F410226

General Info

Members Datasets Scaffolds Average Seq Length
330 218 644 197

Family's Representative Sequence

Representative Sequence 3300046511|Ga0495608_0505896|Ga0495608_0505896_19_708
Length 229
Sequence LNFYKPEGPGGDKIGANTQPRPKGELVGAVIMHNVVSVDGFIADEHDDVGPLHEWYFSGDTPITDSGDPKFDHSGAGSAFRVSRTSAEYVRSMWESIGTIVMGRHLFDLVNGWEGQPPAGDHVVVVSHRPKPAGWHPEASYHFVDDATAAIAKAQDLAGERTVALNAGDVGSQIFAAGLVDEVAMDVVPVVFGSGKRYFAGIEGQHLLDDPHVVIQGDRVLHLRFKVRR

Samples

Sample ID Description Type Environment
1 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
37 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
41 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
61 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
62 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
64 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
92 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
93 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
94 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
95 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
96 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
97 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
98 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
99 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
100 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
101 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
102 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
103 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
104 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
105 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
106 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
107 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
108 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
109 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
110 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
111 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
112 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
113 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
114 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
115 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
116 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
117 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
118 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
119 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
120 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
121 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
122 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
123 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
124 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
125 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
126 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
127 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
128 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
129 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
130 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
131 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
132 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
133 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
134 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
135 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
136 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
137 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
138 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
139 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
140 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
141 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
142 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
143 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
144 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
145 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
