 Ga0500636_0197819_325_966 208
39 3300030744 Ga0316181_1231410 Ga0316181_12314105 209
40 3300046512 Ga0495610_0034538 Ga0495610_0034538_1315_1995 209
41 3300048906 Ga0496103_0020922 Ga0496103_0020922_1454_2134 209
42 3300048917 Ga0496114_0291035 Ga0496114_0291035_171_851 209
43 3300046512 Ga0495610_0002889 Ga0495610_0002889_11915_12592 210
44 3300046522 Ga0495643_0000245 Ga0495643_0000245_31476_32153 210
45 3300046524 Ga0495648_0013728 Ga0495648_0013728_4828_5505 210
46 3300046660 Ga0495625_0165967 Ga0495625_0165967_567_1244 210
47 3300046694 Ga0495649_0012981 Ga0495649_0012981_1362_2039 210
48 3300047320 Ga0495672_0000431 Ga0495672_0000431_48010_48687 210
49 3300049459 Ga0495678_001534 Ga0495678_001534_15607_16284 210
50 3300046500 Ga0495596_0019052 Ga0495596_0019052_1846_2547 211
51 3300046501 Ga0495607_0001687 Ga0495607_0001687_12136_12786 211
52 3300046506 Ga0495583_0035201 Ga0495583_0035201_1033_1734 211
53 3300046507 Ga0495606_0000609 Ga0495606_0000609_12787_13437 211
54 3300046518 Ga0495631_0072420 Ga0495631_0072420_607_1308 211
55 3300046616 Ga0495668_0048489 Ga0495668_0048489_1405_2106 211
56 3300046660 Ga0495625_0260496 Ga0495625_0260496_304_993 211
57 3300047445 Ga0495677_0090268 Ga0495677_0090268_150_800 211
58 3300047470 Ga0495681_0029791 Ga0495681_0029791_667_1368 211
59 3300009036 Ga0105244_10008499 Ga0105244_100084993 212
60 3300025728 Ga0207655_1004659 Ga0207655_10046595 212
61 3300046507 Ga0495606_0000494 Ga0495606_0000494_1530_2213 212
62 3300046512 Ga0495610_0001852 Ga0495610_0001852_12109_12792 212
63 3300046524 Ga0495648_0033082 Ga0495648_0033082_1208_1885 212
64 3300046538 Ga0495609_0010503 Ga0495609_0010503_2434_3126 212
65 3300046542 Ga0495597_0002893 Ga0495597_0002893_1484_2161 212
66 3300048091 Ga0495626_0028194 Ga0495626_0028194_1264_1941 212
67 3300048927 Ga0496124_0175375 Ga0496124_0175375_583_1263 212
68 3300048927 Ga0496124_0559071 Ga0496124_0559071_24_707 212
69 iso_pu_bacteria 2821131069 2821136142 212
70 iso_pu_bacteria 2808606418 2809147434 213
71 3300046492 Ga0495585_0001416 Ga0495585_0001416_9021_9689 214
72 3300046499 Ga0495594_0006952 Ga0495594_0006952_1321_1989 214
73 3300046507 Ga0495606_0033740 Ga0495606_0033740_2569_3246 214
74 3300046648 Ga0495611_0001565 Ga0495611_0001565_1221_1889 214
75 3300046674 Ga0495588_0024158 Ga0495588_0024158_1326_1994 214
76 3300046694 Ga0495649_0095094 Ga0495649_0095094_383_1066 214
77 3300048926 Ga0496123_0182656 Ga0496123_0182656_116_793 214
78 iso_pu_bacteria 2857553236 2857556646 214
79 iso_pu_bacteria 2919476304 2919480602 214
80 3300046474 Ga0495605_0017265 Ga0495605_0017265_3129_3785 215
81 3300046491 Ga0495584_0008991 Ga0495584_0008991_1248_1904 215
82 3300046492 Ga0495585_0057244 Ga0495585_0057244_638_1294 215
83 3300046500 Ga0495596_0007681 Ga0495596_0007681_2896_3570 215
84 3300046501 Ga0495607_0002004 Ga0495607_0002004_11239_11919 215
