F409818

General Info

Members Datasets Scaffolds Average Seq Length
329 153 295 251

Family's Representative Sequence

Representative Sequence 3300046523|Ga0495644_0006015|Ga0495644_0006015_1408_2220
Length 270
Sequence VGKNRQLIPHLNFFNFQEYTMNTIIRTASALALALVATTSAMAAPVKNIVLVHGFFADGSGWKGVADILQRDGYQVAVVQQPETSFEEDVKVANRAIETFDGNSILVGHSYGGMVITEAGVNPKVAGLVYVSAFQPDVGESLLTLVKKTPPAGESIKATADGYLYVDPAQFHADFAADVPASDARFMALSQVMPTVKTAGTAVTHAAWQNKPSWAVITTADRTVNPDLQRYMAARAGSKVVDLNGSHAAFIAHPEQVAQVIEQAAQQTGQ

Samples

Sample ID Description Type Environment
1 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
2 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
3 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
4 2738541297 Duganella sp. GV083 Isolate Unclassified
5 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
6 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
7 2738541357 Duganella sp. GV053 Isolate Unclassified
8 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
9 2738543003 Duganella sp. GV066 Isolate Unclassified
10 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
11 2738543026 Duganella sp. GV089 Isolate Unclassified
12 2738543029 Duganella sp. GV039 Isolate Unclassified
13 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
14 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
15 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
16 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
17 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
18 2857553236 Duganella sp. R-74557 Isolate Unclassified
19 2857558681 Duganella sp. R-74565 Isolate Unclassified
20 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
21 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
22 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
23 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
24 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
25 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
26 2919085039 Luteibacter sp. 1214 Isolate Unclassified
27 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
28 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
29 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
30 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
31 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
32 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
42 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
45 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
46 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
47 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
53 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
54 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
55 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
56 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
57 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
58 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
59 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
60 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
61 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
62 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
63 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
64 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
65 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
66 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
67 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
68 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
69 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
70 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
71 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
72 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
73 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
74 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
75 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
76 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
77 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
78 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
79 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
80 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
81 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
82 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
83 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
84 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
85 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
86 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
87 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
88 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
89 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
90 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
91 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
92 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
93 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
94 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
95 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
96 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
97 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
98 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
99 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
100 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
101 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
102 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
103 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
104 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
105 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
106 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
107 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
108 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
109 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
110 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
111 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
112 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
113 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
114 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
115 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
116 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
117 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
118 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
119 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
120 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
121 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
122 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
123 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
124 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
125 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
126 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
127 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
128 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
129 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
130 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
131 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
132 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
133 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
134 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
135 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
136 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
137 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
138 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
