F409568

General Info

Members Datasets Scaffolds Average Seq Length
329 187 658 220

Family's Representative Sequence

Representative Sequence 3300005457|Ga0070662_100084263|Ga0070662_1000842633
Length 244
Sequence MRYPAYRGGAFAGHQGVTIDEHPLNMFRFIPIFALGFLLTSQSAGSPPAQEVAAALQKKYDAIHDFTADFVHESEGGLLRKKQTERGVVQIKKPGKMRWDYSAPEKKQFVSDGANMYTYLPQDKQVIVAEVPPDQAGTPTLFLAGKGSLTRDFTPSLTDAPAGMAPGSRALKLVPKARQAEYDWLMLVVDPATLAIRGLVTVDGQGGKSTFSFTNLKENVGLADKDFAFKMPRGVDVIRASSGS

Samples

Sample ID Description Type Environment
1 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
130 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
131 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
134 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
135 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
136 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
137 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
138 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
139 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
140 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
141 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
142 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
143 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
144 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
145 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
146 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
147 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
148 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
149 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
150 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
151 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
152 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
153 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
154 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
155 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
156 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
157 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
158 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
159 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
160 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
161 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
162 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
163 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
164 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
165 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
166 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
167 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
168 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
169 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
170 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
171 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
172 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
173 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
174 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
176 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
177 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
178 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
179 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
180 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
181 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
182 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
183 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
184 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
185 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