146 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
147 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
148 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
149 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
150 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
151 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
152 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
153 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
154 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
155 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
156 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
157 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
158 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
159 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
160 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
161 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
162 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
163 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
164 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
165 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
166 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
167 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
168 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
169 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
170 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
171 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
172 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
173 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
174 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
175 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
176 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
177 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
178 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
179 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
180 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
190 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
191 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
192 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
193 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
194 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
195 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
196 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
197 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
198 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
199 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
200 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
201 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
202 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
203 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
204 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
205 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
206 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
207 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
208 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
209 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
210 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
211 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
212 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
213 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
214 2862574272 Streptomyces sp. AcE210 Isolate Nodule
215 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
216 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
217 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
218 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.36
Metatranscriptomes 0.91
Isolates 2.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.94
Nodule 0.91
Rhizoplane 4.55
Rhizosphere 81.82
Stem 0
Stem Tuber 0
Unclassified 2.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495608_0505896 3300046511 Bacteria 731
2 JGI24737J22298_10108167 3300001990 Bacteria 823
3 JGI25406J46586_10056794 3300003203 Bacteria 1282
4 JGI25160J50197_1030656 3300003354 Bacteria 1397
5 Ga0070658_10139271 3300005327 Bacteria 2026
6 Ga0070666_10063309 3300005335 Bacteria 2507
7 Ga0070682_100215009 3300005337 Bacteria 1365
8 Ga0070660_100053980 3300005339 Bacteria 3101
9 Ga0070691_10011690 3300005341 Bacteria 4015
10 Ga0070668_100012278 3300005347 Bacteria 6383
11 Ga0070671_100044907 3300005355 Unclassified 3672
12 Ga0070674_100140212 3300005356 Bacteria 1814
13 Ga0070673_100161746 3300005364 Bacteria 1905
14 Ga0070659_100319313 3300005366 Bacteria 1298
15 Ga0070659_100462449 3300005366 Bacteria 1077
16 Ga0070667_100457274 3300005367 Bacteria 1167
17 Ga0070709_10060584 3300005434 Bacteria 2406
18 Ga0070709_10087207 3300005434 Bacteria 2050
19 Ga0070714_100455658 3300005435 Bacteria 1215
20 Ga0070714_100462734 3300005435 Bacteria 1206
21 Ga0070713_100007343 3300005436 Bacteria 7726
22 Ga0070713_100321866 3300005436 Bacteria 1428
23 Ga0070710_10003952 3300005437 Bacteria 7026
24 Ga0070701_10019437 3300005438 Bacteria 3208
25 Ga0070711_100087451 3300005439 Bacteria 2237
26 Ga0070711_100192778 3300005439 Unclassified 1567
27 Ga0070700_100436742 3300005441 Bacteria 993
28 Ga0070663_100178775 3300005455 Unclassified 1644
29 Ga0070662_100015470 3300005457 Bacteria 5112
30 Ga0068867_100215664 3300005459 Bacteria 1544
31 Ga0070684_100174319 3300005535 Bacteria 1954
32 Ga0070686_100674780 3300005544 Bacteria 822
33 Ga0070665_100408607 3300005548 Bacteria 1366
34 Ga0068855_100114458 3300005563 Bacteria 3092
35 Ga0068854_100165206 3300005578 Bacteria 1718
36 Ga0068856_100621738 3300005614 Bacteria 1101
37 Ga0068858_100031978 3300005842 Bacteria 4888
38 Ga0068860_100394621 3300005843 Bacteria 1368
39 Ga0068862_100039172 3300005844 Bacteria 4024
40 Ga0081455_10003265 3300005937 Bacteria 18762
41 Ga0081538_10023747 3300005981 Bacteria 4397
42 Ga0081538_10081451 3300005981 Bacteria 1721
43 Ga0081540_1006493 3300005983 Bacteria 8502
44 Ga0081539_10003558 3300005985 Bacteria 18920
45 Ga0081539_10005681 3300005985 Bacteria 12515
46 Ga0070717_10444079 3300006028 Bacteria 1168
47 Ga0070717_10629635 3300006028 Bacteria 973
48 Ga0075365_10026641 3300006038 Bacteria 3671
49 Ga0075365_10625418 3300006038 Bacteria 761
50 Ga0075363_100035400 3300006048 Bacteria 2613
51 Ga0075364_10246564 3300006051 Bacteria 1214
52 Ga0097621_100799941 3300006237 Bacteria 874
53 Ga0068871_100485753 3300006358 Bacteria 1111
54 Ga0075434_101277939 3300006871 Bacteria 745
55 Ga0068865_100585816 3300006881 Bacteria 941
56 Ga0099826_10095837 3300006948 Bacteria 1803
57 Ga0105245_10584667 3300009098 Bacteria 1141
58 Ga0105247_10059298 3300009101 Bacteria 2369
59 Ga0105248_10023626 3300009177 Bacteria 6830
60 Ga0105237_10251816 3300009545 Unclassified 1768
61 Ga0105238_10024488 3300009551 Bacteria 6152
62 Ga0157374_10013469 3300013296 Bacteria 7136
63 Ga0157378_10136636 3300013297 Bacteria 2273
64 Ga0157375_10018346 3300013308 Bacteria 6344
65 Ga0163163_10122291 3300014325 Bacteria 2637
66 Ga0157379_10360486 3300014968 Bacteria 1332
67 Ga0206356_10319455 3300020070 Bacteria 1185
68 Ga0206353_11234140 3300020082 Bacteria 1758
69 Ga0213873_10123342 3300021358 Bacteria 762
70 Ga0213875_10020496 3300021388 Bacteria 3172
71 Ga0213875_10026328 3300021388 Bacteria 2767
72 Ga0213875_10047855 3300021388 Bacteria 2006
73 Ga0213875_10148225 3300021388 Bacteria 1099
74 Ga0224712_10018831 3300022467 Bacteria 2316
75 Ga0207426_1030423 3300025302 Bacteria 1770
76 Ga0207692_10085014 3300025898 Bacteria 1701
77 Ga0207692_10199733 3300025898 Bacteria 1175
78 Ga0207710_10040003 3300025900 Bacteria 2077
79 Ga0207680_10320663 3300025903 Bacteria 1083
80 Ga0207685_10023637 3300025905 Bacteria 2095
81 Ga0207699_10137986 3300025906 Bacteria 1599
82 Ga0207693_10015049 3300025915 Bacteria 6210
83 Ga0207693_10780893 3300025915 Bacteria 737
84 Ga0207694_10105967 3300025924 Bacteria 2232
85 Ga0207687_10498345 3300025927 Bacteria 1016