139 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
140 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
141 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
142 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
143 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
144 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
145 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
146 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
147 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
148 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
149 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
150 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
151 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
152 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
153 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.27
Metatranscriptomes 0
Isolates 9.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.52
Nodule 1.52
Rhizoplane 0.91
Rhizosphere 82.37
Stem 0
Stem Tuber 0
Unclassified 13.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10003069 3300001979 Bacteria 7384
2 JGI24735J21928_10000100 3300002067 Bacteria 31893
3 JGI24738J21930_10005205 3300002075 Bacteria 3138
4 Ga0068855_100007328 3300005563 Bacteria 13367
5 Ga0068855_100229017 3300005563 Bacteria 2082
6 Ga0068856_100050602 3300005614 Bacteria 4096
7 Ga0068852_100003553 3300005616 Bacteria 10910
8 Ga0070717_10057352 3300006028 Bacteria 3219
9 Ga0105251_10040409 3300009011 Bacteria 2274
10 Ga0105240_10000344 3300009093 Bacteria 87083
11 Ga0105240_10008507 3300009093 Bacteria 14678
12 Ga0105238_10013799 3300009551 Bacteria 8167
13 Ga0105238_10178040 3300009551 Bacteria 2103
14 Ga0105239_10081533 3300010375 Bacteria 3561
15 Ga0105239_10126760 3300010375 Bacteria 2838
16 Ga0157373_10140179 3300013100 Bacteria 1700
17 Ga0157370_10000580 3300013104 Bacteria 45646
18 Ga0157370_10071385 3300013104 Bacteria 3276
19 Ga0157369_10022484 3300013105 Bacteria 7034
20 Ga0182005_1000027 3300015265 Bacteria 223652
21 Ga0163161_10004221 3300017792 Bacteria 10032
22 Ga0163161_10239042 3300017792 Bacteria 1412
23 Ga0213872_10184375 3300021361 Bacteria 900
24 Ga0207647_10004481 3300025904 Bacteria 10346
25 Ga0207647_10008988 3300025904 Bacteria 7117
26 Ga0207695_10001973 3300025913 Bacteria 31760
27 Ga0207695_10007168 3300025913 Bacteria 14267
28 Ga0207671_10184424 3300025914 Bacteria 1625
29 Ga0207694_10021793 3300025924 Bacteria 4856
30 Ga0207698_10023552 3300026142 Bacteria 4303
31 Ga0307408_100207325 3300031548 Bacteria 1590
32 Ga0307405_10079449 3300031731 Bacteria 2138
33 Ga0307412_10000003 3300031911 Bacteria 659081
34 Ga0307412_10000397 3300031911 Bacteria 26515
35 Ga0307412_10218174 3300031911 Bacteria 1460
36 Ga0436361_0157522 3300039447 Bacteria 2032
37 Ga0495617_000023 3300046452 Bacteria 183865
38 Ga0495617_000028 3300046452 Bacteria 156686
39 Ga0495627_039904 3300046453 Bacteria 1447
40 Ga0495592_0000095 3300046454 Bacteria 78711
41 Ga0495592_0011170 3300046454 Bacteria 6782
42 Ga0495603_0032022 3300046455 Bacteria 3165
43 Ga0495603_0239589 3300046455 Bacteria 1045
44 Ga0495590_0000013 3300046457 Bacteria 271977
45 Ga0495590_0000172 3300046457 Bacteria 38059
46 Ga0495591_000109 3300046458 Bacteria 94877
47 Ga0495629_0001265 3300046459 Bacteria 19875
48 Ga0495629_0014296 3300046459 Bacteria 5712
49 Ga0495638_0068866 3300046460 Bacteria 2169
50 Ga0495641_0039496 3300046461 Bacteria 2201
51 Ga0495641_0127242 3300046461 Bacteria 1137
52 Ga0495653_0003706 3300046463 Bacteria 12356
53 Ga0495653_0151025 3300046463 Bacteria 1623
54 Ga0495650_0000108 3300046471 Bacteria 200369
55 Ga0495650_0000336 3300046471 Bacteria 83752
56 Ga0495650_0007411 3300046471 Bacteria 6600
57 Ga0495650_0018370 3300046471 Bacteria 3476
58 Ga0495650_0100378 3300046471 Bacteria 1087
59 Ga0495580_0036754 3300046472 Bacteria 3515
60 Ga0495582_0023197 3300046473 Bacteria 3394
61 Ga0495582_0031834 3300046473 Bacteria 2900
62 Ga0495605_0006763 3300046474 Bacteria 6553
63 Ga0495605_0022206 3300046474 Bacteria 3354
64 Ga0495662_0113310 3300046476 Bacteria 1330
65 Ga0495664_0003261 3300046477 Bacteria 8816
66 Ga0495664_0219998 3300046477 Bacteria 1149
67 Ga0495584_0000158 3300046491 Bacteria 47396
68 Ga0495584_0005926 3300046491 Bacteria 6439
69 Ga0495585_0000304 3300046492 Bacteria 49074
70 Ga0495585_0005179 3300046492 Bacteria 8275
71 Ga0495585_0014320 3300046492 Bacteria 4622
72 Ga0495585_0024377 3300046492 Bacteria 3469
73 Ga0495585_0060062 3300046492 Bacteria 2093
74 Ga0495596_0000371 3300046500 Bacteria 28783
75 Ga0495596_0003828 3300046500 Bacteria 7487
76 Ga0495596_0004701 3300046500 Bacteria 6598
77 Ga0495596_0024746 3300046500 Bacteria 2430
78 Ga0495596_0024948 3300046500 Bacteria 2418
79 Ga0495607_0000479 3300046501 Bacteria 40004
80 Ga0495607_0001248 3300046501 Bacteria 22826
81 Ga0495607_0003034 3300046501 Bacteria 13096
82 Ga0495607_0055104 3300046501 Bacteria 2288
83 Ga0495607_0123971 3300046501 Bacteria 1353
84 Ga0495583_0001888 3300046506 Bacteria 19427
85 Ga0495583_0006960 3300046506 Bacteria 7245
86 Ga0495606_0000007 3300046507 Bacteria 323713
87 Ga0495606_0000073 3300046507 Bacteria 171657
88 Ga0495606_0001469 3300046507 Bacteria 31493
89 Ga0495606_0001523 3300046507 Bacteria 30685
90 Ga0495606_0003757 3300046507 Bacteria 15802
91 Ga0495606_0004327 3300046507 Bacteria 14287
92 Ga0495606_0015094 3300046507 Bacteria 5977
93 Ga0495606_0069989 3300046507 Bacteria 2215
94 Ga0495606_0069995 3300046507 Bacteria 2214
95 Ga0495606_0216916 3300046507 Bacteria 1080
96 Ga0495608_0142169 3300046511 Bacteria 1531
97 Ga0495610_0000007 3300046512 Bacteria 820919
98 Ga0495610_0000313 3300046512 Bacteria 51404
99 Ga0495610_0000839 3300046512 Bacteria 28605
100 Ga0495610_0008116 3300046512 Bacteria 6862
101 Ga0495616_0000023 3300046513 Bacteria 147717
102 Ga0495616_0000129 3300046513 Bacteria 66170
103 Ga0495616_0003218 3300046513 Bacteria 10525
104 Ga0495616_0119678 3300046513 Bacteria 1217
105 Ga0495618_0013899 3300046514 Bacteria 4899
106 Ga0495620_0000046 3300046515 Bacteria 108205
107 Ga0495628_0013973 3300046516 Bacteria 6740
108 Ga0495628_0022262 3300046516 Bacteria 5206
109 Ga0495630_0132738 3300046517 Bacteria 1891
110 Ga0495630_0257354 3300046517 Bacteria 1333
111 Ga0495631_0003716 3300046518 Bacteria 8322
112 Ga0495631_0004385 3300046518 Bacteria 7517
113 Ga0495631_0005552 3300046518 Bacteria 6593
114 Ga0495632_0000279 3300046519 Bacteria 50089
115 Ga0495632_0003100 3300046519 Bacteria 12043
116 Ga0495632_0034670 3300046519 Bacteria 2580
117 Ga0495632_0110581 3300046519 Bacteria 1290
118 Ga0495637_0000008 3300046520 Bacteria 404658
119 Ga0495637_0000528 3300046520 Bacteria 27567
120 Ga0495637_0158751 3300046520 Bacteria 849
121 Ga0495643_0000459 3300046522 Bacteria 51854
122 Ga0495643_0021148 3300046522 Bacteria 3738
123 Ga0495643_0033376 3300046522 Bacteria 2848
124 Ga0495644_0006015 3300046523 Bacteria 4727
125 Ga0495644_0020538 3300046523 Bacteria 2520
126 Ga0495644_0046945 3300046523 Bacteria 1623
127 Ga0495648_0001043 3300046524 Bacteria 28117
128 Ga0495648_0006050 3300046524 Bacteria 9928
129 Ga0495648_0009615 3300046524 Bacteria 7462
130 Ga0495648_0010062 3300046524 Bacteria 7245
131 Ga0495648_0034243 3300046524 Bacteria 3307
132 Ga0495666_0003741 3300046526 Bacteria 7686
133 Ga0495666_0005673 3300046526 Bacteria 6288
134 Ga0495652_0022518 3300046529 Bacteria 5591
135 Ga0495652_0084748 3300046529 Bacteria 2605
136 Ga0495652_0296050 3300046529 Bacteria 1178