186 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
187 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.61
Nodule 0
Rhizoplane 1.22
Rhizosphere 98.18
Stem 0
Stem Tuber 0
Unclassified 36.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070662_100084263 3300005457 Bacteria 2374
2 MRS1b_contig_3687250 2162886011 Unclassified 846
3 MBSR1b_contig_5263092 2162886012 Unclassified 1358
4 MBSR1b_contig_5264986 2162886012 Unclassified 1358
5 Ga0065712_10018682 3300005290 Unclassified 1665
6 Ga0065715_10111345 3300005293 Unclassified 2577
7 Ga0065715_10207597 3300005293 Bacteria 1330
8 Ga0065715_10371600 3300005293 Bacteria 920
9 Ga0070676_10002113 3300005328 Bacteria 10117
10 Ga0070690_100025055 3300005330 Bacteria 3672
11 Ga0070690_100570630 3300005330 Unclassified 855
12 Ga0070670_100031508 3300005331 Bacteria 4567
13 Ga0068869_100080570 3300005334 Bacteria 2429
14 Ga0070666_10039906 3300005335 Bacteria 3130
15 Ga0070666_10114784 3300005335 Bacteria 1865
16 Ga0070680_100112700 3300005336 Bacteria 2265
17 Ga0070680_100508689 3300005336 Bacteria 1031
18 Ga0070660_100036466 3300005339 Unclassified 3725
19 Ga0070689_100296955 3300005340 Unclassified 1344
20 Ga0070691_10005218 3300005341 Bacteria 5901
21 Ga0070687_100090805 3300005343 Unclassified 1689
22 Ga0070669_100019272 3300005353 Bacteria 4873
23 Ga0070669_100058950 3300005353 Bacteria 2818
24 Ga0070669_100436877 3300005353 Unclassified 1076
25 Ga0070669_100700709 3300005353 Bacteria 855
26 Ga0070669_100801720 3300005353 Unclassified 800
27 Ga0070675_100318074 3300005354 Unclassified 1374
28 Ga0070675_100444332 3300005354 Unclassified 1162
29 Ga0070671_100180525 3300005355 Unclassified 1787
30 Ga0070674_100054996 3300005356 Unclassified 2754
31 Ga0070674_100714227 3300005356 Unclassified 858
32 Ga0070673_100421906 3300005364 Bacteria 1196
33 Ga0070688_100035316 3300005365 Unclassified 3036
34 Ga0070688_100082519 3300005365 Unclassified 2084
35 Ga0070659_100143903 3300005366 Unclassified 1942
36 Ga0070667_100273147 3300005367 Bacteria 1516
37 Ga0070703_10073801 3300005406 Bacteria 1145
38 Ga0070714_100011818 3300005435 Bacteria 6939
39 Ga0070701_10148410 3300005438 Unclassified 1348
40 Ga0070705_100072489 3300005440 Unclassified 2086
41 Ga0070705_100172416 3300005440 Unclassified 1457
42 Ga0070705_100662414 3300005440 Unclassified 815
43 Ga0070700_100017968 3300005441 Bacteria 4056
44 Ga0070700_100194251 3300005441 Unclassified 1421
45 Ga0070694_100023757 3300005444 Unclassified 3948
46 Ga0070694_100110690 3300005444 Bacteria 1956
47 Ga0070708_100088286 3300005445 Unclassified 2819
48 Ga0070662_100095010 3300005457 Unclassified 2246
49 Ga0070681_10066554 3300005458 Bacteria 3572
50 Ga0068867_100186889 3300005459 Unclassified 1651
51 Ga0068867_100399612 3300005459 Bacteria 1159
52 Ga0070685_10206079 3300005466 Bacteria 1281
53 Ga0070706_100292933 3300005467 Unclassified 1519
54 Ga0070707_100082514 3300005468 Bacteria 3105
55 Ga0070698_100039917 3300005471 Bacteria 4826
56 Ga0070699_100090891 3300005518 Bacteria 2669
57 Ga0070699_100409841 3300005518 Bacteria 1226
58 Ga0070679_100052985 3300005530 Bacteria 4039
59 Ga0070679_100188234 3300005530 Bacteria 2033
60 Ga0070697_100180533 3300005536 Bacteria 1789
61 Ga0070697_100251219 3300005536 Unclassified 1512
62 Ga0068853_100383537 3300005539 Unclassified 1313
63 Ga0068853_100658755 3300005539 Bacteria 997
64 Ga0070672_100151772 3300005543 Bacteria 1917
65 Ga0070672_100160346 3300005543 Bacteria 1865
66 Ga0070686_100000649 3300005544 Bacteria 20369
67 Ga0070686_100766294 3300005544 Unclassified 775
68 Ga0070695_100028763 3300005545 Unclassified 3450
69 Ga0070695_100044267 3300005545 Unclassified 2833