86 Ga0207700_10042401 3300025928 Bacteria 3336
87 Ga0207700_10103672 3300025928 Bacteria 2274
88 Ga0207706_10055452 3300025933 Bacteria 3495
89 Ga0207669_10113979 3300025937 Bacteria 1819
90 Ga0207704_10158331 3300025938 Bacteria 1608
91 Ga0207665_10005660 3300025939 Bacteria 8324
92 Ga0207665_10010308 3300025939 Bacteria 6136
93 Ga0207691_10298870 3300025940 Bacteria 1383
94 Ga0207691_10367528 3300025940 Bacteria 1229
95 Ga0207711_10014254 3300025941 Bacteria 6603
96 Ga0207689_10127912 3300025942 Bacteria 2089
97 Ga0207651_10091045 3300025960 Bacteria 2232
98 Ga0207677_10840447 3300026023 Bacteria 824
99 Ga0207703_10447115 3300026035 Bacteria 1206
100 Ga0207639_10594926 3300026041 Bacteria 1019
101 Ga0207678_10009473 3300026067 Bacteria 8567
102 Ga0207678_10111837 3300026067 Bacteria 2330
103 Ga0207708_10159202 3300026075 Unclassified 1782
104 Ga0207702_10134181 3300026078 Bacteria 2232
105 Ga0207702_10134344 3300026078 Bacteria 2230
106 Ga0207702_10641749 3300026078 Bacteria 1044
107 Ga0207675_100071056 3300026118 Bacteria 3254
108 Ga0207698_10258507 3300026142 Bacteria 1598
109 Ga0268266_10228475 3300028379 Bacteria 1713
110 Ga0268264_10346904 3300028381 Bacteria 1412
111 Ga0307516_10003823 3300031730 Bacteria 19076
112 Ga0307518_10046397 3300031838 Bacteria 3159
113 Ga0307518_10221482 3300031838 Bacteria 1234
114 Ga0307416_101703134 3300032002 Bacteria 735
115 Ga0373926_0002014 3300035083 Bacteria 6386
116 Ga0373934_0265487 3300035086 Bacteria 710
117 Ga0373944_0001102 3300035089 Bacteria 6712
118 Ga0373923_0009614 3300035111 Bacteria 3496
119 Ga0373923_0034931 3300035111 Bacteria 2043
120 Ga0373936_0000339 3300035113 Bacteria 15811
121 Ga0373936_0000860 3300035113 Bacteria 10832
122 Ga0373936_0013580 3300035113 Bacteria 3108
123 Ga0373939_0006874 3300035114 Bacteria 2751
124 Ga0373945_0000025 3300035116 Bacteria 30315
125 Ga0373943_0000113 3300035170 Bacteria 30117
126 Ga0373946_0000290 3300035171 Bacteria 16153
127 Ga0373946_0000755 3300035171 Bacteria 10997
128 Ga0373955_0035995 3300035172 Bacteria 2625
129 Ga0373924_0007428 3300035410 Bacteria 3958
130 Ga0373924_0055712 3300035410 Bacteria 1645
131 Ga0373935_0000080 3300035692 Bacteria 41767
132 Ga0373927_0000888 3300035695 Bacteria 22761
133 Ga0373933_0076199 3300035724 Bacteria 2048
134 Ga0373933_0079942 3300035724 Bacteria 2003
135 Ga0373947_0001060 3300035725 Bacteria 16805
136 Ga0373937_0157611 3300036401 Bacteria 2128
137 Ga0373937_0335535 3300036401 Bacteria 1431
138 Ga0373937_0425608 3300036401 Bacteria 1260
139 Ga0373925_0002755 3300037068 Bacteria 13906
140 Ga0373925_0075226 3300037068 Bacteria 2558
141 Ga0373925_0199629 3300037068 Bacteria 1590
142 Ga0373925_0307248 3300037068 Bacteria 1281
143 Ga0436364_0103244 3300037853 Bacteria 1060
144 Ga0436364_0375547 3300037853 Bacteria 3847
145 Ga0436364_0461844 3300037853 Bacteria 3182
146 Ga0436364_0764786 3300037853 Bacteria 1455
147 Ga0436364_0784509 3300037853 Bacteria 881
148 Ga0436364_1041488 3300037853 Bacteria 17558
149 Ga0436364_1362001 3300037853 Bacteria 1597
150 Ga0436365_0589192 3300039437 Bacteria 1241
151 Ga0436365_0751232 3300039437 Bacteria 707
152 Ga0436365_1185618 3300039437 Bacteria 39779
153 Ga0436365_1642417 3300039437 Bacteria 50776
154 Ga0436363_0064810 3300039450 Bacteria 4479
155 Ga0436363_0197518 3300039450 Bacteria 705
156 Ga0436363_0374874 3300039450 Bacteria 2375
157 Ga0436363_0669790 3300039450 Bacteria 1059
158 Ga0436363_1460400 3300039450 Bacteria 812
159 Ga0436362_0045169 3300039453 Bacteria 2039
160 Ga0436362_1205237 3300039453 Bacteria 1406
161 Ga0439461_0083870 3300041410 Bacteria 755
162 Ga0439465_0041961 3300041413 Bacteria 1482
163 Ga0451795_0899820 3300041456 Bacteria 1191
164 Ga0451853_0810003 3300041512 Bacteria 2828
165 Ga0439431_0003708 3300041997 Bacteria 3376
166 Ga0439434_0008093 3300042435 Bacteria 3083
167 Ga0466969_0246131 3300044656 Bacteria 811
168 Ga0466966_0132467 3300044684 Unclassified 1526
169 Ga0466961_0236262 3300044693 Unclassified 1124
