F409995

General Info

Members Datasets Scaffolds Average Seq Length
330 213 660 354

Family's Representative Sequence

Representative Sequence 3300005458|Ga0070681_10232728|Ga0070681_102327282
Length 373
Sequence MCCEQGVDGRDKPGHDEVNVTAISIEGVARSFAGVRAVDDVSLGVRDGEFFTLLGPSGCGKTTLLRMVAGFCELDAGRIMFGDQRIDTLPPHRRNTGMVFQNYAVFPHLTVGDNVAYGLRARNTKAGDVRTRVARALELVQLPGYAERWPHQLSGGQLQRVAIARAVAIEPDVLLLDEPLSNLDAKLRVDMRGEIRRLQKLLKITVLYVTHDQEEALAVSDRIAVMRAGRVEQVGDPRAIYERPQTPFVASFVGTTNLIDGKVTGRAGELVEVGFAGGVVRAVSTTGAVGDKVAASLRPEALRVLAAGETAPAGWATLTGKLSAVEYLGPVTRFAVTLADGAALHVMALAPPAGEVEVRLAYDPKCVVMVGTP

Samples

Sample ID Description Type Environment
1 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
50 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
54 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
55 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
56 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
59 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
60 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
61 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
89 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
90 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
91 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
92 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
93 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
122 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
123 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
126 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
127 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
128 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
129 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
130 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
131 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
132 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
133 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
134 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
135 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
136 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
137 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
138 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
139 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
140 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
141 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
142 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
143 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
144 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
145 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
146 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
147 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
148 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
149 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
150 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
151 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
152 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
153 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
154 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
155 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
156 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
157 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
158 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
159 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
160 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
161 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
162 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
163 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
164 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
165 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
166 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
176 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
177 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
178 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
179 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
180 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
181 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