70 Ga0070695_100103306 3300005545 Bacteria 1922
71 Ga0070696_100000678 3300005546 Bacteria 21810
72 Ga0070665_100019803 3300005548 Bacteria 6754
73 Ga0070665_100046143 3300005548 Bacteria 4377
74 Ga0070704_100001825 3300005549 Bacteria 11728
75 Ga0070704_100103917 3300005549 Bacteria 2147
76 Ga0070704_100211071 3300005549 Bacteria 1573
77 Ga0068855_100015213 3300005563 Bacteria 9264
78 Ga0068854_100029677 3300005578 Bacteria 3787
79 Ga0068856_100209606 3300005614 Bacteria 1964
80 Ga0068859_100067838 3300005617 Bacteria 3602
81 Ga0068859_100317341 3300005617 Unclassified 1652
82 Ga0068866_10037480 3300005718 Bacteria 2381
83 Ga0068861_100066341 3300005719 Unclassified 2782
84 Ga0068861_100118879 3300005719 Unclassified 2129
85 Ga0068870_10129699 3300005840 Unclassified 1463
86 Ga0068870_10249422 3300005840 Bacteria 1100
87 Ga0068858_100007234 3300005842 Bacteria 10757
88 Ga0068858_100212874 3300005842 Bacteria 1829
89 Ga0068858_100362258 3300005842 Unclassified 1390
90 Ga0068860_100196212 3300005843 Bacteria 1955
91 Ga0068860_100227502 3300005843 Unclassified 1812
92 Ga0068860_100496322 3300005843 Unclassified 1218
93 Ga0068862_100011726 3300005844 Bacteria 7235
94 Ga0068862_100108893 3300005844 Unclassified 2430
95 Ga0068862_100205254 3300005844 Unclassified 1778
96 Ga0075432_10016362 3300006058 Unclassified 2531
97 Ga0070716_100406839 3300006173 Bacteria 980
98 Ga0075366_10155939 3300006195 Unclassified 1383
99 Ga0097621_100269223 3300006237 Unclassified 1496
100 Ga0097621_100318489 3300006237 Bacteria 1377
101 Ga0097621_100333400 3300006237 Unclassified 1346
102 Ga0097621_100391961 3300006237 Bacteria 1242
103 Ga0068871_100016758 3300006358 Bacteria 5529
104 Ga0068871_100121310 3300006358 Bacteria 2208
105 Ga0075428_100000003 3300006844 Bacteria 365483
106 Ga0075428_100086703 3300006844 Bacteria 3415
107 Ga0075428_100294082 3300006844 Unclassified 1746
108 Ga0075428_100679462 3300006844 Bacteria 1097
109 Ga0075431_100053352 3300006847 Unclassified 4169
110 Ga0075431_100060076 3300006847 Bacteria 3923
111 Ga0075433_10077661 3300006852 Bacteria 2925
112 Ga0075433_10226043 3300006852 Bacteria 1662
113 Ga0075433_10439427 3300006852 Unclassified 1150
114 Ga0075434_100000260 3300006871 Bacteria 37408
115 Ga0075434_100009989 3300006871 Bacteria 8884
116 Ga0075434_100036521 3300006871 Unclassified 4861
117 Ga0075434_100410406 3300006871 Bacteria 1375
118 Ga0075434_100437130 3300006871 Unclassified 1330
119 Ga0075429_100138377 3300006880 Unclassified 2131
120 Ga0075429_100891890 3300006880 Unclassified 778
121 Ga0068865_100038255 3300006881 Unclassified 3246
122 Ga0068865_100590842 3300006881 Unclassified 937
123 Ga0075436_100000281 3300006914 Bacteria 32239
124 Ga0075436_100023948 3300006914 Bacteria 4196
125 Ga0075436_100082857 3300006914 Bacteria 2225
126 Ga0075436_100099635 3300006914 Bacteria 2023
127 Ga0075436_100342017 3300006914 Bacteria 1077
128 Ga0075436_100486726 3300006914 Bacteria 901
129 Ga0097620_100067837 3300006931 Bacteria 3602
130 Ga0097620_100317327 3300006931 Unclassified 1652
131 Ga0075435_100000064 3300007076 Bacteria 54706
132 Ga0075435_100004239 3300007076 Bacteria 9849
133 Ga0075435_100016401 3300007076 Bacteria 5585
134 Ga0075435_100345919 3300007076 Bacteria 1274
135 Ga0099794_10297497 3300007265 Bacteria 835
136 Ga0105240_10016980 3300009093 Bacteria 9833
137 Ga0105240_10058964 3300009093 Bacteria 4792
138 Ga0105240_10368694 3300009093 Bacteria 1624
139 Ga0105240_10697481 3300009093 Bacteria 1108
140 Ga0111539_10000001 3300009094 Bacteria 1035431
141 Ga0111539_10002176 3300009094 Bacteria 26185
142 Ga0111539_10191757 3300009094 Bacteria 2384