137 Ga0495654_0000038 3300046530 Bacteria 185693
138 Ga0495654_0002640 3300046530 Bacteria 11403
139 Ga0495665_0094678 3300046531 Bacteria 1568
140 Ga0495640_0048395 3300046533 Bacteria 2938
141 Ga0495609_0001192 3300046538 Bacteria 17878
142 Ga0495609_0001197 3300046538 Bacteria 17857
143 Ga0495597_0012324 3300046542 Bacteria 4125
144 Ga0495645_0063421 3300046543 Bacteria 2676
145 Ga0495622_0001172 3300046557 Bacteria 13567
146 Ga0495633_0000132 3300046558 Bacteria 100231
147 Ga0495633_0000671 3300046558 Bacteria 31589
148 Ga0495633_0002160 3300046558 Bacteria 14100
149 Ga0495667_0136161 3300046559 Bacteria 1583
150 Ga0495667_0270647 3300046559 Bacteria 1079
151 Ga0495656_0038798 3300046615 Bacteria 1975
152 Ga0495668_0000117 3300046616 Bacteria 122379
153 Ga0495668_0000146 3300046616 Bacteria 106276
154 Ga0495668_0122421 3300046616 Bacteria 1423
155 Ga0495634_0010562 3300046642 Bacteria 6760
156 Ga0495634_0014374 3300046642 Bacteria 5709
157 Ga0495611_0000006 3300046648 Bacteria 249842
158 Ga0495611_0000214 3300046648 Bacteria 40851
159 Ga0495611_0002426 3300046648 Bacteria 8535
160 Ga0495611_0071337 3300046648 Bacteria 1588
161 Ga0495625_0001913 3300046660 Bacteria 23538
162 Ga0495625_0020252 3300046660 Bacteria 5139
163 Ga0495625_0058188 3300046660 Bacteria 2747
164 Ga0495625_0224325 3300046660 Bacteria 1230
165 Ga0495635_0003586 3300046663 Bacteria 10741
166 Ga0495635_0017720 3300046663 Bacteria 4974
167 Ga0495661_0009220 3300046665 Bacteria 6782
168 Ga0495661_0028734 3300046665 Bacteria 3556
169 Ga0495661_0057056 3300046665 Bacteria 2333
170 Ga0495661_0138627 3300046665 Bacteria 1325
171 Ga0495661_0178620 3300046665 Bacteria 1126
172 Ga0495623_0037855 3300046679 Bacteria 3085
173 Ga0495623_0039375 3300046679 Bacteria 3021
174 Ga0495646_0006079 3300046680 Bacteria 7655
175 Ga0495646_0085418 3300046680 Bacteria 1831
176 Ga0495669_0051442 3300046684 Bacteria 1849
177 Ga0495624_0122334 3300046690 Bacteria 1597
178 Ga0495671_0000009 3300046692 Bacteria 369875
179 Ga0495671_0020005 3300046692 Bacteria 3532
180 Ga0495671_0168142 3300046692 Bacteria 1066
181 Ga0495649_0000535 3300046694 Bacteria 32186
182 Ga0495649_0006070 3300046694 Bacteria 7553
183 Ga0495649_0007247 3300046694 Bacteria 6792
184 Ga0495649_0017816 3300046694 Bacteria 4004
185 Ga0495649_0045822 3300046694 Bacteria 2382
186 Ga0495649_0143770 3300046694 Bacteria 1254
187 Ga0495589_0000293 3300046794 Bacteria 40161
188 Ga0495589_0007104 3300046794 Bacteria 5869
189 Ga0495589_0007998 3300046794 Bacteria 5532
190 Ga0495589_0019173 3300046794 Bacteria 3509
191 Ga0495589_0045338 3300046794 Bacteria 2184
192 Ga0495589_0068797 3300046794 Bacteria 1732
193 Ga0495600_0000405 3300046809 Bacteria 22251
194 Ga0495600_0235239 3300046809 Bacteria 1168
195 Ga0495660_0001692 3300046810 Bacteria 14755
196 Ga0495660_0017961 3300046810 Bacteria 4070
197 Ga0495660_0026237 3300046810 Bacteria 3304
198 Ga0495660_0032848 3300046810 Bacteria 2913
199 Ga0495660_0057285 3300046810 Bacteria 2102
200 Ga0495660_0081092 3300046810 Bacteria 1701
201 Ga0495660_0121841 3300046810 Bacteria 1318
202 Ga0495660_0171576 3300046810 Bacteria 1056
203 Ga0495581_0008153 3300047315 Bacteria 6065
204 Ga0495581_0058370 3300047315 Bacteria 2228
205 Ga0495604_0052311 3300047317 Bacteria 3163
206 Ga0495674_0005712 3300047319 Bacteria 11916
207 Ga0495672_0000013 3300047320 Bacteria 511827
208 Ga0495672_0000033 3300047320 Bacteria 291992
209 Ga0495672_0000386 3300047320 Bacteria 54325
210 Ga0495672_0000530 3300047320 Bacteria 43361
211 Ga0495672_0007770 3300047320 Bacteria 8019
212 Ga0495676_0145888 3300047321 Bacteria 1690
213 Ga0495680_0120168 3300047322 Bacteria 1940
214 Ga0495683_0000301 3300047323 Bacteria 41920
215 Ga0495683_0004755 3300047323 Bacteria 7629
216 Ga0495683_0006276 3300047323 Bacteria 6505
217 Ga0495683_0008111 3300047323 Bacteria 5639
218 Ga0495683_0035945 3300047323 Bacteria 2517
219 Ga0495683_0048752 3300047323 Bacteria 2123
220 Ga0495683_0115121 3300047323 Bacteria 1280
221 Ga0495687_009705 3300047443 Bacteria 5351
222 Ga0495687_017503 3300047443 Bacteria 3573
223 Ga0495675_0000913 3300047444 Bacteria 17968
224 Ga0495675_0083491 3300047444 Bacteria 2010
225 Ga0495677_0000270 3300047445 Bacteria 22801
226 Ga0495677_0174783 3300047445 Bacteria 832
227 Ga0495679_002632 3300047446 Bacteria 9014
228 Ga0495679_009764 3300047446 Bacteria 3814
229 Ga0495673_0000015 3300047469 Bacteria 598766
230 Ga0495673_0000018 3300047469 Bacteria 569190
231 Ga0495673_0000032 3300047469 Bacteria 375856
232 Ga0495673_0001311 3300047469 Bacteria 20250
233 Ga0495673_0004789 3300047469 Bacteria 8371
234 Ga0495673_0053940 3300047469 Bacteria 1750
235 Ga0495681_0012883 3300047470 Bacteria 4887
236 Ga0495681_0018426 3300047470 Bacteria 3846
237 Ga0495681_0043489 3300047470 Bacteria 2165
238 Ga0495681_0051168 3300047470 Bacteria 1944
239 Ga0495681_0180214 3300047470 Bacteria 868
240 Ga0495686_0001166 3300047472 Bacteria 30748
241 Ga0495686_0001425 3300047472 Bacteria 26145
242 Ga0495686_0015119 3300047472 Bacteria 5286
243 Ga0495686_0023268 3300047472 Bacteria 4088
244 Ga0495686_0055268 3300047472 Bacteria 2483
245 Ga0495686_0128739 3300047472 Bacteria 1503
246 Ga0495593_0005177 3300047673 Bacteria 7710
247 Ga0495602_0081546 3300048088 Bacteria 2719
248 Ga0495602_0143554 3300048088 Bacteria 1886
249 Ga0495614_0003214 3300048089 Bacteria 7297
250 Ga0495614_0052420 3300048089 Bacteria 1748
251 Ga0495626_0000017 3300048091 Bacteria 231648
252 Ga0495626_0010068 3300048091 Bacteria 5074
253 Ga0495626_0011774 3300048091 Bacteria 4610
254 Ga0495626_0018119 3300048091 Bacteria 3543
255 Ga0495626_0098046 3300048091 Bacteria 1280
256 Ga0495626_0159046 3300048091 Bacteria 948
257 Ga0496102_0002275 3300048905 Bacteria 16433
258 Ga0496103_0014803 3300048906 Bacteria 4637
259 Ga0496116_0071823 3300048919 Bacteria 2190
260 Ga0496117_0004819 3300048920 Bacteria 14599
261 Ga0496117_0041724 3300048920 Bacteria 3357
262 Ga0496118_0000120 3300048921 Bacteria 142952
263 Ga0496118_0012505 3300048921 Bacteria 8138
264 Ga0496118_0192263 3300048921 Bacteria 1219
265 Ga0496121_0004358 3300048924 Bacteria 19124
266 Ga0496121_0014071 3300048924 Bacteria 8535
267 Ga0496121_0014387 3300048924 Bacteria 8401
268 Ga0496121_0082408 3300048924 Bacteria 2543
269 Ga0496121_0132320 3300048924 Bacteria 1864
270 Ga0496122_0000225 3300048925 Bacteria 126304
271 Ga0496122_0024460 3300048925 Bacteria 5285
272 Ga0496122_0025240 3300048925 Bacteria 5169
273 Ga0496122_0259201 3300048925 Bacteria 966
274 Ga0496123_0000192 3300048926 Bacteria 124096
275 Ga0496123_0006229 3300048926 Bacteria 11641
276 Ga0496123_0021889 3300048926 Bacteria 4951
277 Ga0496124_0039688 3300048927 Bacteria 4078
278 Ga0496124_0216837 3300048927 Bacteria 1443
279 Ga0496124_0409671 3300048927 Bacteria 938
280 Ga0496125_0000947 3300048928 Bacteria 45544
281 Ga0496125_0057727 3300048928 Bacteria 3140
282 Ga0496126_0018125 3300048929 Bacteria 6988
283 Ga0495678_000009 3300049459 Bacteria 373806
284 Ga0495678_000024 3300049459 Bacteria 229034
285 Ga0495678_000203 3300049459 Bacteria 69724
286 Ga0495678_007634 3300049459 Bacteria 5580
287 Ga0495678_065907 3300049459 Bacteria 1343
288 Ga0495678_083875 3300049459 Bacteria 1138
289 Ga0495682_0000716 3300049460 Bacteria 21678
290 Ga0495682_0003270 3300049460 Bacteria 7251
291 Ga0500618_000882 3300053125 Bacteria 15914
292 Ga0500618_002626 3300053125 Bacteria 6621
293 Ga0500559_0000432 3300053136 Bacteria 29680
294 Ga0500586_000034 3300053145 Bacteria 24197
295 Ga0500586_000077 3300053145 Bacteria 16839