170 Ga0466963_0013237 3300044694 Bacteria 5063
171 Ga0466963_0038449 3300044694 Bacteria 3129
172 Ga0466963_0059074 3300044694 Bacteria 2559
173 Ga0466957_0117366 3300044842 Bacteria 1694
174 Ga0466960_0103450 3300044901 Bacteria 1470
175 Ga0466958_0700914 3300045836 Bacteria 659
176 Ga0466967_0011486 3300045976 Bacteria 6712
177 Ga0466967_0122429 3300045976 Bacteria 2406
178 Ga0466967_1273168 3300045976 Unclassified 732
179 Ga0495617_089231 3300046452 Bacteria 1007
180 Ga0495603_0039868 3300046455 Bacteria 2812
181 Ga0495641_0001478 3300046461 Bacteria 19970
182 Ga0495651_0061298 3300046462 Bacteria 2879
183 Ga0495653_0001040 3300046463 Bacteria 21353
184 Ga0495653_0323066 3300046463 Bacteria 1000
185 Ga0495653_0627655 3300046463 Bacteria 658
186 Ga0495582_0009822 3300046473 Bacteria 5271
187 Ga0495639_0061411 3300046475 Bacteria 1723
188 Ga0495639_0113896 3300046475 Bacteria 1285
189 Ga0495662_0049002 3300046476 Bacteria 2040
190 Ga0495662_0066120 3300046476 Bacteria 1748
191 Ga0495664_0001733 3300046477 Bacteria 11588
192 Ga0495664_0001986 3300046477 Bacteria 10902
193 Ga0495585_0086778 3300046492 Bacteria 1690
194 Ga0495594_0147418 3300046499 Bacteria 1336
195 Ga0495608_0012767 3300046511 Bacteria 5829
196 Ga0495608_0018821 3300046511 Bacteria 4758
197 Ga0495618_0038050 3300046514 Bacteria 3022
198 Ga0495618_0346267 3300046514 Bacteria 916
199 Ga0495628_0105828 3300046516 Bacteria 2167
200 Ga0495628_0145305 3300046516 Bacteria 1808
201 Ga0495630_0004355 3300046517 Bacteria 9939
202 Ga0495652_0017155 3300046529 Bacteria 6465
203 Ga0495652_0059367 3300046529 Bacteria 3236
204 Ga0495665_0003891 3300046531 Bacteria 8079
205 Ga0495665_0085741 3300046531 Bacteria 1655
206 Ga0495640_0016892 3300046533 Bacteria 5452
207 Ga0495640_0060038 3300046533 Bacteria 2587
208 Ga0495587_0066534 3300046536 Bacteria 2102
209 Ga0495645_0019606 3300046543 Bacteria 4870
210 Ga0495645_0059156 3300046543 Bacteria 2779
211 Ga0495667_0001347 3300046559 Bacteria 16127
212 Ga0495667_0005108 3300046559 Bacteria 8866
213 Ga0495667_0252403 3300046559 Bacteria 1123
214 Ga0495667_0445784 3300046559 Bacteria 813
215 Ga0495634_0002543 3300046642 Bacteria 15085
216 Ga0495634_0084233 3300046642 Bacteria 2073
217 Ga0495611_0004408 3300046648 Bacteria 6092
218 Ga0495611_0088347 3300046648 Bacteria 1431
219 Ga0495635_0000879 3300046663 Bacteria 19716
220 Ga0495635_0132977 3300046663 Bacteria 1696
221 Ga0495635_0525681 3300046663 Bacteria 777
222 Ga0495657_0009397 3300046675 Bacteria 7414
223 Ga0495657_0089782 3300046675 Bacteria 1973
224 Ga0495657_0118603 3300046675 Bacteria 1669
225 Ga0495623_0170518 3300046679 Bacteria 1272
226 Ga0495646_0018009 3300046680 Bacteria 4474
227 Ga0495624_0003528 3300046690 Bacteria 11596
228 Ga0495624_0004837 3300046690 Bacteria 9790
229 Ga0495589_0011664 3300046794 Bacteria 4561
230 Ga0495589_0020284 3300046794 Bacteria 3400
231 Ga0495600_0107819 3300046809 Bacteria 1814
232 Ga0495600_0180750 3300046809 Bacteria 1359
233 Ga0495600_0326809 3300046809 Bacteria 964
234 Ga0495581_0008954 3300047315 Bacteria 5793
235 Ga0495581_0015019 3300047315 Bacteria 4494
236 Ga0495674_0000534 3300047319 Bacteria 35124
237 Ga0495676_0006649 3300047321 Bacteria 10658
238 Ga0495676_0033694 3300047321 Bacteria 4308
239 Ga0495676_0060288 3300047321 Bacteria 2975
240 Ga0495676_0119445 3300047321 Bacteria 1920
241 Ga0495680_0002309 3300047322 Bacteria 19594
242 Ga0495680_0016163 3300047322 Bacteria 6416
243 Ga0495680_0150197 3300047322 Bacteria 1699
244 Ga0495683_0065229 3300047323 Bacteria 1797
245 Ga0495685_004383 3300047447 Bacteria 4557
246 Ga0495685_017824 3300047447 Bacteria 2433
247 Ga0495685_018585 3300047447 Bacteria 2386
248 Ga0495685_115180 3300047447 Bacteria 883
249 Ga0495684_0001682 3300047471 Bacteria 17781
250 Ga0495684_0002062 3300047471 Bacteria 16149
251 Ga0495593_0081711 3300047673 Bacteria 1671
252 Ga0495602_0138832 3300048088 Bacteria 1927
253 Ga0495602_0154203 3300048088 Bacteria 1801
254 Ga0495614_0317510 3300048089 Bacteria 722