182 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
183 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
184 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
187 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
188 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
189 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
190 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
191 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
192 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
193 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
194 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
195 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
196 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
197 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
198 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
199 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
200 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
201 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
202 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
203 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
204 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
205 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
206 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
207 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
208 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
209 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
210 2855730933 Achromobacter sp. HZ28 Isolate Nodule
211 2855767633 Achromobacter sp. HZ34 Isolate Nodule
212 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
213 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.79
Metatranscriptomes 0
Isolates 1.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.82
Nodule 0.61
Rhizoplane 5.76
Rhizosphere 74.55
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070681_10232728 3300005458 Bacteria 1757
2 JGI25151J46595_10000077 3300003187 Bacteria 133862
3 Ga0070658_10004869 3300005327 Bacteria 10935
4 Ga0068869_100155016 3300005334 Bacteria 1779
5 Ga0070680_100014172 3300005336 Bacteria 6227
6 Ga0070680_100077439 3300005336 Bacteria 2739
7 Ga0070660_100009017 3300005339 Bacteria 7000
8 Ga0070691_10004973 3300005341 Bacteria 6048
9 Ga0070687_100010794 3300005343 Bacteria 3971
10 Ga0070661_100100574 3300005344 Bacteria 2150
11 Ga0070692_10003457 3300005345 Bacteria 6405
12 Ga0070668_100166615 3300005347 Bacteria 1791
13 Ga0070671_100011310 3300005355 Bacteria 7172
14 Ga0070674_100086968 3300005356 Bacteria 2246
15 Ga0070673_100035072 3300005364 Bacteria 3802
16 Ga0070673_100041555 3300005364 Bacteria 3538
17 Ga0070673_100220859 3300005364 Bacteria 1640
18 Ga0070667_100097988 3300005367 Bacteria 2530
19 Ga0070703_10000835 3300005406 Bacteria 9995
20 Ga0070709_10021157 3300005434 Bacteria 3786
21 Ga0070714_100017530 3300005435 Bacteria 5803
22 Ga0070713_100000314 3300005436 Bacteria 31729
23 Ga0070713_100023956 3300005436 Bacteria 4746
24 Ga0070713_100103761 3300005436 Bacteria 2467
25 Ga0070711_100034343 3300005439 Bacteria 3382
26 Ga0070705_100002065 3300005440 Bacteria 10251
27 Ga0070700_100069900 3300005441 Bacteria 2237
28 Ga0070694_100002867 3300005444 Bacteria 10244
29 Ga0070694_100016157 3300005444 Bacteria 4697
30 Ga0070708_100030309 3300005445 Bacteria 4675
31 Ga0070708_100037250 3300005445 Bacteria 4242
32 Ga0070708_100047588 3300005445 Bacteria 3789
33 Ga0070708_100162666 3300005445 Bacteria 2080
34 Ga0070663_100003779 3300005455 Bacteria 8797
35 Ga0070678_100227433 3300005456 Bacteria 1553
36 Ga0070681_10026174 3300005458 Bacteria 5866
37 Ga0070681_10089940 3300005458 Bacteria 3021
38 Ga0068867_100030910 3300005459 Bacteria 3864
39 Ga0070685_10064011 3300005466 Bacteria 2161
40 Ga0070706_100181580 3300005467 Bacteria 1965
41 Ga0070706_100317599 3300005467 Bacteria 1453
42 Ga0070707_100194007 3300005468 Bacteria 1980
43 Ga0070707_100388298 3300005468 Bacteria 1356
44 Ga0070698_100015110 3300005471 Bacteria 8163
45 Ga0070699_100004592 3300005518 Bacteria 12217
46 Ga0070679_100006498 3300005530 Bacteria 10899
47 Ga0070679_100022445 3300005530 Bacteria 6167
48 Ga0070697_100027335 3300005536 Bacteria 4564
49 Ga0070695_100002006 3300005545 Bacteria 11603