85 3300046501 Ga0495607_0082236 Ga0495607_0082236_206_862 215
86 3300046506 Ga0495583_0000839 Ga0495583_0000839_14835_15491 215
87 3300046512 Ga0495610_0043411 Ga0495610_0043411_174_836 215
88 3300046513 Ga0495616_0002053 Ga0495616_0002053_3152_3808 215
89 3300046513 Ga0495616_0026777 Ga0495616_0026777_1197_1877 215
90 3300046518 Ga0495631_0003796 Ga0495631_0003796_1347_2003 215
91 3300046518 Ga0495631_0006084 Ga0495631_0006084_854_1528 215
92 3300046519 Ga0495632_0001304 Ga0495632_0001304_15317_15997 215
93 3300046519 Ga0495632_0023622 Ga0495632_0023622_1225_1881 215
94 3300046519 Ga0495632_0083850 Ga0495632_0083850_511_1167 215
95 3300046520 Ga0495637_0001558 Ga0495637_0001558_1678_2340 215
96 3300046522 Ga0495643_0010788 Ga0495643_0010788_930_1586 215
97 3300046523 Ga0495644_0001901 Ga0495644_0001901_1798_2454 215
98 3300046528 Ga0495642_0000707 Ga0495642_0000707_11892_12566 215
99 3300046528 Ga0495642_0060277 Ga0495642_0060277_153_809 215
100 3300046538 Ga0495609_0049533 Ga0495609_0049533_765_1421 215
101 3300046542 Ga0495597_0039564 Ga0495597_0039564_1154_1810 215
102 3300046558 Ga0495633_0003462 Ga0495633_0003462_8315_8977 215
103 3300046558 Ga0495633_0010130 Ga0495633_0010130_1037_1693 215
104 3300046615 Ga0495656_0057824 Ga0495656_0057824_151_825 215
105 3300046615 Ga0495656_0101542 Ga0495656_0101542_313_969 215
106 3300046616 Ga0495668_0149137 Ga0495668_0149137_119_775 215
107 3300046648 Ga0495611_0006807 Ga0495611_0006807_3563_4219 215
108 3300046665 Ga0495661_0004087 Ga0495661_0004087_4294_4974 215
109 3300046665 Ga0495661_0095687 Ga0495661_0095687_154_810 215
110 3300046684 Ga0495669_0005123 Ga0495669_0005123_916_1590 215
111 3300046691 Ga0495670_0104539 Ga0495670_0104539_338_994 215
112 3300046692 Ga0495671_0000609 Ga0495671_0000609_9610_10284 215
113 3300046692 Ga0495671_0202243 Ga0495671_0202243_271_927 215
114 3300046694 Ga0495649_0003103 Ga0495649_0003103_9433_10089 215
115 3300046694 Ga0495649_0013776 Ga0495649_0013776_3371_4027 215
116 3300046794 Ga0495589_0018234 Ga0495589_0018234_1131_1787 215
117 3300046794 Ga0495589_0049135 Ga0495589_0049135_1288_1962 215
118 3300046810 Ga0495660_0017542 Ga0495660_0017542_1319_1975 215
119 3300047323 Ga0495683_0055512 Ga0495683_0055512_858_1514 215
120 3300047323 Ga0495683_0073443 Ga0495683_0073443_164_826 215
121 3300047445 Ga0495677_0001426 Ga0495677_0001426_4692_5372 215
122 3300047445 Ga0495677_0001516 Ga0495677_0001516_3350_4006 215
123 3300047445 Ga0495677_0016413 Ga0495677_0016413_598_1254 215
124 3300047446 Ga0495679_003276 Ga0495679_003276_6566_7222 215
125 3300047469 Ga0495673_0000074 Ga0495673_0000074_150982_151644 215
126 3300047470 Ga0495681_0001763 Ga0495681_0001763_2257_2913 215
127 3300048091 Ga0495626_0068753 Ga0495626_0068753_323_979 215
128 3300048913 Ga0496110_0396095 Ga0496110_0396095_525_1187 215
129 3300049459 Ga0495678_004469 Ga0495678_004469_6218_6874 215