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046507 Ga0495606_0003757 Ga0495606_0003757_8933_9691 225
2 3300046463 Ga0495653_0151025 Ga0495653_0151025_515_1276 227
3 3300046692 Ga0495671_0000009 Ga0495671_0000009_65496_66257 227
4 3300046694 Ga0495649_0143770 Ga0495649_0143770_412_1101 229
5 3300046452 Ga0495617_000023 Ga0495617_000023_58719_59480 231
6 3300046471 Ga0495650_0000336 Ga0495650_0000336_23717_24478 231
7 3300046530 Ga0495654_0002640 Ga0495654_0002640_7512_8273 231
8 3300046616 Ga0495668_0000117 Ga0495668_0000117_93994_94755 231
9 3300046660 Ga0495625_0058188 Ga0495625_0058188_1708_2469 231
10 3300046665 Ga0495661_0028734 Ga0495661_0028734_355_1116 231
11 3300046692 Ga0495671_0020005 Ga0495671_0020005_590_1351 231
12 3300046810 Ga0495660_0001692 Ga0495660_0001692_7054_7815 231
13 3300047323 Ga0495683_0008111 Ga0495683_0008111_1160_1921 231
14 3300047446 Ga0495679_009764 Ga0495679_009764_1920_2681 231
15 3300047469 Ga0495673_0000032 Ga0495673_0000032_231508_232269 231
16 3300047472 Ga0495686_0128739 Ga0495686_0128739_711_1472 231
17 3300048925 Ga0496122_0259201 Ga0496122_0259201_108_869 231
18 3300053145 Ga0500586_000077 Ga0500586_000077_7575_8336 231
19 3300046520 Ga0495637_0000528 Ga0495637_0000528_19188_19958 234
20 3300046530 Ga0495654_0000038 Ga0495654_0000038_64488_65258 234
21 3300048924 Ga0496121_0132320 Ga0496121_0132320_412_1170 237
22 3300048927 Ga0496124_0216837 Ga0496124_0216837_135_893 237
23 3300006028 Ga0070717_10057352 Ga0070717_100573522 238
24 3300046524 Ga0495648_0034243 Ga0495648_0034243_734_1501 238
25 3300047470 Ga0495681_0012883 Ga0495681_0012883_709_1461 238
26 3300049459 Ga0495678_000009 Ga0495678_000009_162669_163421 238
27 3300046519 Ga0495632_0000279 Ga0495632_0000279_19939_20706 239
28 3300046492 Ga0495585_0060062 Ga0495585_0060062_415_1173 240
29 3300046500 Ga0495596_0024746 Ga0495596_0024746_235_993 240
30 3300046507 Ga0495606_0000007 Ga0495606_0000007_18052_18822 240
31 3300046648 Ga0495611_0002426 Ga0495611_0002426_5311_6069 240
32 3300046665 Ga0495661_0057056 Ga0495661_0057056_752_1510 240
33 3300046794 Ga0495589_0000293 Ga0495589_0000293_6252_7010 240
34 3300047472 Ga0495686_0001166 Ga0495686_0001166_14672_15460 240
35 3300048927 Ga0496124_0039688 Ga0496124_0039688_1775_2548 240
36 3300046507 Ga0495606_0015094 Ga0495606_0015094_86_853 242
37 3300046648 Ga0495611_0000006 Ga0495611_0000006_164975_165742 242
38 3300047472 Ga0495686_0023268 Ga0495686_0023268_3021_3788 242
39 3300049459 Ga0495678_065907 Ga0495678_065907_21_788 242
40 3300046512 Ga0495610_0008116 Ga0495610_0008116_1238_2005 243
41 3300046810 Ga0495660_0057285 Ga0495660_0057285_1141_1893 243
42 3300046616 Ga0495668_0000146 Ga0495668_0000146_18444_19226 244
43 iso_pu_bacteria 2946019816 2946022075 244
44 3300046492 Ga0495585_0000304 Ga0495585_0000304_23538_24299 245
45 3300046538 Ga0495609_0001197 Ga0495609_0001197_12040_12804 245
46 3300046519 Ga0495632_0110581 Ga0495632_0110581_264_1004 246
47 3300046810 Ga0495660_0032848 Ga0495660_0032848_2108_2848 246
48 3300047320 Ga0495672_0000013 Ga0495672_0000013_204205_204945 246
49 iso_pu_bacteria 2857553236 2857557983 246
50 iso_pu_bacteria 2884791551 2884792564 247
51 3300048925 Ga0496122_0024460 Ga0496122_0024460_1383_2153 248
52 3300048926 Ga0496123_0006229 Ga0496123_0006229_4503_5264 248
53 iso_pu_bacteria 2857558681 2857558906 248
54 3300046558 Ga0495633_0000132 Ga0495633_0000132_5934_6683 249
55 iso_pu_bacteria 2738541297 2738827610 249
56 iso_pu_bacteria 2738541357 2739151406 249
57 iso_pu_bacteria 2738543003 2739193326 249
58 iso_pu_bacteria 2738543026 2739319802 249
59 iso_pu_bacteria 2738543029 2739338043 249
60 iso_pu_bacteria 2884811622 2884813449 249
61 iso_pu_bacteria 2884811622 2884813534 249
62 iso_pu_bacteria 2884836552 2884838343 249
63 iso_pu_bacteria 2884852848 2884854635 249
64 iso_pu_bacteria 2896154374 2896156697 249
65 3300046457 Ga0495590_0000013 Ga0495590_0000013_228246_229004 250
66 3300046457 Ga0495590_0000172 Ga0495590_0000172_24965_25735 250
67 3300046458 Ga0495591_000109 Ga0495591_000109_57574_58326 250
68 3300046471 Ga0495650_0007411 Ga0495650_0007411_4593_5345 250
69 3300046474 Ga0495605_0006763 Ga0495605_0006763_1279_2031 250
70 3300046491 Ga0495584_0000158 Ga0495584_0000158_37240_37992 250
71 3300046492 Ga0495585_0005179 Ga0495585_0005179_84_836 250
72 3300046492 Ga0495585_0014320 Ga0495585_0014320_3392_4144 250
73 3300046501 Ga0495607_0000479 Ga0495607_0000479_2315_3067 250
74 3300046506 Ga0495583_0001888 Ga0495583_0001888_8562_9314 250
75 3300046507 Ga0495606_0004327 Ga0495606_0004327_8945_9697 250
76 3300046507 Ga0495606_0216916 Ga0495606_0216916_37_789 250
77 3300046512 Ga0495610_0000313 Ga0495610_0000313_23699_24451 250
78 3300046518 Ga0495631_0004385 Ga0495631_0004385_2563_3315 250
79 3300046518 Ga0495631_0005552 Ga0495631_0005552_5806_6558 250
80 3300046519 Ga0495632_0034670 Ga0495632_0034670_1002_1754 250
81 3300046520 Ga0495637_0000008 Ga0495637_0000008_42715_43467 250
82 3300046522 Ga0495643_0033376 Ga0495643_0033376_1798_2550 250
83 3300046558 Ga0495633_0002160 Ga0495633_0002160_7276_8028 250