50 Ga0070695_100025575 3300005545 Bacteria 3646
51 Ga0070696_100003671 3300005546 Bacteria 10235
52 Ga0070665_100233457 3300005548 Bacteria 1840
53 Ga0070704_100000936 3300005549 Bacteria 14740
54 Ga0070664_100083659 3300005564 Bacteria 2753
55 Ga0068857_100012564 3300005577 Bacteria 7375
56 Ga0068859_100017153 3300005617 Bacteria 7272
57 Ga0068859_100183183 3300005617 Bacteria 2177
58 Ga0068864_100039589 3300005618 Bacteria 4029
59 Ga0068864_100045162 3300005618 Bacteria 3779
60 Ga0068861_100104691 3300005719 Bacteria 2258
61 Ga0068863_100271074 3300005841 Bacteria 1643
62 Ga0068858_100166761 3300005842 Bacteria 2076
63 Ga0068860_100011487 3300005843 Bacteria 8725
64 Ga0068862_100010689 3300005844 Bacteria 7581
65 Ga0068862_100023186 3300005844 Bacteria 5198
66 Ga0081455_10004452 3300005937 Bacteria 15704
67 Ga0081538_10032620 3300005981 Bacteria 3485
68 Ga0081540_1000086 3300005983 Bacteria 99615
69 Ga0081540_1000213 3300005983 Bacteria 61164
70 Ga0081539_10012836 3300005985 Bacteria 6390
71 Ga0070717_10047453 3300006028 Bacteria 3519
72 Ga0075365_10000142 3300006038 Bacteria 22408
73 Ga0075368_10000349 3300006042 Bacteria 13539
74 Ga0075368_10021204 3300006042 Bacteria 2466
75 Ga0075363_100005490 3300006048 Bacteria 5649
76 Ga0075363_100014954 3300006048 Bacteria 3806
77 Ga0075364_10000192 3300006051 Bacteria 28238
78 Ga0075364_10022588 3300006051 Bacteria 3974
79 Ga0075364_10172140 3300006051 Bacteria 1464
80 Ga0070712_100039817 3300006175 Bacteria 3218
81 Ga0070712_100197413 3300006175 Bacteria 1578
82 Ga0075362_10002571 3300006177 Bacteria 6132
83 Ga0075367_10002144 3300006178 Bacteria 8877
84 Ga0075367_10005733 3300006178 Bacteria 6204
85 Ga0075367_10019214 3300006178 Bacteria 3786
86 Ga0075367_10034117 3300006178 Bacteria 2937
87 Ga0075369_10000761 3300006186 Bacteria 10505
88 Ga0075370_10094043 3300006353 Bacteria 1730
89 Ga0068871_100058893 3300006358 Bacteria 3129
90 Ga0068871_100154897 3300006358 Bacteria 1956
91 Ga0075428_100000587 3300006844 Bacteria 37141
92 Ga0075428_100021551 3300006844 Bacteria 7134
93 Ga0075428_100023808 3300006844 Bacteria 6776
94 Ga0075428_100112123 3300006844 Bacteria 2970
95 Ga0075428_100326776 3300006844 Bacteria 1648
96 Ga0075430_100006148 3300006846 Bacteria 10112
97 Ga0075430_100041940 3300006846 Bacteria 3870
98 Ga0075430_100133103 3300006846 Bacteria 2072
99 Ga0075431_100000130 3300006847 Bacteria 50226
100 Ga0075431_100023247 3300006847 Bacteria 6341
101 Ga0075431_100256231 3300006847 Bacteria 1777
102 Ga0075433_10001754 3300006852 Bacteria 16212
103 Ga0075434_100009584 3300006871 Bacteria 9042
104 Ga0075434_100117308 3300006871 Bacteria 2675
105 Ga0075429_100038631 3300006880 Bacteria 4156
106 Ga0068865_100080221 3300006881 Bacteria 2340
107 Ga0097620_100017153 3300006931 Bacteria 7272
108 Ga0097620_100183184 3300006931 Bacteria 2177
109 Ga0075435_100028945 3300007076 Bacteria 4348
110 Ga0111539_10001611 3300009094 Bacteria 30145
111 Ga0111539_10093317 3300009094 Bacteria 3536
112 Ga0111539_10156981 3300009094 Bacteria 2662
113 Ga0105247_10157492 3300009101 Bacteria 1501
114 Ga0114129_10000126 3300009147 Bacteria 77521
115 Ga0114129_10029645 3300009147 Bacteria 7749
116 Ga0114129_10049127 3300009147 Bacteria 5929
117 Ga0114129_10310831 3300009147 Bacteria 2098
118 Ga0114129_10323221 3300009147 Bacteria 2051
119 Ga0105242_10053186 3300009176 Bacteria 3305
120 Ga0105248_10097914 3300009177 Bacteria 3305
121 Ga0105237_10025982 3300009545 Bacteria 5986
122 Ga0105238_10304894 3300009551 Bacteria 1577
123 Ga0105249_10006405 3300009553 Bacteria 10235
124 Ga0105249_10230156 3300009553 Bacteria 1828
125 Ga0105239_10426299 3300010375 Bacteria 1503
126 Ga0157370_10052854 3300013104 Bacteria 3876
127 Ga0163162_10051245 3300013306 Bacteria 4141
128 Ga0157375_10079450 3300013308 Bacteria 3316
129 Ga0157375_10216453 3300013308 Bacteria 2073
130 Ga0163163_10129853 3300014325 Bacteria 2559
131 Ga0157380_10123846 3300014326 Bacteria 2194
132 Ga0157376_10082876 3300014969 Bacteria 2757
133 Ga0157376_10152945 3300014969 Bacteria 2083
134 Ga0163161_10073910 3300017792 Bacteria 2499
135 Ga0163161_10168825 3300017792 Bacteria 1672
136 Ga0213873_10002083 3300021358 Bacteria 3421
137 Ga0213874_10003017 3300021377 Bacteria 3692