130 3300053145 Ga0500586_001795 Ga0500586_001795_1387_2049 215
131 iso_pu_bacteria 2600255292 2601671903 215
132 iso_pu_bacteria 2842711865 2842717837 215
133 iso_pu_bacteria 2857547612 2857552265 215
134 iso_pu_bacteria 2904424332 2904429653 215
135 iso_pu_bacteria 2932410948 2932415093 215
136 iso_pu_bacteria 2932416698 2932421259 215
137 3300003775 Ga0055524_1000022 Ga0055524_100002250 216
138 3300005262 Ga0065165_1027554 Ga0065165_10275543 216
139 3300006051 Ga0075364_10435820 Ga0075364_104358201 216
140 3300006948 Ga0099826_10000006 Ga0099826_10000006365 216
141 3300009036 Ga0105244_10005151 Ga0105244_100051513 216
142 3300025299 Ga0209256_1000035 Ga0209256_100003550 216
143 3300025728 Ga0207655_1003180 Ga0207655_100318011 216
144 3300027666 Ga0209282_1000003 Ga0209282_100000311 216
145 3300046457 Ga0495590_0014991 Ga0495590_0014991_530_1204 216
146 3300046460 Ga0495638_0049829 Ga0495638_0049829_501_1175 216
147 3300046474 Ga0495605_0057915 Ga0495605_0057915_325_999 216
148 3300046506 Ga0495583_0005535 Ga0495583_0005535_3273_3947 216
149 3300046506 Ga0495583_0150401 Ga0495583_0150401_165_839 216
150 3300046507 Ga0495606_0000169 Ga0495606_0000169_16031_16705 216
151 3300046507 Ga0495606_0187186 Ga0495606_0187186_241_918 216
152 3300046513 Ga0495616_0038165 Ga0495616_0038165_1404_2078 216
153 3300046513 Ga0495616_0169445 Ga0495616_0169445_186_863 216
154 3300046518 Ga0495631_0003758 Ga0495631_0003758_1416_2090 216
155 3300046520 Ga0495637_0071533 Ga0495637_0071533_392_1066 216
156 3300046524 Ga0495648_0011106 Ga0495648_0011106_2374_3048 216
157 3300046524 Ga0495648_0050604 Ga0495648_0050604_1313_1987 216
158 3300046530 Ga0495654_0006998 Ga0495654_0006998_5483_6157 216
159 3300046542 Ga0495597_0008536 Ga0495597_0008536_3310_3984 216
160 3300046542 Ga0495597_0018660 Ga0495597_0018660_458_1135 216
161 3300046616 Ga0495668_0004052 Ga0495668_0004052_9484_10158 216
162 3300046660 Ga0495625_0025809 Ga0495625_0025809_1671_2345 216
163 3300046692 Ga0495671_0109640 Ga0495671_0109640_204_878 216
164 3300046694 Ga0495649_0035937 Ga0495649_0035937_1387_2052 216
165 3300046794 Ga0495589_0001945 Ga0495589_0001945_9444_10121 216
166 3300046810 Ga0495660_0026381 Ga0495660_0026381_1896_2570 216
167 3300047443 Ga0495687_000917 Ga0495687_000917_20593_21270 216
168 3300047443 Ga0495687_146055 Ga0495687_146055_62_739 216
169 3300047446 Ga0495679_049124 Ga0495679_049124_375_1049 216
170 3300047472 Ga0495686_0246598 Ga0495686_0246598_214_888 216
171 3300048090 Ga0495615_0089205 Ga0495615_0089205_156_824 216
172 3300048091 Ga0495626_0096622 Ga0495626_0096622_214_888 216
173 3300048921 Ga0496118_0084408 Ga0496118_0084408_372_1046 216
174 3300048924 Ga0496121_0055216 Ga0496121_0055216_1084_1749 216
175 3300048926 Ga0496123_0003832 Ga0496123_0003832_7312_7986 216
176 3300048929 Ga0496126_0100605 Ga0496126_0100605_354_1028 216
177 3300049459 Ga0495678_003140 Ga0495678_003140_9524_10198 216