255 Ga0496100_0188691 3300048903 Bacteria 1495
256 Ga0496102_0028026 3300048905 Bacteria 5032
257 Ga0496104_0022459 3300048907 Bacteria 5796
258 Ga0496105_0028602 3300048908 Bacteria 4558
259 Ga0496108_0098379 3300048911 Bacteria 2493
260 Ga0496108_0190630 3300048911 Bacteria 1777
261 Ga0496109_0003009 3300048912 Bacteria 14064
262 Ga0496109_0835290 3300048912 Bacteria 859
263 Ga0496109_1240209 3300048912 Bacteria 682
264 Ga0496110_0141472 3300048913 Bacteria 2175
265 Ga0496112_0119183 3300048915 Bacteria 2609
266 Ga0496114_0003295 3300048917 Bacteria 12394
267 Ga0496115_0310949 3300048918 Bacteria 1290
268 Ga0496115_0332772 3300048918 Bacteria 1240
269 Ga0496125_0250788 3300048928 Bacteria 1117
270 Ga0496126_0074087 3300048929 Bacteria 3024
271 Ga0501031_0211132 3300049568 Bacteria 1265
272 Ga0501031_0543329 3300049568 Bacteria 749
273 Ga0501033_0273037 3300049570 Bacteria 1195
274 Ga0501036_0013681 3300049572 Bacteria 6746
275 Ga0501036_0524586 3300049572 Bacteria 985
276 Ga0501039_0008464 3300049575 Bacteria 7842
277 Ga0501039_0524798 3300049575 Bacteria 930
278 Ga0501039_0536125 3300049575 Bacteria 919
279 Ga0501040_0154137 3300049576 Bacteria 1622
280 Ga0501040_0741817 3300049576 Bacteria 710
281 Ga0501041_0120301 3300049577 Bacteria 1632
282 Ga0501041_0154735 3300049577 Bacteria 1432
283 Ga0501042_0316642 3300049578 Bacteria 1127
284 Ga0501046_0102065 3300049580 Bacteria 2199
285 Ga0501048_0369254 3300049582 Bacteria 1024
286 Ga0501068_0016575 3300049584 Bacteria 4248
287 Ga0501071_0054274 3300049587 Bacteria 2892
288 Ga0501071_0395193 3300049587 Bacteria 1055
289 Ga0501072_0175798 3300049588 Bacteria 1708
290 Ga0501073_0078062 3300049589 Bacteria 2304
291 Ga0501074_0382977 3300049590 Bacteria 998
292 Ga0501075_0067435 3300049591 Bacteria 2702
293 Ga0501076_0508092 3300049592 Bacteria 993
294 Ga0501077_0268796 3300049593 Bacteria 1084
295 Ga0501079_0032026 3300049741 Bacteria 4041
296 Ga0501081_0037677 3300049743 Bacteria 3300
297 Ga0501045_0152171 3300049824 Bacteria 1721
298 nmdc:mga00v17_367464_c1 3300050491 Bacteria 935
299 nmdc:mga0yw44_242210_c1 3300050492 Bacteria 1199
300 nmdc:mga0yw44_64856_c1 3300050492 Bacteria 2249
301 nmdc:mga0yw44_67767_c1 3300050492 Bacteria 2206
302 nmdc:mga0yw44_737597_c1 3300050492 Bacteria 669
303 nmdc:mga06z11_92172_c1 3300050494 Bacteria 1647
304 nmdc:mga0n895_1193533_c1 3300050512 Bacteria 735
305 Ga0495601_0618332 3300053077 Bacteria 694
306 Ga0495612_0039650 3300053078 Bacteria 1916
307 Ga0500600_0052434 3300053149 Bacteria 2308
308 Ga0501084_0072360 3300054114 Bacteria 2887
309 Ga0501084_0271126 3300054114 Bacteria 1433
310 Ga0501082_0176448 3300060353 Bacteria 1858
311 Ga0466962_0125511 3300061719 Bacteria 1239
312 Ga0530510_0015734 3300061734 Bacteria 5347
313 Ga0530510_0528341 3300061734 Bacteria 895
314 2731907694 2731639228 Bacteria 4187555
315 2808917046 2808606375 Bacteria 9466072
316 2837272569 2837268691 Bacteria 7850704
317 2862575117 2862574272 Bacteria 10567477
318 2862581123 2862574272 Bacteria 10567477
319 2954691717 2954691527 Bacteria 10720516
320 2954706845 2954701450 Bacteria 10834262
321 8047719707 8047710418 Bacteria 11023148
322 8055068264 8055066027 Bacteria 9479577
323 Ga0495608_0505896
324 JGI24737J22298_10108167
325 JGI25406J46586_10056794
326 JGI25160J50197_1030656
327 Ga0070658_10139271
328 Ga0070666_10063309
329 Ga0070682_100215009
330 Ga0070660_100053980
331 Ga0070691_10011690
332 Ga0070668_100012278
333 Ga0070671_100044907
334 Ga0070674_100140212
335 Ga0070673_100161746
336 Ga0070659_100319313
337 Ga0070659_100462449
338 Ga0070667_100457274
339 Ga0070709_10060584
340 Ga0070709_10087207
341 Ga0070714_100455658
342 Ga0070714_100462734
343 Ga0070713_100007343
344 Ga0070713_100321866
345 Ga0070710_10003952
346 Ga0070701_10019437
347 Ga0070711_100087451
348 Ga0070711_100192778
349 Ga0070700_100436742
350 Ga0070663_100178775
351 Ga0070662_100015470
352 Ga0068867_100215664
353 Ga0070684_100174319
354 Ga0070686_100674780