143 Ga0111539_10633979 3300009094 Unclassified 1244
144 Ga0105245_10123690 3300009098 Unclassified 2419
145 Ga0114129_10002121 3300009147 Bacteria 27334
146 Ga0114129_10493852 3300009147 Unclassified 1599
147 Ga0105243_10101598 3300009148 Unclassified 2388
148 Ga0105243_10360323 3300009148 Bacteria 1338
149 Ga0105243_10731156 3300009148 Bacteria 968
150 Ga0105243_10794820 3300009148 Bacteria 932
151 Ga0105243_10829405 3300009148 Bacteria 914
152 Ga0105241_10019079 3300009174 Bacteria 5057
153 Ga0105241_10976699 3300009174 Unclassified 791
154 Ga0105242_10044908 3300009176 Bacteria 3579
155 Ga0105242_10547777 3300009176 Unclassified 1109
156 Ga0105248_10022633 3300009177 Bacteria 6974
157 Ga0105248_10071947 3300009177 Bacteria 3886
158 Ga0105248_10085674 3300009177 Unclassified 3545
159 Ga0105248_10089620 3300009177 Bacteria 3463
160 Ga0105248_10094553 3300009177 Unclassified 3365
161 Ga0105248_10415507 3300009177 Bacteria 1515
162 Ga0105248_10752706 3300009177 Unclassified 1099
163 Ga0105249_10038242 3300009553 Unclassified 4353
164 Ga0105239_10424965 3300010375 Bacteria 1506
165 Ga0157374_10007722 3300013296 Bacteria 9183
166 Ga0157378_10118966 3300013297 Unclassified 2433
167 Ga0163162_10084612 3300013306 Bacteria 3248
168 Ga0157372_10420160 3300013307 Unclassified 1558
169 Ga0157375_10202809 3300013308 Unclassified 2139
170 Ga0157375_10271565 3300013308 Bacteria 1858
171 Ga0157380_10183295 3300014326 Bacteria 1841
172 Ga0157380_10535568 3300014326 Unclassified 1145
173 Ga0157380_10538585 3300014326 Unclassified 1143
174 Ga0157379_10381382 3300014968 Unclassified 1293
175 Ga0157379_10513503 3300014968 Bacteria 1112
176 Ga0157376_10049975 3300014969 Unclassified 3466
177 Ga0157376_10063022 3300014969 Bacteria 3122
178 Ga0157376_10184902 3300014969 Bacteria 1907
179 Ga0157376_10845467 3300014969 Unclassified 930
180 Ga0207642_10030840 3300025899 Bacteria 2239
181 Ga0207680_10035852 3300025903 Bacteria 2852
182 Ga0207680_10125065 3300025903 Bacteria 1687
183 Ga0207645_10005571 3300025907 Bacteria 9111
184 Ga0207643_10262899 3300025908 Bacteria 1066
185 Ga0207707_10052050 3300025912 Bacteria 3566
186 Ga0207695_10055537 3300025913 Bacteria 4126
187 Ga0207660_10069624 3300025917 Bacteria 2555
188 Ga0207657_10005393 3300025919 Bacteria 13363
189 Ga0207652_10473572 3300025921 Bacteria 1128
190 Ga0207681_10490524 3300025923 Bacteria 1004
191 Ga0207681_10660709 3300025923 Unclassified 867
192 Ga0207659_10025323 3300025926 Unclassified 3985
193 Ga0207659_10830892 3300025926 Unclassified 794
194 Ga0207687_10275302 3300025927 Bacteria 1347
195 Ga0207664_10193286 3300025929 Bacteria 1753
196 Ga0207644_10240623 3300025931 Unclassified 1441
197 Ga0207644_10281610 3300025931 Bacteria 1335
198 Ga0207690_10040279 3300025932 Unclassified 3054
199 Ga0207706_10270837 3300025933 Bacteria 1482
200 Ga0207706_10448722 3300025933 Bacteria 1116
201 Ga0207686_10095508 3300025934 Bacteria 1973
202 Ga0207686_10569025 3300025934 Unclassified 888
203 Ga0207709_10023898 3300025935 Bacteria 3484
204 Ga0207709_10475542 3300025935 Unclassified 970
205 Ga0207669_10053030 3300025937 Bacteria 2440
206 Ga0207704_10206268 3300025938 Unclassified 1443
207 Ga0207704_10522241 3300025938 Unclassified 960
208 Ga0207691_10190987 3300025940 Unclassified 1786
209 Ga0207691_10219951 3300025940 Bacteria 1647
210 Ga0207711_10037027 3300025941 Bacteria 4141
211 Ga0207711_10043000 3300025941 Bacteria 3852
212 Ga0207711_10098009 3300025941 Bacteria 2590
213 Ga0207711_10196331 3300025941 Unclassified 1841
214 Ga0207689_10052424 3300025942 Bacteria 3362
215 Ga0207679_10493146 3300025945 Unclassified 1092