178 3300049537 Ga0501321_015632 Ga0501321_015632_52_732 216
179 3300049539 Ga0501323_034414 Ga0501323_034414_24_710 216
180 3300049671 Ga0501238_003667 Ga0501238_003667_330_995 216
181 3300053125 Ga0500618_030571 Ga0500618_030571_223_897 216
182 3300046474 Ga0495605_0009371 Ga0495605_0009371_1507_2190 217
183 3300046500 Ga0495596_0002418 Ga0495596_0002418_6516_7199 217
184 3300046520 Ga0495637_0113136 Ga0495637_0113136_37_720 217
185 3300046524 Ga0495648_0009089 Ga0495648_0009089_6726_7409 217
186 3300046538 Ga0495609_0005176 Ga0495609_0005176_4723_5406 217
187 3300046794 Ga0495589_0019398 Ga0495589_0019398_1924_2607 217
188 3300046810 Ga0495660_0136668 Ga0495660_0136668_136_819 217
189 3300047320 Ga0495672_0001709 Ga0495672_0001709_7270_7953 217
190 3300047323 Ga0495683_0002282 Ga0495683_0002282_1509_2192 217
191 3300048908 Ga0496105_0349454 Ga0496105_0349454_228_893 217
192 3300003771 Ga0055526_1001365 Ga0055526_10013653 218
193 3300006946 Ga0079104_1016367 Ga0079104_10163671 218
194 3300025246 Ga0209646_1000120 Ga0209646_100012092 218
195 3300025295 Ga0209564_1000154 Ga0209564_1000154102 218
196 3300027111 Ga0209281_1012657 Ga0209281_10126572 218
197 3300037418 Ga0395900_0397946 Ga0395900_0397946_564_1241 218
198 3300046452 Ga0495617_001118 Ga0495617_001118_2670_3341 218
199 3300046453 Ga0495627_001231 Ga0495627_001231_9383_10075 218
200 3300046457 Ga0495590_0000022 Ga0495590_0000022_143977_144648 218
201 3300046460 Ga0495638_0000099 Ga0495638_0000099_51346_52017 218
202 3300046471 Ga0495650_0002354 Ga0495650_0002354_1718_2389 218
203 3300046475 Ga0495639_0007054 Ga0495639_0007054_3882_4553 218
204 3300046501 Ga0495607_0191271 Ga0495607_0191271_190_861 218
205 3300046506 Ga0495583_0000220 Ga0495583_0000220_82814_83485 218
206 3300046507 Ga0495606_0001166 Ga0495606_0001166_12933_13604 218
207 3300046507 Ga0495606_0344810 Ga0495606_0344810_60_731 218
208 3300046512 Ga0495610_0003861 Ga0495610_0003861_9272_9943 218
209 3300046522 Ga0495643_0002014 Ga0495643_0002014_14636_15307 218
210 3300046524 Ga0495648_0000004 Ga0495648_0000004_319821_320492 218
211 3300046528 Ga0495642_0011486 Ga0495642_0011486_994_1665 218
212 3300046538 Ga0495609_0001551 Ga0495609_0001551_1437_2108 218
213 3300046538 Ga0495609_0073190 Ga0495609_0073190_318_989 218
214 3300046542 Ga0495597_0000563 Ga0495597_0000563_14690_15361 218
215 3300046557 Ga0495622_0000157 Ga0495622_0000157_12926_13597 218
216 3300046558 Ga0495633_0000327 Ga0495633_0000327_51344_52015 218
217 3300046616 Ga0495668_0000333 Ga0495668_0000333_50760_51431 218
218 3300046660 Ga0495625_0000412 Ga0495625_0000412_51333_52004 218
219 3300046691 Ga0495670_0080915 Ga0495670_0080915_152_823 218
220 3300046692 Ga0495671_0051290 Ga0495671_0051290_1014_1685 218
221 3300046694 Ga0495649_0063720 Ga0495649_0063720_1216_1887 218
222 3300046694 Ga0495649_0073705 Ga0495649_0073705_84_755 218