355 Ga0070665_100408607
356 Ga0068855_100114458
357 Ga0068854_100165206
358 Ga0068856_100621738
359 Ga0068858_100031978
360 Ga0068860_100394621
361 Ga0068862_100039172
362 Ga0081455_10003265
363 Ga0081538_10023747
364 Ga0081538_10081451
365 Ga0081540_1006493
366 Ga0081539_10003558
367 Ga0081539_10005681
368 Ga0070717_10444079
369 Ga0070717_10629635
370 Ga0075365_10026641
371 Ga0075365_10625418
372 Ga0075363_100035400
373 Ga0075364_10246564
374 Ga0097621_100799941
375 Ga0068871_100485753
376 Ga0075434_101277939
377 Ga0068865_100585816
378 Ga0099826_10095837
379 Ga0105245_10584667
380 Ga0105247_10059298
381 Ga0105248_10023626
382 Ga0105237_10251816
383 Ga0105238_10024488
384 Ga0157374_10013469
385 Ga0157378_10136636
386 Ga0157375_10018346
387 Ga0163163_10122291
388 Ga0157379_10360486
389 Ga0206356_10319455
390 Ga0206353_11234140
391 Ga0213873_10123342
392 Ga0213875_10020496
393 Ga0213875_10026328
394 Ga0213875_10047855
395 Ga0213875_10148225
396 Ga0224712_10018831
397 Ga0207426_1030423
398 Ga0207692_10085014
399 Ga0207692_10199733
400 Ga0207710_10040003
401 Ga0207680_10320663
402 Ga0207685_10023637
403 Ga0207699_10137986
404 Ga0207693_10015049
405 Ga0207693_10780893
406 Ga0207694_10105967
407 Ga0207687_10498345
408 Ga0207700_10042401
409 Ga0207700_10103672
410 Ga0207706_10055452
411 Ga0207669_10113979
412 Ga0207704_10158331
413 Ga0207665_10005660
414 Ga0207665_10010308
415 Ga0207691_10298870
416 Ga0207691_10367528
417 Ga0207711_10014254
418 Ga0207689_10127912
419 Ga0207651_10091045
420 Ga0207677_10840447
421 Ga0207703_10447115
422 Ga0207639_10594926
423 Ga0207678_10009473
424 Ga0207678_10111837
425 Ga0207708_10159202
426 Ga0207702_10134181
427 Ga0207702_10134344
428 Ga0207702_10641749
429 Ga0207675_100071056
430 Ga0207698_10258507
431 Ga0268266_10228475
432 Ga0268264_10346904
433 Ga0307516_10003823
434 Ga0307518_10046397
435 Ga0307518_10221482
436 Ga0307416_101703134
437 Ga0373926_0002014
438 Ga0373934_0265487
439 Ga0373944_0001102
440 Ga0373923_0009614
441 Ga0373923_0034931
442 Ga0373936_0000339
443 Ga0373936_0000860
444 Ga0373936_0013580
445 Ga0373939_0006874
446 Ga0373945_0000025
447 Ga0373943_0000113
448 Ga0373946_0000290
449 Ga0373946_0000755
450 Ga0373955_0035995
451 Ga0373924_0007428
452 Ga0373924_0055712
453 Ga0373935_0000080
454 Ga0373927_0000888
455 Ga0373933_0076199
456 Ga0373933_0079942
457 Ga0373947_0001060
458 Ga0373937_0157611
459 Ga0373937_0335535
460 Ga0373937_0425608
461 Ga0373925_0002755
462 Ga0373925_0075226
463 Ga0373925_0199629
464 Ga0373925_0307248
465 Ga0436364_0103244
466 Ga0436364_0375547
467 Ga0436364_0461844
468 Ga0436364_0764786
469 Ga0436364_0784509
470 Ga0436364_1041488
471 Ga0436364_1362001
472 Ga0436365_0589192
473 Ga0436365_0751232
474 Ga0436365_1185618
475 Ga0436365_1642417
476 Ga0436363_0064810
477 Ga0436363_0197518
478 Ga0436363_0374874
479 Ga0436363_0669790
480 Ga0436363_1460400
481 Ga0436362_0045169
482 Ga0436362_1205237
483 Ga0439461_0083870
484 Ga0439465_0041961
485 Ga0451795_0899820
486 Ga0451853_0810003
487 Ga0439431_0003708
488 Ga0439434_0008093
489 Ga0466969_0246131
490 Ga0466966_0132467
491 Ga0466961_0236262
492 Ga0466963_0013237
493 Ga0466963_0038449
494 Ga0466963_0059074
495 Ga0466957_0117366
496 Ga0466960_0103450
497 Ga0466958_0700914
498 Ga0466967_0011486
499 Ga0466967_0122429
500 Ga0466967_1273168
501 Ga0495617_089231
502 Ga0495603_0039868
503 Ga0495641_0001478
504 Ga0495651_0061298
505 Ga0495653_0001040
506 Ga0495653_0323066
507 Ga0495653_0627655
508 Ga0495582_0009822
509 Ga0495639_0061411
510 Ga0495639_0113896
511 Ga0495662_0049002
512 Ga0495662_0066120
513 Ga0495664_0001733
514 Ga0495664_0001986
515 Ga0495585_0086778
516 Ga0495594_0147418
517 Ga0495608_0012767
518 Ga0495608_0018821
519 Ga0495618_0038050
520 Ga0495618_0346267
521 Ga0495628_0105828
522 Ga0495628_0145305
523 Ga0495630_0004355
524 Ga0495652_0017155
525 Ga0495652_0059367
526 Ga0495665_0003891
527 Ga0495665_0085741
528 Ga0495640_0016892
529 Ga0495640_0060038
530 Ga0495587_0066534
531 Ga0495645_0019606