138 Ga0213874_10024961 3300021377 Bacteria 1681
139 Ga0213876_10001478 3300021384 Bacteria 14636
140 Ga0213875_10000030 3300021388 Bacteria 178500
141 Ga0213875_10004538 3300021388 Bacteria 7591
142 Ga0213875_10008113 3300021388 Bacteria 5392
143 Ga0213875_10040000 3300021388 Bacteria 2208
144 Ga0209025_1000003 3300025294 Bacteria 1366495
145 Ga0207653_10001471 3300025885 Bacteria 7652
146 Ga0207699_10026344 3300025906 Bacteria 3203
147 Ga0207707_10028700 3300025912 Bacteria 4862
148 Ga0207707_10033561 3300025912 Bacteria 4491
149 Ga0207707_10042351 3300025912 Bacteria 3974
150 Ga0207695_10115397 3300025913 Bacteria 2660
151 Ga0207693_10032621 3300025915 Bacteria 4110
152 Ga0207693_10116684 3300025915 Bacteria 2096
153 Ga0207660_10001911 3300025917 Bacteria 13881
154 Ga0207660_10059628 3300025917 Bacteria 2740
155 Ga0207662_10005578 3300025918 Bacteria 6724
156 Ga0207650_10012643 3300025925 Bacteria 5825
157 Ga0207659_10047903 3300025926 Bacteria 3025
158 Ga0207659_10121105 3300025926 Bacteria 2005
159 Ga0207700_10000390 3300025928 Bacteria 25598
160 Ga0207700_10033245 3300025928 Bacteria 3689
161 Ga0207700_10036375 3300025928 Bacteria 3555
162 Ga0207664_10009971 3300025929 Bacteria 6693
163 Ga0207664_10010887 3300025929 Bacteria 6442
164 Ga0207709_10218822 3300025935 Bacteria 1372
165 Ga0207691_10005709 3300025940 Bacteria 12035
166 Ga0207691_10007579 3300025940 Bacteria 10446
167 Ga0207661_10014372 3300025944 Bacteria 5801
168 Ga0207679_10038008 3300025945 Bacteria 3427
169 Ga0207667_10372811 3300025949 Bacteria 1454
170 Ga0207651_10070750 3300025960 Bacteria 2469
171 Ga0207712_10004321 3300025961 Bacteria 8973
172 Ga0207712_10174683 3300025961 Bacteria 1682
173 Ga0207677_10134086 3300026023 Bacteria 1885
174 Ga0207678_10010824 3300026067 Bacteria 8015
175 Ga0207708_10060603 3300026075 Bacteria 2888
176 Ga0207641_10307498 3300026088 Bacteria 1499
177 Ga0207648_10026342 3300026089 Bacteria 5168
178 Ga0207676_10041180 3300026095 Bacteria 3544
179 Ga0207674_10022650 3300026116 Bacteria 6742
180 Ga0207675_100144946 3300026118 Bacteria 2258
181 Ga0207683_10000860 3300026121 Bacteria 27818
182 Ga0207683_10001187 3300026121 Bacteria 23607
183 Ga0209966_1013175 3300027695 Bacteria 1527
184 Ga0209813_10000404 3300027866 Bacteria 10591
185 Ga0209813_10000928 3300027866 Bacteria 6580
186 Ga0207428_10031357 3300027907 Bacteria 4386
187 Ga0268265_10002961 3300028380 Bacteria 12439
188 Ga0268264_10006223 3300028381 Bacteria 10071
189 Ga0265334_10016932 3300028573 Bacteria 3014
190 Ga0265340_10111518 3300031247 Bacteria 1264
191 Ga0307508_10009664 3300031616 Bacteria 8855
192 Ga0373930_0012498 3300034816 Bacteria 1550
193 Ga0373941_0034232 3300035115 Bacteria 1531
194 Ga0373942_0031107 3300035207 Bacteria 1409
195 Ga0373931_0050430 3300035691 Bacteria 2214
196 Ga0373931_0068365 3300035691 Bacteria 1933
197 Ga0373935_0100650 3300035692 Bacteria 1905
198 Ga0373927_0131505 3300035695 Bacteria 1635
199 Ga0395899_0005095 3300037312 Bacteria 10229
200 Ga0395898_0003003 3300037466 Bacteria 19126
201 Ga0395905_0007934 3300037471 Bacteria 10499
202 Ga0436364_0207431 3300037853 Bacteria 52858
203 Ga0436364_0329747 3300037853 Bacteria 2887
204 Ga0436364_0550293 3300037853 Bacteria 2297
205 Ga0436364_0625167 3300037853 Bacteria 1515
206 Ga0436364_0833595 3300037853 Bacteria 18740
207 Ga0436364_1452795 3300037853 Bacteria 3319
208 Ga0436365_0038117 3300039437 Bacteria 61158
209 Ga0436365_0111300 3300039437 Bacteria 37065
210 Ga0436365_0775443 3300039437 Bacteria 16621
211 Ga0436365_0832969 3300039437 Bacteria 1762
212 Ga0436360_0244392 3300039438 Bacteria 2554
213 Ga0436363_1266481 3300039450 Bacteria 29395
214 Ga0436363_1610497 3300039450 Bacteria 4725
215 Ga0436362_0773950 3300039453 Bacteria 7807
216 Ga0439435_0003936 3300042436 Bacteria 3150
217 Ga0439444_0009576 3300042437 Bacteria 1530
218 Ga0451577_0083244 3300042876 Bacteria 2854
219 Ga0495638_0043379 3300046460 Bacteria 2837
220 Ga0495650_0034531 3300046471 Bacteria 2237
221 Ga0495580_0055318 3300046472 Bacteria 2797
222 Ga0495674_0287588 3300047319 Bacteria 1345
223 Ga0496100_0195578 3300048903 Bacteria 1471
224 Ga0496102_0002610 3300048905 Bacteria 15341
225 Ga0496103_0040244 3300048906 Bacteria 2873
226 Ga0496104_0000189 3300048907 Bacteria 55677