223 3300046810 Ga0495660_0036461 Ga0495660_0036461_823_1494 218
224 3300047443 Ga0495687_002375 Ga0495687_002375_12737_13408 218
225 3300047443 Ga0495687_007174 Ga0495687_007174_1797_2468 218
226 3300047470 Ga0495681_0000642 Ga0495681_0000642_15213_15884 218
227 3300047472 Ga0495686_0021324 Ga0495686_0021324_2340_3032 218
228 3300048927 Ga0496124_0088932 Ga0496124_0088932_519_1196 218
229 3300053118 Ga0500594_0050002 Ga0500594_0050002_176_847 218
230 3300003323 rootH1_10202298 rootH1_102022981 219
231 3300003763 Ga0055529_1000027 Ga0055529_100002774 219
232 3300017792 Ga0163161_10004787 Ga0163161_1000478710 219
233 3300021361 Ga0213872_10000065 Ga0213872_1000006550 219
234 3300021361 Ga0213872_10001325 Ga0213872_1000132514 219
235 3300021361 Ga0213872_10008754 Ga0213872_100087543 219
236 3300025233 Ga0209437_119840 Ga0209437_1198401 219
237 3300025245 Ga0207425_1004461 Ga0207425_10044612 219
238 3300025272 Ga0209455_1000033 Ga0209455_1000033370 219
239 3300025294 Ga0209025_1004990 Ga0209025_10049905 219
240 3300025297 Ga0209758_1000354 Ga0209758_100035448 219
241 3300032005 Ga0307411_10953029 Ga0307411_109530291 219
242 3300039447 Ga0436361_0094991 Ga0436361_0094991_16155_16832 219
243 3300039447 Ga0436361_0247969 Ga0436361_0247969_471_1148 219
244 3300039447 Ga0436361_0283126 Ga0436361_0283126_593_1270 219
245 3300039447 Ga0436361_0584638 Ga0436361_0584638_665_1342 219
246 3300039447 Ga0436361_0900144 Ga0436361_0900144_140335_141012 219
247 3300046460 Ga0495638_0064673 Ga0495638_0064673_446_1123 219
248 3300046471 Ga0495650_0001404 Ga0495650_0001404_12167_12841 219
249 3300046507 Ga0495606_0004324 Ga0495606_0004324_12006_12689 219
250 3300046530 Ga0495654_0074553 Ga0495654_0074553_418_1089 219
251 3300046542 Ga0495597_0001057 Ga0495597_0001057_5322_5999 219
252 3300046557 Ga0495622_0000500 Ga0495622_0000500_13095_13778 219
253 3300046558 Ga0495633_0003329 Ga0495633_0003329_1698_2369 219
254 3300046558 Ga0495633_0018291 Ga0495633_0018291_1948_2628 219
255 3300046660 Ga0495625_0000821 Ga0495625_0000821_40766_41440 219
256 3300046660 Ga0495625_0008334 Ga0495625_0008334_559_1236 219
257 3300046660 Ga0495625_0027110 Ga0495625_0027110_1967_2653 219
258 3300048913 Ga0496110_0170190 Ga0496110_0170190_134_811 219
259 3300048927 Ga0496124_0104723 Ga0496124_0104723_1202_1876 219
260 3300049460 Ga0495682_0005422 Ga0495682_0005422_4132_4803 219
261 3300046460 Ga0495638_0000354 Ga0495638_0000354_48607_49287 220
262 3300046474 Ga0495605_0000614 Ga0495605_0000614_9893_10573 220
263 3300046492 Ga0495585_0033882 Ga0495585_0033882_1412_2092 220
264 3300046492 Ga0495585_0139290 Ga0495585_0139290_160_840 220
265 3300046501 Ga0495607_0008758 Ga0495607_0008758_217_897 220
266 3300046501 Ga0495607_0028840 Ga0495607_0028840_475_1155 220
267 3300046506 Ga0495583_0000063 Ga0495583_0000063_34978_35658 220
268 3300046513 Ga0495616_0029470 Ga0495616_0029470_1361_2041 220