532 Ga0495645_0059156
533 Ga0495667_0001347
534 Ga0495667_0005108
535 Ga0495667_0252403
536 Ga0495667_0445784
537 Ga0495634_0002543
538 Ga0495634_0084233
539 Ga0495611_0004408
540 Ga0495611_0088347
541 Ga0495635_0000879
542 Ga0495635_0132977
543 Ga0495635_0525681
544 Ga0495657_0009397
545 Ga0495657_0089782
546 Ga0495657_0118603
547 Ga0495623_0170518
548 Ga0495646_0018009
549 Ga0495624_0003528
550 Ga0495624_0004837
551 Ga0495589_0011664
552 Ga0495589_0020284
553 Ga0495600_0107819
554 Ga0495600_0180750
555 Ga0495600_0326809
556 Ga0495581_0008954
557 Ga0495581_0015019
558 Ga0495674_0000534
559 Ga0495676_0006649
560 Ga0495676_0033694
561 Ga0495676_0060288
562 Ga0495676_0119445
563 Ga0495680_0002309
564 Ga0495680_0016163
565 Ga0495680_0150197
566 Ga0495683_0065229
567 Ga0495685_004383
568 Ga0495685_017824
569 Ga0495685_018585
570 Ga0495685_115180
571 Ga0495684_0001682
572 Ga0495684_0002062
573 Ga0495593_0081711
574 Ga0495602_0138832
575 Ga0495602_0154203
576 Ga0495614_0317510
577 Ga0496100_0188691
578 Ga0496102_0028026
579 Ga0496104_0022459
580 Ga0496105_0028602
581 Ga0496108_0098379
582 Ga0496108_0190630
583 Ga0496109_0003009
584 Ga0496109_0835290
585 Ga0496109_1240209
586 Ga0496110_0141472
587 Ga0496112_0119183
588 Ga0496114_0003295
589 Ga0496115_0310949
590 Ga0496115_0332772
591 Ga0496125_0250788
592 Ga0496126_0074087
593 Ga0501031_0211132
594 Ga0501031_0543329
595 Ga0501033_0273037
596 Ga0501036_0013681
597 Ga0501036_0524586
598 Ga0501039_0008464
599 Ga0501039_0524798
600 Ga0501039_0536125
601 Ga0501040_0154137
602 Ga0501040_0741817
603 Ga0501041_0120301
604 Ga0501041_0154735
605 Ga0501042_0316642
606 Ga0501046_0102065
607 Ga0501048_0369254
608 Ga0501068_0016575
609 Ga0501071_0054274
610 Ga0501071_0395193
611 Ga0501072_0175798
612 Ga0501073_0078062
613 Ga0501074_0382977
614 Ga0501075_0067435
615 Ga0501076_0508092
616 Ga0501077_0268796
617 Ga0501079_0032026
618 Ga0501081_0037677
619 Ga0501045_0152171
620 nmdc:mga00v17_367464_c1
621 nmdc:mga0yw44_242210_c1
622 nmdc:mga0yw44_64856_c1
623 nmdc:mga0yw44_67767_c1
624 nmdc:mga0yw44_737597_c1
625 nmdc:mga06z11_92172_c1
626 nmdc:mga0n895_1193533_c1
627 Ga0495601_0618332
628 Ga0495612_0039650
629 Ga0500600_0052434
630 Ga0501084_0072360
631 Ga0501084_0271126
632 Ga0501082_0176448
633 Ga0466962_0125511
634 Ga0530510_0015734
635 Ga0530510_0528341
636 2731907694
637 2808917046
638 2837272569
639 2862575117
640 2862581123
641 2954691717
642 2954706845
643 8047719707
644 8055068264

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

29

222

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
2xw7-assembly1.cif.gz_B structure of mycobacterium smegmatis putative reductase ms0308 0.7844 2 191
3jtw-assembly1.cif.gz_A-2 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.7801 1 191
3jtw-assembly2.cif.gz_B-3 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.7797 1 191
3jtw-assembly1.cif.gz_A-2 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.7762 1 191
3jtw-assembly2.cif.gz_B-3 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.7757 1 191
ID Description Score Start End Superfamily
3kgyB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7954 2 191 3.40.430.10
2xw7B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7844 2 191 3.40.430.10
3kgyB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7843 2 191 3.40.430.10
2xw7B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.768 2 191 3.40.430.10
1vdrA00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7639 4 191 3.40.430.10
ID Description Score Start End GO Terms
AF-K6VY46-F1-model_v4 Bacterial bifunctional deaminase-reductase C-terminal domain-containing protein 0.9414 2 192 GO:0008703
GO:0009231
AF-A0A5D0NSF7-F1-model_v4 deleted 0.9388 37 192
AF-A0A3M8V9I8-F1-model_v4 Dihydrofolate reductase 0.9368 1 192 GO:0008703
GO:0009231
AF-A0A366LPL5-F1-model_v4 Dihydrofolate reductase 0.9353 3 192 GO:0008703
GO:0009231
AF-A0A419HSL7-F1-model_v4 Dihydrofolate reductase 0.9351 1 192 GO:0008703
GO:0009231

Map