227 Ga0496105_0047698 3300048908 Bacteria 3535
228 Ga0496106_0007198 3300048909 Bacteria 8220
229 Ga0496107_0011668 3300048910 Bacteria 6124
230 Ga0496107_0033491 3300048910 Bacteria 3676
231 Ga0496108_0082056 3300048911 Bacteria 2733
232 Ga0496108_0087719 3300048911 Bacteria 2643
233 Ga0496109_0022278 3300048912 Bacteria 5611
234 Ga0496109_0063137 3300048912 Bacteria 3388
235 Ga0496110_0004257 3300048913 Bacteria 11075
236 Ga0496111_0016180 3300048914 Bacteria 5137
237 Ga0496112_0139736 3300048915 Bacteria 2391
238 Ga0496112_0145983 3300048915 Bacteria 2334
239 Ga0496113_0009889 3300048916 Bacteria 6282
240 Ga0496114_0061887 3300048917 Bacteria 3132
241 Ga0496115_0020546 3300048918 Bacteria 5095
242 Ga0496121_0016362 3300048924 Bacteria 7663
243 Ga0496126_0068428 3300048929 Bacteria 3170
244 Ga0501032_0047829 3300049569 Bacteria 2888
245 Ga0501032_0093442 3300049569 Bacteria 1994
246 Ga0501033_0062612 3300049570 Bacteria 2739
247 Ga0501034_0011456 3300049571 Bacteria 9188
248 Ga0501034_0044310 3300049571 Bacteria 4500
249 Ga0501034_0057923 3300049571 Bacteria 3895
250 Ga0501034_0282961 3300049571 Bacteria 1597
251 Ga0501036_0024573 3300049572 Bacteria 5080
252 Ga0501037_0016064 3300049573 Bacteria 5508
253 Ga0501037_0042144 3300049573 Bacteria 3355
254 Ga0501038_0011974 3300049574 Bacteria 7918
255 Ga0501038_0062456 3300049574 Bacteria 3183
256 Ga0501038_0275174 3300049574 Bacteria 1326
257 Ga0501039_0031571 3300049575 Bacteria 4084
258 Ga0501039_0383254 3300049575 Bacteria 1104
259 Ga0501041_0010048 3300049577 Bacteria 5576
260 Ga0501047_0015574 3300049581 Bacteria 7245
261 Ga0501047_0173304 3300049581 Bacteria 2026
262 Ga0501068_0015669 3300049584 Bacteria 4358
263 Ga0501071_0030584 3300049587 Bacteria 3810
264 Ga0501072_0062943 3300049588 Bacteria 2926
265 Ga0501072_0286997 3300049588 Bacteria 1308
266 Ga0501072_0292856 3300049588 Bacteria 1294
267 Ga0501075_0032876 3300049591 Bacteria 3857
268 Ga0501076_0016607 3300049592 Bacteria 5581
269 Ga0501077_0054618 3300049593 Bacteria 2536
270 Ga0501080_0089080 3300049742 Bacteria 2866
271 Ga0501081_0059748 3300049743 Bacteria 2640
272 Ga0501083_0063914 3300049744 Bacteria 2454
273 Ga0501035_0020563 3300049822 Bacteria 6062
274 Ga0501035_0095360 3300049822 Bacteria 2615
275 Ga0501035_0108913 3300049822 Bacteria 2428
276 Ga0501044_0001031 3300049823 Bacteria 33572
277 Ga0501044_0018684 3300049823 Bacteria 7425
278 Ga0501044_0042699 3300049823 Bacteria 4714
279 Ga0501044_0043258 3300049823 Bacteria 4681
280 Ga0501044_0113121 3300049823 Bacteria 2721
281 Ga0501045_0034183 3300049824 Bacteria 3689
282 Ga0501045_0271797 3300049824 Bacteria 1262
283 nmdc:mga03683_16445_c1 3300050489 Bacteria 2779
284 nmdc:mga03683_1984_c1 3300050489 Bacteria 6265
285 nmdc:mga03n38_2446_c1 3300050490 Bacteria 5738
286 nmdc:mga03n38_626_c1 3300050490 Bacteria 9059
287 nmdc:mga03n38_8814_c1 3300050490 Bacteria 3638
288 nmdc:mga00v17_4573_c1 3300050491 Bacteria 7212
289 nmdc:mga0yw44_301_c1 3300050492 Bacteria 17044
290 nmdc:mga0yw44_91483_c1 3300050492 Bacteria 1923
291 nmdc:mga0yw44_96535_c1 3300050492 Bacteria 1876
292 nmdc:mga06z11_11970_c1 3300050494 Bacteria 3760
293 nmdc:mga06z11_15654_c1 3300050494 Bacteria 3390
294 nmdc:mga06z11_283_c1 3300050494 Bacteria 19709
295 nmdc:mga06z11_2928_c1 3300050494 Bacteria 6571
296 nmdc:mga06z11_7004_c1 3300050494 Bacteria 4623
297 nmdc:mga04h51_392_c1 3300050495 Bacteria 10642
298 nmdc:mga04h51_409_c1 3300050495 Bacteria 10395
299 nmdc:mga07m45_93446_c1 3300050496 Bacteria 1724
300 nmdc:mga05p37_1068_c1 3300050507 Bacteria 31371
301 nmdc:mga05p37_40354_c1 3300050507 Bacteria 5731
302 nmdc:mga05p37_405820_c1 3300050507 Bacteria 1590
303 nmdc:mga05p37_58449_c2 3300050507 Bacteria 3006
304 nmdc:mga09592_46360_c1 3300050508 Bacteria 3662
305 nmdc:mga09592_582_c1 3300050508 Bacteria 27628
306 nmdc:mga0qj67_14573_c1 3300050509 Bacteria 5944
307 nmdc:mga0qj67_147149_c1 3300050509 Bacteria 1910
308 nmdc:mga0qj67_3113_c1 3300050509 Bacteria 11934
309 nmdc:mga0qj67_8830_c1 3300050509 Bacteria 7479
310 nmdc:mga06r32_105481_c1 3300050510 Bacteria 2769
311 nmdc:mga06r32_125_c1 3300050510 Bacteria 55385
312 nmdc:mga08y16_184002_c1 3300050511 Bacteria 2168
313 nmdc:mga08y16_21548_c1 3300050511 Bacteria 6804