269 3300046523 Ga0495644_0003440 Ga0495644_0003440_302_982 220
270 3300046523 Ga0495644_0004210 Ga0495644_0004210_4870_5550 220
271 3300046524 Ga0495648_0004096 Ga0495648_0004096_7415_8095 220
272 3300046538 Ga0495609_0002738 Ga0495609_0002738_767_1447 220
273 3300046558 Ga0495633_0013903 Ga0495633_0013903_3144_3824 220
274 3300046615 Ga0495656_0014463 Ga0495656_0014463_1620_2300 220
275 3300046648 Ga0495611_0002679 Ga0495611_0002679_3535_4215 220
276 3300046648 Ga0495611_0004039 Ga0495611_0004039_1912_2592 220
277 3300046660 Ga0495625_0034727 Ga0495625_0034727_2738_3418 220
278 3300046664 Ga0495659_0001811 Ga0495659_0001811_1899_2579 220
279 3300046691 Ga0495670_0054635 Ga0495670_0054635_193_873 220
280 3300046692 Ga0495671_0006883 Ga0495671_0006883_3735_4415 220
281 3300047318 Ga0495636_0000972 Ga0495636_0000972_7965_8645 220
282 3300047320 Ga0495672_0001925 Ga0495672_0001925_9632_10321 220
283 3300047320 Ga0495672_0010140 Ga0495672_0010140_1965_2645 220
284 3300047323 Ga0495683_0002939 Ga0495683_0002939_2941_3621 220
285 3300047443 Ga0495687_000562 Ga0495687_000562_30628_31308 220
286 3300047445 Ga0495677_0031305 Ga0495677_0031305_928_1608 220
287 3300047445 Ga0495677_0079285 Ga0495677_0079285_179_859 220
288 3300047447 Ga0495685_000345 Ga0495685_000345_13523_14203 220
289 3300047469 Ga0495673_0020003 Ga0495673_0020003_2205_2885 220
290 3300048905 Ga0496102_0000097 Ga0496102_0000097_39523_40197 220
291 3300048906 Ga0496103_0046644 Ga0496103_0046644_1386_2060 220
292 3300049459 Ga0495678_003481 Ga0495678_003481_7801_8481 220
293 3300049460 Ga0495682_0001101 Ga0495682_0001101_9612_10292 220
294 3300049460 Ga0495682_0002294 Ga0495682_0002294_2440_3120 220
295 3300013307 Ga0157372_10167979 Ga0157372_101679793 221
296 3300025909 Ga0207705_10352718 Ga0207705_103527182 221
297 3300025933 Ga0207706_10326987 Ga0207706_103269872 221
298 3300046519 Ga0495632_0000280 Ga0495632_0000280_36166_36882 221
299 3300046525 Ga0495663_0002068 Ga0495663_0002068_4849_5514 221
300 3300046526 Ga0495666_0002294 Ga0495666_0002294_7825_8520 221
301 3300046528 Ga0495642_0057247 Ga0495642_0057247_636_1301 221
302 3300046531 Ga0495665_0027345 Ga0495665_0027345_655_1350 221
303 3300046558 Ga0495633_0088055 Ga0495633_0088055_113_781 221
304 3300046615 Ga0495656_0037727 Ga0495656_0037727_1105_1773 221
305 3300046665 Ga0495661_0041814 Ga0495661_0041814_1267_1983 221
306 3300046679 Ga0495623_0067680 Ga0495623_0067680_922_1617 221
307 3300047317 Ga0495604_0253921 Ga0495604_0253921_32_727 221
308 3300047444 Ga0495675_0079103 Ga0495675_0079103_413_1108 221
309 3300047447 Ga0495685_015044 Ga0495685_015044_524_1189 221
310 3300002739 JGI25158J39367_1017419 JGI25158J39367_10174191 222
311 3300002987 JGI25159J45721_1003176 JGI25159J45721_10031763 222
312 3300003374 JGI25161J50226_1001671 JGI25161J50226_10016713 222
313 3300004625 Ga0055543_1001989 Ga0055543_10019893 222