84 3300046615 Ga0495656_0038798 Ga0495656_0038798_1047_1799 250
85 3300046648 Ga0495611_0000214 Ga0495611_0000214_8208_8960 250
86 3300046665 Ga0495661_0138627 Ga0495661_0138627_557_1309 250
87 3300046694 Ga0495649_0000535 Ga0495649_0000535_9629_10381 250
88 3300046794 Ga0495589_0019173 Ga0495589_0019173_1062_1814 250
89 3300046810 Ga0495660_0121841 Ga0495660_0121841_195_947 250
90 3300047320 Ga0495672_0000033 Ga0495672_0000033_224617_225369 250
91 3300047323 Ga0495683_0000301 Ga0495683_0000301_32070_32822 250
92 3300047323 Ga0495683_0115121 Ga0495683_0115121_357_1118 250
93 3300047445 Ga0495677_0000270 Ga0495677_0000270_20402_21154 250
94 3300047446 Ga0495679_002632 Ga0495679_002632_5914_6666 250
95 3300047470 Ga0495681_0018426 Ga0495681_0018426_1642_2394 250
96 3300047470 Ga0495681_0180214 Ga0495681_0180214_19_771 250
97 3300047472 Ga0495686_0055268 Ga0495686_0055268_723_1475 250
98 3300048091 Ga0495626_0010068 Ga0495626_0010068_15_767 250
99 3300048091 Ga0495626_0098046 Ga0495626_0098046_15_767 250
100 3300048929 Ga0496126_0018125 Ga0496126_0018125_5899_6651 250
101 3300049459 Ga0495678_000024 Ga0495678_000024_166725_167477 250
102 3300046471 Ga0495650_0000108 Ga0495650_0000108_166278_167042 251
103 3300046471 Ga0495650_0000108 Ga0495650_0000108_95778_96533 251
104 3300046474 Ga0495605_0022206 Ga0495605_0022206_1918_2682 251
105 3300046500 Ga0495596_0000371 Ga0495596_0000371_23543_24298 251
106 3300046500 Ga0495596_0003828 Ga0495596_0003828_4092_4850 251
107 3300046500 Ga0495596_0004701 Ga0495596_0004701_299_1063 251
108 3300046500 Ga0495596_0024948 Ga0495596_0024948_625_1383 251
109 3300046507 Ga0495606_0069995 Ga0495606_0069995_1148_1906 251
110 3300046513 Ga0495616_0003218 Ga0495616_0003218_5636_6394 251
111 3300046518 Ga0495631_0003716 Ga0495631_0003716_1825_2583 251
112 3300046520 Ga0495637_0158751 Ga0495637_0158751_21_785 251
113 3300046523 Ga0495644_0020538 Ga0495644_0020538_395_1153 251
114 3300046524 Ga0495648_0001043 Ga0495648_0001043_2771_3535 251
115 3300046524 Ga0495648_0006050 Ga0495648_0006050_2481_3236 251
116 3300046538 Ga0495609_0001192 Ga0495609_0001192_5504_6259 251
117 3300046542 Ga0495597_0012324 Ga0495597_0012324_2381_3139 251
118 3300046694 Ga0495649_0017816 Ga0495649_0017816_1402_2160 251
119 3300046794 Ga0495589_0007104 Ga0495589_0007104_1290_2045 251
120 3300046794 Ga0495589_0045338 Ga0495589_0045338_1140_1904 251
121 3300046794 Ga0495589_0068797 Ga0495589_0068797_178_936 251
122 3300046810 Ga0495660_0026237 Ga0495660_0026237_1223_1978 251
123 3300047320 Ga0495672_0000386 Ga0495672_0000386_8154_8918 251
124 3300047320 Ga0495672_0000530 Ga0495672_0000530_34935_35690 251
125 3300047445 Ga0495677_0174783 Ga0495677_0174783_14_772 251
126 3300047470 Ga0495681_0043489 Ga0495681_0043489_186_944 251
127 3300048091 Ga0495626_0018119 Ga0495626_0018119_313_1071 251
128 3300048091 Ga0495626_0159046 Ga0495626_0159046_145_909 251
129 3300048905 Ga0496102_0002275 Ga0496102_0002275_2451_3224 251
130 3300048906 Ga0496103_0014803 Ga0496103_0014803_1970_2743 251
131 3300048920 Ga0496117_0004819 Ga0496117_0004819_12180_12953 251
132 3300048921 Ga0496118_0000120 Ga0496118_0000120_27084_27857 251
133 3300049459 Ga0495678_000203 Ga0495678_000203_62342_63100 251
134 3300049460 Ga0495682_0000716 Ga0495682_0000716_14315_15073 251
135 iso_pu_bacteria 2842324504 2842326875 251
136 iso_pu_bacteria 2842348783 2842350480 251
137 iso_pu_bacteria 2842454564 2842456752 251
138 iso_pu_bacteria 2842914999 2842916086 251
139 iso_pu_bacteria 2857357740 2857357959 251
140 iso_pu_bacteria 2919085039 2919086669 251
141 3300009093 Ga0105240_10008507 Ga0105240_100085075 252
142 3300025913 Ga0207695_10007168 Ga0207695_1000716811 252
143 3300046501 Ga0495607_0001248 Ga0495607_0001248_11233_11994 252
144 3300046513 Ga0495616_0119678 Ga0495616_0119678_218_985 252
145 3300046519 Ga0495632_0003100 Ga0495632_0003100_11079_11840 252
146 3300046522 Ga0495643_0000459 Ga0495643_0000459_43860_44627 252
147 3300046810 Ga0495660_0017961 Ga0495660_0017961_388_1149 252
148 3300046810 Ga0495660_0171576 Ga0495660_0171576_144_902 252
149 3300047469 Ga0495673_0000015 Ga0495673_0000015_48728_49489 252
150 3300048091 Ga0495626_0000017 Ga0495626_0000017_135839_136597 252
151 3300048091 Ga0495626_0011774 Ga0495626_0011774_684_1451 252
152 3300048924 Ga0496121_0014387 Ga0496121_0014387_6364_7122 252
153 3300053125 Ga0500618_002626 Ga0500618_002626_716_1474 252
154 iso_pu_bacteria 2508501125 2509128986 252
155 iso_pu_bacteria 2515154189 2516017482 252
156 iso_pu_bacteria 2738541296 2738821594 252
157 iso_pu_bacteria 2738541298 2738834076 252
158 iso_pu_bacteria 2738541306 2738875280 252
159 iso_pu_bacteria 2738543002 2739187233 252
160 iso_pu_bacteria 2738543008 2739221878 252
161 iso_pu_bacteria 2883087390 2883091618 252
162 iso_pu_bacteria 2945934425 2945936290 252
163 iso_pu_bacteria 2990703756 2990709807 252
164 iso_pu_bacteria 641736151 642425416 252
165 iso_pu_bacteria 8018845410 8018850199 252
166 3300005563 Ga0068855_100007328 Ga0068855_1000073287 253
167 3300005614 Ga0068856_100050602 Ga0068856_1000506025 253
168 3300005616 Ga0068852_100003553 Ga0068852_10000355313 253