314 nmdc:mga08y16_835_c1 3300050511 Bacteria 29607
315 nmdc:mga0n895_10797_c1 3300050512 Bacteria 8103
316 nmdc:mga0rr50_17128_c1 3300050513 Bacteria 4829
317 nmdc:mga08x19_150964_c1 3300050514 Bacteria 1573
318 nmdc:mga0a205_266118_c1 3300050515 Bacteria 1591
319 nmdc:mga0sz30_495_c1 3300050516 Bacteria 14687
320 Ga0500641_0036746 3300053096 Bacteria 1961
321 Ga0500616_0003466 3300053153 Bacteria 12025
322 Ga0501084_0033482 3300054114 Bacteria 4299
323 Ga0590071_007621 3300059421 Bacteria 2559
324 Ga0501082_0039234 3300060353 Bacteria 4086
325 Ga0501082_0069159 3300060353 Bacteria 3039
326 Ga0530510_0028707 3300061734 Bacteria 3989
327 2855730945 2855730933 Bacteria 7047938
328 2855770454 2855767633 Bacteria 7049357
329 2881414657 2881412998 Bacteria 6492157
330 2920763971 2920760137 Bacteria 7427611
331 Ga0070681_10232728
332 JGI25151J46595_10000077
333 Ga0070658_10004869
334 Ga0068869_100155016
335 Ga0070680_100014172
336 Ga0070680_100077439
337 Ga0070660_100009017
338 Ga0070691_10004973
339 Ga0070687_100010794
340 Ga0070661_100100574
341 Ga0070692_10003457
342 Ga0070668_100166615
343 Ga0070671_100011310
344 Ga0070674_100086968
345 Ga0070673_100035072
346 Ga0070673_100041555
347 Ga0070673_100220859
348 Ga0070667_100097988
349 Ga0070703_10000835
350 Ga0070709_10021157
351 Ga0070714_100017530
352 Ga0070713_100000314
353 Ga0070713_100023956
354 Ga0070713_100103761
355 Ga0070711_100034343
356 Ga0070705_100002065
357 Ga0070700_100069900
358 Ga0070694_100002867
359 Ga0070694_100016157
360 Ga0070708_100030309
361 Ga0070708_100037250
362 Ga0070708_100047588
363 Ga0070708_100162666
364 Ga0070663_100003779
365 Ga0070678_100227433
366 Ga0070681_10026174
367 Ga0070681_10089940
368 Ga0068867_100030910
369 Ga0070685_10064011
370 Ga0070706_100181580
371 Ga0070706_100317599
372 Ga0070707_100194007
373 Ga0070707_100388298
374 Ga0070698_100015110
375 Ga0070699_100004592
376 Ga0070679_100006498
377 Ga0070679_100022445
378 Ga0070697_100027335
379 Ga0070695_100002006
380 Ga0070695_100025575
381 Ga0070696_100003671
382 Ga0070665_100233457
383 Ga0070704_100000936
384 Ga0070664_100083659
385 Ga0068857_100012564
386 Ga0068859_100017153
387 Ga0068859_100183183
388 Ga0068864_100039589
389 Ga0068864_100045162
390 Ga0068861_100104691
391 Ga0068863_100271074
392 Ga0068858_100166761
393 Ga0068860_100011487
394 Ga0068862_100010689
395 Ga0068862_100023186
396 Ga0081455_10004452
397 Ga0081538_10032620
398 Ga0081540_1000086
399 Ga0081540_1000213
400 Ga0081539_10012836
401 Ga0070717_10047453
402 Ga0075365_10000142
403 Ga0075368_10000349
404 Ga0075368_10021204
405 Ga0075363_100005490
406 Ga0075363_100014954
407 Ga0075364_10000192
408 Ga0075364_10022588
409 Ga0075364_10172140
410 Ga0070712_100039817
411 Ga0070712_100197413
412 Ga0075362_10002571
413 Ga0075367_10002144
414 Ga0075367_10005733
415 Ga0075367_10019214
416 Ga0075367_10034117
417 Ga0075369_10000761
418 Ga0075370_10094043
419 Ga0068871_100058893
420 Ga0068871_100154897
421 Ga0075428_100000587
422 Ga0075428_100021551
423 Ga0075428_100023808
424 Ga0075428_100112123
425 Ga0075428_100326776
426 Ga0075430_100006148
427 Ga0075430_100041940
428 Ga0075430_100133103
429 Ga0075431_100000130
430 Ga0075431_100023247
431 Ga0075431_100256231
432 Ga0075433_10001754
433 Ga0075434_100009584
434 Ga0075434_100117308
435 Ga0075429_100038631
436 Ga0068865_100080221
437 Ga0097620_100017153
438 Ga0097620_100183184
439 Ga0075435_100028945
440 Ga0111539_10001611
441 Ga0111539_10093317
442 Ga0111539_10156981
443 Ga0105247_10157492
444 Ga0114129_10000126
445 Ga0114129_10029645
446 Ga0114129_10049127
447 Ga0114129_10310831
448 Ga0114129_10323221
449 Ga0105242_10053186
450 Ga0105248_10097914
451 Ga0105237_10025982
452 Ga0105238_10304894
453 Ga0105249_10006405
454 Ga0105249_10230156
455 Ga0105239_10426299
456 Ga0157370_10052854
457 Ga0163162_10051245
458 Ga0157375_10079450
459 Ga0157375_10216453
460 Ga0163163_10129853
461 Ga0157380_10123846
462 Ga0157376_10082876
463 Ga0157376_10152945
464 Ga0163161_10073910
465 Ga0163161_10168825
466 Ga0213873_10002083
467 Ga0213874_10003017
468 Ga0213874_10024961
469 Ga0213876_10001478
470 Ga0213875_10000030
471 Ga0213875_10004538
472 Ga0213875_10008113
473 Ga0213875_10040000
474 Ga0209025_1000003
475 Ga0207653_10001471