216 Ga0207667_10093582 3300025949 Unclassified 3104
217 Ga0207651_10530933 3300025960 Unclassified 1021
218 Ga0207712_10126750 3300025961 Bacteria 1939
219 Ga0207668_10156924 3300025972 Unclassified 1769
220 Ga0207658_10276506 3300025986 Bacteria 1438
221 Ga0207658_10358728 3300025986 Unclassified 1271
222 Ga0207677_10328078 3300026023 Bacteria 1274
223 Ga0207703_10165643 3300026035 Bacteria 1939
224 Ga0207639_10759512 3300026041 Unclassified 902
225 Ga0207708_10432088 3300026075 Bacteria 1094
226 Ga0207708_10582522 3300026075 Bacteria 946
227 Ga0207648_10011936 3300026089 Bacteria 8157
228 Ga0207648_10447239 3300026089 Bacteria 1176
229 Ga0207675_100006714 3300026118 Bacteria 10880
230 Ga0207675_100018747 3300026118 Bacteria 6458
231 Ga0207675_100164875 3300026118 Unclassified 2116
232 Ga0207675_100177566 3300026118 Unclassified 2038
233 Ga0207675_100267549 3300026118 Bacteria 1658
234 Ga0207428_10000002 3300027907 Bacteria 854851
235 Ga0207428_10011735 3300027907 Bacteria 7727
236 Ga0268266_10030913 3300028379 Bacteria 4547
237 Ga0268266_10036642 3300028379 Bacteria 4176
238 Ga0268266_10467105 3300028379 Unclassified 1201
239 Ga0268265_10010135 3300028380 Bacteria 6364
240 Ga0268265_10160053 3300028380 Unclassified 1911
241 Ga0268265_10205438 3300028380 Unclassified 1712
242 Ga0268265_10270550 3300028380 Bacteria 1515
243 Ga0268265_10274041 3300028380 Unclassified 1506
244 Ga0268265_10416609 3300028380 Bacteria 1246
245 Ga0268264_10338540 3300028381 Unclassified 1428
246 Ga0268264_10446317 3300028381 Unclassified 1252
247 Ga0307405_10523482 3300031731 Unclassified 955
248 Ga0307410_10512094 3300031852 Bacteria 989
249 Ga0307412_10436436 3300031911 Unclassified 1075
250 Ga0307416_100224102 3300032002 Unclassified 1806
251 Ga0307416_100247495 3300032002 Bacteria 1732
252 Ga0307416_100556893 3300032002 Unclassified 1221
253 Ga0307415_100248676 3300032126 Bacteria 1443
254 Ga0307415_100794995 3300032126 Bacteria 863
255 Ga0373930_0002148 3300034816 Bacteria 3024
256 Ga0373948_0033851 3300034817 Bacteria 1042
257 Ga0373950_0004006 3300034818 Bacteria 2143
258 Ga0373958_0000409 3300034819 Bacteria 5227
259 Ga0373959_0006982 3300034820 Bacteria 1890
260 Ga0373928_0002349 3300035084 Unclassified 3673
261 Ga0373929_0006627 3300035085 Bacteria 2096
262 Ga0373949_0004961 3300035090 Bacteria 3002
263 Ga0373951_0000583 3300035091 Bacteria 10066
264 Ga0373952_0000539 3300035092 Bacteria 6648
265 Ga0373932_0000989 3300035112 Bacteria 8230
266 Ga0373939_0000976 3300035114 Bacteria 7097
267 Ga0373960_0001642 3300035121 Bacteria 4998
268 Ga0373942_0000122 3300035207 Bacteria 18181
269 Ga0373961_0002548 3300035241 Unclassified 4699
270 Ga0373962_0001652 3300035242 Bacteria 5306
271 Ga0373931_0087151 3300035691 Bacteria 1733
272 Ga0373935_0360687 3300035692 Unclassified 1038
273 Ga0373933_0472336 3300035724 Unclassified 821
274 Ga0373933_0514325 3300035724 Bacteria 785
275 Ga0373947_0361086 3300035725 Unclassified 976
276 Ga0373937_0140942 3300036401 Bacteria 2255
277 Ga0373925_0060882 3300037068 Bacteria 2835
278 Ga0439435_0037392 3300042436 Bacteria 1345
279 Ga0450918_060112 3300042531 Bacteria 701
280 Ga0451576_0008076 3300045051 Bacteria 12410
281 Ga0451576_0090130 3300045051 Bacteria 3190
282 Ga0495628_0777140 3300046516 Unclassified 671
283 Ga0495630_0268827 3300046517 Bacteria 1303
284 Ga0495640_0124088 3300046533 Unclassified 1676
285 Ga0495640_0421906 3300046533 Bacteria 817
286 Ga0495587_0185265 3300046536 Bacteria 1179
287 Ga0495645_0002003 3300046543 Bacteria 13863
288 Ga0495599_0255711 3300046678 Unclassified 1065
289 Ga0495658_0011084 3300046683 Unclassified 4524
290 Ga0495658_0157225 3300046683 Bacteria 1400