169 3300017792 Ga0163161_10239042 Ga0163161_102390421 253
170 3300025913 Ga0207695_10001973 Ga0207695_100019732 253
171 3300025914 Ga0207671_10184424 Ga0207671_101844242 253
172 3300025924 Ga0207694_10021793 Ga0207694_100217935 253
173 3300026142 Ga0207698_10023552 Ga0207698_100235524 253
174 3300046453 Ga0495627_039904 Ga0495627_039904_532_1293 253
175 3300046507 Ga0495606_0000007 Ga0495606_0000007_21924_22685 253
176 3300046512 Ga0495610_0000007 Ga0495610_0000007_435447_436208 253
177 3300046522 Ga0495643_0021148 Ga0495643_0021148_2523_3284 253
178 3300046523 Ga0495644_0006015 Ga0495644_0006015_1408_2220 253
179 3300046524 Ga0495648_0009615 Ga0495648_0009615_6679_7440 253
180 3300046660 Ga0495625_0224325 Ga0495625_0224325_265_1026 253
181 3300046665 Ga0495661_0009220 Ga0495661_0009220_1143_1904 253
182 3300046694 Ga0495649_0045822 Ga0495649_0045822_775_1536 253
183 3300046810 Ga0495660_0081092 Ga0495660_0081092_139_900 253
184 3300047443 Ga0495687_017503 Ga0495687_017503_29_790 253
185 3300048928 Ga0496125_0000947 Ga0496125_0000947_33544_34305 253
186 3300049459 Ga0495678_007634 Ga0495678_007634_3588_4361 253
187 3300053136 Ga0500559_0000432 Ga0500559_0000432_5447_6208 253
188 3300009011 Ga0105251_10040409 Ga0105251_100404092 255
189 3300009093 Ga0105240_10000344 Ga0105240_1000034435 255
190 3300009551 Ga0105238_10013799 Ga0105238_100137998 255
191 3300009551 Ga0105238_10178040 Ga0105238_101780402 255
192 3300010375 Ga0105239_10081533 Ga0105239_100815333 255
193 3300010375 Ga0105239_10126760 Ga0105239_101267603 255
194 3300013100 Ga0157373_10140179 Ga0157373_101401792 255
195 3300013104 Ga0157370_10000580 Ga0157370_1000058037 255
196 3300013104 Ga0157370_10071385 Ga0157370_100713851 255
197 3300015265 Ga0182005_1000027 Ga0182005_1000027166 255
198 3300017792 Ga0163161_10004221 Ga0163161_1000422110 255
199 3300031548 Ga0307408_100207325 Ga0307408_1002073252 255
200 3300031731 Ga0307405_10079449 Ga0307405_100794492 255
201 3300031911 Ga0307412_10218174 Ga0307412_102181741 255
202 3300046452 Ga0495617_000028 Ga0495617_000028_55067_55834 255
203 3300046471 Ga0495650_0018370 Ga0495650_0018370_2665_3432 255
204 3300046471 Ga0495650_0100378 Ga0495650_0100378_257_1024 255
205 3300046491 Ga0495584_0005926 Ga0495584_0005926_4276_5043 255
206 3300046492 Ga0495585_0024377 Ga0495585_0024377_1529_2296 255
207 3300046501 Ga0495607_0003034 Ga0495607_0003034_2940_3707 255
208 3300046501 Ga0495607_0055104 Ga0495607_0055104_99_866 255
209 3300046507 Ga0495606_0000073 Ga0495606_0000073_133718_134485 255
210 3300046507 Ga0495606_0001469 Ga0495606_0001469_6496_7263 255
211 3300046507 Ga0495606_0001523 Ga0495606_0001523_24694_25461 255
212 3300046507 Ga0495606_0069989 Ga0495606_0069989_156_923 255
213 3300046513 Ga0495616_0000023 Ga0495616_0000023_15914_16681 255
214 3300046513 Ga0495616_0000129 Ga0495616_0000129_22509_23276 255
215 3300046515 Ga0495620_0000046 Ga0495620_0000046_43938_44705 255
216 3300046660 Ga0495625_0001913 Ga0495625_0001913_12813_13595 255
217 3300046660 Ga0495625_0020252 Ga0495625_0020252_2620_3387 255
218 3300047323 Ga0495683_0006276 Ga0495683_0006276_4697_5464 255
219 3300047323 Ga0495683_0035945 Ga0495683_0035945_652_1419 255
220 3300047469 Ga0495673_0000018 Ga0495673_0000018_206201_206968 255
221 3300047469 Ga0495673_0004789 Ga0495673_0004789_4885_5652 255
222 3300047470 Ga0495681_0051168 Ga0495681_0051168_963_1730 255
223 3300047472 Ga0495686_0001425 Ga0495686_0001425_5068_5835 255
224 3300047472 Ga0495686_0015119 Ga0495686_0015119_1342_2109 255
225 3300048919 Ga0496116_0071823 Ga0496116_0071823_586_1353 255
226 3300048921 Ga0496118_0192263 Ga0496118_0192263_355_1122 255
227 3300048924 Ga0496121_0004358 Ga0496121_0004358_3869_4636 255
228 3300048924 Ga0496121_0014071 Ga0496121_0014071_848_1615 255
229 3300048924 Ga0496121_0082408 Ga0496121_0082408_1629_2396 255
230 3300048925 Ga0496122_0000225 Ga0496122_0000225_98042_98809 255
231 3300048925 Ga0496122_0025240 Ga0496122_0025240_3412_4179 255
232 3300048926 Ga0496123_0000192 Ga0496123_0000192_27496_28263 255
233 3300048926 Ga0496123_0021889 Ga0496123_0021889_3090_3857 255
234 3300048927 Ga0496124_0409671 Ga0496124_0409671_56_823 255
235 3300048928 Ga0496125_0057727 Ga0496125_0057727_420_1187 255
236 3300049459 Ga0495678_083875 Ga0495678_083875_161_928 255
237 3300053125 Ga0500618_000882 Ga0500618_000882_9120_9899 255
238 3300001979 JGI24740J21852_10003069 JGI24740J21852_100030695 256
239 3300002067 JGI24735J21928_10000100 JGI24735J21928_1000010026 256
240 3300002075 JGI24738J21930_10005205 JGI24738J21930_100052053 256
241 3300005563 Ga0068855_100229017 Ga0068855_1002290172 256
242 3300013105 Ga0157369_10022484 Ga0157369_100224843 256
243 3300021361 Ga0213872_10184375 Ga0213872_101843751 256
244 3300025904 Ga0207647_10004481 Ga0207647_100044818 256
245 3300025904 Ga0207647_10008988 Ga0207647_100089884 256
246 3300031911 Ga0307412_10000003 Ga0307412_10000003575 256
247 3300031911 Ga0307412_10000397 Ga0307412_1000039714 256
248 3300039447 Ga0436361_0157522 Ga0436361_0157522_1105_1881 256
249 3300046454 Ga0495592_0000095 Ga0495592_0000095_1231_2001 256