476 Ga0207699_10026344
477 Ga0207707_10028700
478 Ga0207707_10033561
479 Ga0207707_10042351
480 Ga0207695_10115397
481 Ga0207693_10032621
482 Ga0207693_10116684
483 Ga0207660_10001911
484 Ga0207660_10059628
485 Ga0207662_10005578
486 Ga0207650_10012643
487 Ga0207659_10047903
488 Ga0207659_10121105
489 Ga0207700_10000390
490 Ga0207700_10033245
491 Ga0207700_10036375
492 Ga0207664_10009971
493 Ga0207664_10010887
494 Ga0207709_10218822
495 Ga0207691_10005709
496 Ga0207691_10007579
497 Ga0207661_10014372
498 Ga0207679_10038008
499 Ga0207667_10372811
500 Ga0207651_10070750
501 Ga0207712_10004321
502 Ga0207712_10174683
503 Ga0207677_10134086
504 Ga0207678_10010824
505 Ga0207708_10060603
506 Ga0207641_10307498
507 Ga0207648_10026342
508 Ga0207676_10041180
509 Ga0207674_10022650
510 Ga0207675_100144946
511 Ga0207683_10000860
512 Ga0207683_10001187
513 Ga0209966_1013175
514 Ga0209813_10000404
515 Ga0209813_10000928
516 Ga0207428_10031357
517 Ga0268265_10002961
518 Ga0268264_10006223
519 Ga0265334_10016932
520 Ga0265340_10111518
521 Ga0307508_10009664
522 Ga0373930_0012498
523 Ga0373941_0034232
524 Ga0373942_0031107
525 Ga0373931_0050430
526 Ga0373931_0068365
527 Ga0373935_0100650
528 Ga0373927_0131505
529 Ga0395899_0005095
530 Ga0395898_0003003
531 Ga0395905_0007934
532 Ga0436364_0207431
533 Ga0436364_0329747
534 Ga0436364_0550293
535 Ga0436364_0625167
536 Ga0436364_0833595
537 Ga0436364_1452795
538 Ga0436365_0038117
539 Ga0436365_0111300
540 Ga0436365_0775443
541 Ga0436365_0832969
542 Ga0436360_0244392
543 Ga0436363_1266481
544 Ga0436363_1610497
545 Ga0436362_0773950
546 Ga0439435_0003936
547 Ga0439444_0009576
548 Ga0451577_0083244
549 Ga0495638_0043379
550 Ga0495650_0034531
551 Ga0495580_0055318
552 Ga0495674_0287588
553 Ga0496100_0195578
554 Ga0496102_0002610
555 Ga0496103_0040244
556 Ga0496104_0000189
557 Ga0496105_0047698
558 Ga0496106_0007198
559 Ga0496107_0011668
560 Ga0496107_0033491
561 Ga0496108_0082056
562 Ga0496108_0087719
563 Ga0496109_0022278
564 Ga0496109_0063137
565 Ga0496110_0004257
566 Ga0496111_0016180
567 Ga0496112_0139736
568 Ga0496112_0145983
569 Ga0496113_0009889
570 Ga0496114_0061887
571 Ga0496115_0020546
572 Ga0496121_0016362
573 Ga0496126_0068428
574 Ga0501032_0047829
575 Ga0501032_0093442
576 Ga0501033_0062612
577 Ga0501034_0011456
578 Ga0501034_0044310
579 Ga0501034_0057923
580 Ga0501034_0282961
581 Ga0501036_0024573
582 Ga0501037_0016064
583 Ga0501037_0042144
584 Ga0501038_0011974
585 Ga0501038_0062456
586 Ga0501038_0275174
587 Ga0501039_0031571
588 Ga0501039_0383254
589 Ga0501041_0010048
590 Ga0501047_0015574
591 Ga0501047_0173304
592 Ga0501068_0015669
593 Ga0501071_0030584
594 Ga0501072_0062943
595 Ga0501072_0286997
596 Ga0501072_0292856
597 Ga0501075_0032876
598 Ga0501076_0016607
599 Ga0501077_0054618
600 Ga0501080_0089080
601 Ga0501081_0059748
602 Ga0501083_0063914
603 Ga0501035_0020563
604 Ga0501035_0095360
605 Ga0501035_0108913
606 Ga0501044_0001031
607 Ga0501044_0018684
608 Ga0501044_0042699
609 Ga0501044_0043258
610 Ga0501044_0113121
611 Ga0501045_0034183
612 Ga0501045_0271797
613 nmdc:mga03683_16445_c1
614 nmdc:mga03683_1984_c1
615 nmdc:mga03n38_2446_c1
616 nmdc:mga03n38_626_c1
617 nmdc:mga03n38_8814_c1
618 nmdc:mga00v17_4573_c1
619 nmdc:mga0yw44_301_c1
620 nmdc:mga0yw44_91483_c1
621 nmdc:mga0yw44_96535_c1
622 nmdc:mga06z11_11970_c1
623 nmdc:mga06z11_15654_c1
624 nmdc:mga06z11_283_c1
625 nmdc:mga06z11_2928_c1
626 nmdc:mga06z11_7004_c1
627 nmdc:mga04h51_392_c1
628 nmdc:mga04h51_409_c1
629 nmdc:mga07m45_93446_c1
630 nmdc:mga05p37_1068_c1
631 nmdc:mga05p37_40354_c1
632 nmdc:mga05p37_405820_c1
633 nmdc:mga05p37_58449_c2
634 nmdc:mga09592_46360_c1
635 nmdc:mga09592_582_c1
636 nmdc:mga0qj67_14573_c1
637 nmdc:mga0qj67_147149_c1
638 nmdc:mga0qj67_3113_c1
639 nmdc:mga0qj67_8830_c1
640 nmdc:mga06r32_105481_c1
641 nmdc:mga06r32_125_c1
642 nmdc:mga08y16_184002_c1
643 nmdc:mga08y16_21548_c1
644 nmdc:mga08y16_835_c1
645 nmdc:mga0n895_10797_c1
646 nmdc:mga0rr50_17128_c1
647 nmdc:mga08x19_150964_c1
648 nmdc:mga0a205_266118_c1
649 nmdc:mga0sz30_495_c1
650 Ga0500641_0036746
651 Ga0500616_0003466
652 Ga0501084_0033482
653 Ga0590071_007621
654 Ga0501082_0039234
655 Ga0501082_0069159
656 Ga0530510_0028707
657 2855730945
658 2855770454
659 2881414657
660 2920763971