314 3300005262 Ga0065165_1006296 Ga0065165_10062963 222
315 3300025208 Ga0209436_102296 Ga0209436_1022965 222
316 3300025284 Ga0209130_1001299 Ga0209130_100129916 222
317 3300032002 Ga0307416_100001560 Ga0307416_1000015608 222
318 3300046473 Ga0495582_0093499 Ga0495582_0093499_110_781 222
319 3300046492 Ga0495585_0007138 Ga0495585_0007138_1984_2670 222
320 3300046492 Ga0495585_0030245 Ga0495585_0030245_1964_2635 222
321 3300046499 Ga0495594_0001996 Ga0495594_0001996_202_888 222
322 3300046518 Ga0495631_0025860 Ga0495631_0025860_583_1269 222
323 3300046526 Ga0495666_0040784 Ga0495666_0040784_866_1537 222
324 3300046557 Ga0495622_0011242 Ga0495622_0011242_1141_1812 222
325 3300046691 Ga0495670_0128019 Ga0495670_0128019_396_1082 222
326 3300046810 Ga0495660_0013887 Ga0495660_0013887_2080_2760 222
327 3300047318 Ga0495636_0140198 Ga0495636_0140198_106_792 222
328 3300047321 Ga0495676_0018280 Ga0495676_0018280_4496_5167 222
329 3300047445 Ga0495677_0018611 Ga0495677_0018611_107_793 222
330 3300049775 Ga0501279_001091 Ga0501279_001091_1289_1957 222

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00085

Thioredoxin

Thioredoxin

49

105

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zl7-assembly1.cif.gz_A crystal structure of pseudomonas aeruginosa dsba e82i: crystal i 0.9512 26 219
7luj-assembly3.cif.gz_C burkholderia pseudomallei disulfide bond forming protein a (dsba) liganded with fragment 4-methoxy-n-phenylbenzenesulfonamide 0.9478 25 222
7luj-assembly3.cif.gz_C burkholderia pseudomallei disulfide bond forming protein a (dsba) liganded with fragment 4-methoxy-n-phenylbenzenesulfonamide 0.9429 25 222
5vyo-assembly4.cif.gz_D the complex structure of burkholderia pseudomallei dsba bound to a peptide 0.942 25 222
3h93-assembly1.cif.gz_A crystal structure of pseudomonas aeruginosa dsba 0.9372 26 220
ID Description Score Start End Superfamily
5vyoC00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9445 24 222 3.40.30.10
af_E9QGM3_60_256_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9402 42 85 3.40.30.10
3hd5C01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9385 39 180 3.40.30.10
4p3yB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9329 27 218 3.40.30.10
5vyoC00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9301 24 222 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A257MY75-F1-model_v4 Thiol:disulfide interchange protein DsbA 0.96 39 220 GO:0015036
GO:0042597
AF-A0A2N1WN08-F1-model_v4 deleted 0.9599 46 220
AF-A0A258QIY5-F1-model_v4 Thiol:disulfide interchange protein DsbA 0.9563 35 221 GO:0015036
GO:0042597
AF-T0YD57-F1-model_v4 Thiol:disulfide interchange protein DsbA 0.9538 21 221 GO:0016491
GO:0042597
AF-A0A7X8D6R9-F1-model_v4 Thiol:disulfide interchange protein DsbA 0.9529 45 217 GO:0016491
GO:0042597

Feature Viewer

pLDDT pTM Quality
91.25 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map