250 3300046454 Ga0495592_0011170 Ga0495592_0011170_5437_6207 256
251 3300046455 Ga0495603_0032022 Ga0495603_0032022_1879_2649 256
252 3300046455 Ga0495603_0239589 Ga0495603_0239589_220_990 256
253 3300046459 Ga0495629_0001265 Ga0495629_0001265_17764_18534 256
254 3300046459 Ga0495629_0014296 Ga0495629_0014296_3362_4132 256
255 3300046460 Ga0495638_0068866 Ga0495638_0068866_407_1177 256
256 3300046461 Ga0495641_0039496 Ga0495641_0039496_617_1387 256
257 3300046461 Ga0495641_0127242 Ga0495641_0127242_24_794 256
258 3300046463 Ga0495653_0003706 Ga0495653_0003706_10767_11537 256
259 3300046472 Ga0495580_0036754 Ga0495580_0036754_2296_3066 256
260 3300046473 Ga0495582_0023197 Ga0495582_0023197_2121_2891 256
261 3300046473 Ga0495582_0031834 Ga0495582_0031834_497_1267 256
262 3300046476 Ga0495662_0113310 Ga0495662_0113310_464_1234 256
263 3300046477 Ga0495664_0003261 Ga0495664_0003261_2094_2864 256
264 3300046477 Ga0495664_0219998 Ga0495664_0219998_347_1117 256
265 3300046501 Ga0495607_0123971 Ga0495607_0123971_306_1076 256
266 3300046506 Ga0495583_0006960 Ga0495583_0006960_6044_6814 256
267 3300046511 Ga0495608_0142169 Ga0495608_0142169_621_1391 256
268 3300046512 Ga0495610_0000839 Ga0495610_0000839_1359_2129 256
269 3300046514 Ga0495618_0013899 Ga0495618_0013899_1355_2125 256
270 3300046516 Ga0495628_0013973 Ga0495628_0013973_4315_5085 256
271 3300046516 Ga0495628_0022262 Ga0495628_0022262_1944_2714 256
272 3300046517 Ga0495630_0132738 Ga0495630_0132738_719_1489 256
273 3300046517 Ga0495630_0257354 Ga0495630_0257354_376_1146 256
274 3300046523 Ga0495644_0046945 Ga0495644_0046945_639_1409 256
275 3300046524 Ga0495648_0010062 Ga0495648_0010062_6044_6814 256
276 3300046526 Ga0495666_0003741 Ga0495666_0003741_721_1491 256
277 3300046526 Ga0495666_0005673 Ga0495666_0005673_690_1460 256
278 3300046529 Ga0495652_0022518 Ga0495652_0022518_4803_5573 256
279 3300046529 Ga0495652_0084748 Ga0495652_0084748_212_982 256
280 3300046529 Ga0495652_0296050 Ga0495652_0296050_94_864 256
281 3300046531 Ga0495665_0094678 Ga0495665_0094678_554_1324 256
282 3300046533 Ga0495640_0048395 Ga0495640_0048395_647_1417 256
283 3300046543 Ga0495645_0063421 Ga0495645_0063421_755_1525 256
284 3300046557 Ga0495622_0001172 Ga0495622_0001172_5962_6732 256
285 3300046558 Ga0495633_0000671 Ga0495633_0000671_11009_11782 256
286 3300046559 Ga0495667_0136161 Ga0495667_0136161_747_1517 256
287 3300046559 Ga0495667_0270647 Ga0495667_0270647_125_895 256
288 3300046616 Ga0495668_0122421 Ga0495668_0122421_22_792 256
289 3300046642 Ga0495634_0010562 Ga0495634_0010562_780_1550 256
290 3300046642 Ga0495634_0014374 Ga0495634_0014374_265_1035 256
291 3300046648 Ga0495611_0071337 Ga0495611_0071337_300_1070 256
292 3300046663 Ga0495635_0003586 Ga0495635_0003586_7201_7971 256
293 3300046663 Ga0495635_0017720 Ga0495635_0017720_520_1290 256
294 3300046665 Ga0495661_0178620 Ga0495661_0178620_34_804 256
295 3300046679 Ga0495623_0037855 Ga0495623_0037855_1484_2254 256
296 3300046679 Ga0495623_0039375 Ga0495623_0039375_1532_2302 256
297 3300046680 Ga0495646_0006079 Ga0495646_0006079_4750_5520 256
298 3300046680 Ga0495646_0085418 Ga0495646_0085418_536_1306 256
299 3300046684 Ga0495669_0051442 Ga0495669_0051442_488_1258 256
300 3300046690 Ga0495624_0122334 Ga0495624_0122334_576_1346 256
301 3300046692 Ga0495671_0168142 Ga0495671_0168142_22_792 256
302 3300046694 Ga0495649_0006070 Ga0495649_0006070_417_1187 256
303 3300046694 Ga0495649_0007247 Ga0495649_0007247_5998_6768 256
304 3300046794 Ga0495589_0007998 Ga0495589_0007998_4692_5462 256
305 3300046809 Ga0495600_0000405 Ga0495600_0000405_4660_5430 256
306 3300046809 Ga0495600_0235239 Ga0495600_0235239_344_1114 256
307 3300047315 Ga0495581_0008153 Ga0495581_0008153_604_1374 256
308 3300047315 Ga0495581_0058370 Ga0495581_0058370_165_935 256
309 3300047317 Ga0495604_0052311 Ga0495604_0052311_820_1590 256
310 3300047319 Ga0495674_0005712 Ga0495674_0005712_10943_11713 256
311 3300047320 Ga0495672_0007770 Ga0495672_0007770_2255_3025 256
312 3300047321 Ga0495676_0145888 Ga0495676_0145888_287_1057 256
313 3300047322 Ga0495680_0120168 Ga0495680_0120168_747_1517 256
314 3300047323 Ga0495683_0004755 Ga0495683_0004755_4703_5473 256
315 3300047323 Ga0495683_0048752 Ga0495683_0048752_566_1336 256
316 3300047443 Ga0495687_009705 Ga0495687_009705_2560_3330 256
317 3300047444 Ga0495675_0000913 Ga0495675_0000913_12496_13266 256
318 3300047444 Ga0495675_0083491 Ga0495675_0083491_720_1490 256
319 3300047469 Ga0495673_0001311 Ga0495673_0001311_563_1333 256
320 3300047469 Ga0495673_0053940 Ga0495673_0053940_577_1347 256
321 3300047673 Ga0495593_0005177 Ga0495593_0005177_4697_5467 256
322 3300048088 Ga0495602_0081546 Ga0495602_0081546_905_1675 256
323 3300048088 Ga0495602_0143554 Ga0495602_0143554_933_1703 256
324 3300048089 Ga0495614_0003214 Ga0495614_0003214_6344_7114 256
325 3300048089 Ga0495614_0052420 Ga0495614_0052420_698_1468 256
326 3300048920 Ga0496117_0041724 Ga0496117_0041724_2331_3101 256
327 3300048921 Ga0496118_0012505 Ga0496118_0012505_1175_1945 256
328 3300049460 Ga0495682_0003270 Ga0495682_0003270_6050_6820 256
329 3300053145 Ga0500586_000034 Ga0500586_000034_6670_7443 256