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

38

181

0.96

PF08402

TOBE_2

TOBE domain

295

369

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
2onk-assembly1.cif.gz_B abc transporter modbc in complex with its binding protein moda 0.9562 3 233
7ahe-assembly1.cif.gz_C opua inhibited inward facing 0.9518 3 237
1f3o-assembly1.cif.gz_A-2 crystal structure of mj0796 atp-binding cassette 0.9449 4 217
5xu1-assembly1.cif.gz_B structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.944 1 216
5xu1-assembly1.cif.gz_A structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.9435 1 216
ID Description Score Start End Superfamily
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.987 1 217 3.40.50.300
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9781 1 217 3.40.50.300
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9738 4 216 3.40.50.300
1oxuA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.969 1 235 3.40.50.300
af_P33360_1_239_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9648 4 233 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A848WQ45-F1-model_v4 ABC transporter ATP-binding protein 0.9926 2 235 GO:0005524
GO:0016887
AF-A0A528M0S6-F1-model_v4 ABC transporter ATP-binding protein 0.9852 2 197 GO:0005524
GO:0005886
GO:0015408
GO:0016887
AF-A0A5J4F8B2-F1-model_v4 Sulfate/thiosulfate import ATP-binding protein CysA (EC 3.6.3.25) 0.9808 1 240 GO:0005524
GO:0015419
GO:0016887
GO:0043190
AF-A0A7J3BDG1-F1-model_v4 Molybdate/tungstate import ATP-binding protein WtpC (EC 7.3.2.6) 0.9807 1 225 GO:0005524
GO:0016887
AF-A0A0D6JVA7-F1-model_v4 Molybdate/tungstate import ATP-binding protein WtpC (EC 7.3.2.6) 0.9792 1 234 GO:0005524
GO:0016887

Map