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

47

254

0.73

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

49

260

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
7wwf-assembly3.cif.gz_E crystal structure of bioh3 from mycolicibacterium smegmatis 0.8909 33 246
8hfw-assembly2.cif.gz_C-2 the crystal structure of alpha/beta fold hydrolase 0.8904 34 250
8hfw-assembly1.cif.gz_B the crystal structure of alpha/beta fold hydrolase 0.8698 29 246
8hfw-assembly1.cif.gz_A the crystal structure of alpha/beta fold hydrolase 0.8688 29 246
5y5r-assembly6.cif.gz_F crystal structure of a novel pyrethroid hydrolase pyth with bif 0.8685 32 252
ID Description Score Start End Superfamily
af_Q54QE7_5_233_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9812 33 252 3.40.50.1820
af_Q54QE7_5_233_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.939 33 252 3.40.50.1820
af_Q9FVW3_95_346_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8983 31 248 3.40.50.1820
af_A0A0R0FZI3_6_303_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8837 32 253 3.40.50.1820
af_F4JRA6_1_133_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8795 32 133 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A528B0L5-F1-model_v4 Alpha/beta hydrolase 0.9957 31 115 GO:0016787
AF-E8X507-F1-model_v4 AB hydrolase-1 domain-containing protein 0.9936 94 253
AF-A0A527W604-F1-model_v4 Alpha/beta hydrolase 0.9934 53 253 GO:0016787
AF-A0A1A0XYZ2-F1-model_v4 Hydrolase 0.9924 28 255 GO:0016787
AF-A0A7Y8BK16-F1-model_v4 Alpha/beta hydrolase 0.992 28 253 GO:0016787

Feature Viewer

pLDDT pTM Quality
90.68 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map