291 Ga0495624_0284225 3300046690 Bacteria 999
292 Ga0495604_0240322 3300047317 Bacteria 1239
293 Ga0495674_0158854 3300047319 Bacteria 1892
294 Ga0495684_0035897 3300047471 Bacteria 3801
295 Ga0495684_0415971 3300047471 Unclassified 941
296 Ga0496104_0043149 3300048907 Bacteria 4236
297 Ga0496106_0024068 3300048909 Bacteria 4527
298 Ga0496109_0184219 3300048912 Bacteria 1962
299 Ga0496115_0077971 3300048918 Bacteria 2695
300 Ga0501031_0155844 3300049568 Bacteria 1493
301 Ga0501225_0035920 3300049705 Unclassified 1365
302 Ga0501283_051562 3300049779 Unclassified 730
303 nmdc:mga0k408_213075_c1 3300050493 Unclassified 1153
304 nmdc:mga09592_849847_c1 3300050508 Unclassified 770
305 nmdc:mga06r32_43087_c1 3300050510 Bacteria 4293
306 nmdc:mga08y16_3_c1 3300050511 Bacteria 936907
307 nmdc:mga08y16_5181_c1 3300050511 Bacteria 13615
308 nmdc:mga0n895_130_c1 3300050512 Bacteria 44769
309 nmdc:mga0n895_18520_c1 3300050512 Bacteria 6446
310 nmdc:mga0n895_376131_c1 3300050512 Bacteria 1438
311 nmdc:mga0n895_613369_c1 3300050512 Bacteria 1089
312 nmdc:mga0n895_72468_c1 3300050512 Unclassified 3417
313 nmdc:mga0n895_875226_c1 3300050512 Bacteria 885
314 nmdc:mga0rr50_184166_c1 3300050513 Bacteria 1708
315 nmdc:mga0rr50_31153_c1 3300050513 Unclassified 3785
316 nmdc:mga0rr50_3877_c1 3300050513 Bacteria 8700
317 nmdc:mga0rr50_40852_c1 3300050513 Bacteria 3375
318 nmdc:mga0rr50_4452_c1 3300050513 Bacteria 8246
319 nmdc:mga0rr50_5_c1 3300050513 Bacteria 327169
320 nmdc:mga08x19_270_c1 3300050514 Bacteria 39380
321 nmdc:mga08x19_297202_c1 3300050514 Bacteria 1121
322 nmdc:mga08x19_299908_c1 3300050514 Bacteria 1116
323 nmdc:mga08x19_38887_c1 3300050514 Bacteria 3022
324 nmdc:mga0a205_118854_c1 3300050515 Bacteria 2542
325 nmdc:mga0a205_41365_c1 3300050515 Bacteria 4438
326 nmdc:mga0a205_593005_c1 3300050515 Bacteria 961
327 Ga0495601_0033879 3300053077 Bacteria 3183
328 Ga0495595_0048051 3300053084 Bacteria 1970
329 Ga0495619_0023050 3300053085 Bacteria 3988
330 Ga0070662_100084263
331 MRS1b_contig_3687250
332 MBSR1b_contig_5263092
333 MBSR1b_contig_5264986
334 Ga0065712_10018682
335 Ga0065715_10111345
336 Ga0065715_10207597
337 Ga0065715_10371600
338 Ga0070676_10002113
339 Ga0070690_100025055
340 Ga0070690_100570630
341 Ga0070670_100031508
342 Ga0068869_100080570
343 Ga0070666_10039906
344 Ga0070666_10114784
345 Ga0070680_100112700
346 Ga0070680_100508689
347 Ga0070660_100036466
348 Ga0070689_100296955
349 Ga0070691_10005218
350 Ga0070687_100090805
351 Ga0070669_100019272
352 Ga0070669_100058950
353 Ga0070669_100436877
354 Ga0070669_100700709
355 Ga0070669_100801720
356 Ga0070675_100318074
357 Ga0070675_100444332
358 Ga0070671_100180525
359 Ga0070674_100054996
360 Ga0070674_100714227
361 Ga0070673_100421906
362 Ga0070688_100035316
363 Ga0070688_100082519
364 Ga0070659_100143903
365 Ga0070667_100273147
366 Ga0070703_10073801
367 Ga0070714_100011818
368 Ga0070701_10148410
369 Ga0070705_100072489
370 Ga0070705_100172416
371 Ga0070705_100662414
372 Ga0070700_100017968
373 Ga0070700_100194251
374 Ga0070694_100023757
375 Ga0070694_100110690
376 Ga0070708_100088286
377 Ga0070662_100095010
378 Ga0070681_10066554
379 Ga0068867_100186889
380 Ga0068867_100399612
381 Ga0070685_10206079
382 Ga0070706_100292933
383 Ga0070707_100082514
384 Ga0070698_100039917
385 Ga0070699_100090891
386 Ga0070699_100409841
387 Ga0070679_100052985
388 Ga0070679_100188234
389 Ga0070697_100180533
390 Ga0070697_100251219
391 Ga0068853_100383537
392 Ga0068853_100658755
393 Ga0070672_100151772
394 Ga0070672_100160346
395 Ga0070686_100000649
396 Ga0070686_100766294
397 Ga0070695_100028763
398 Ga0070695_100044267
399 Ga0070695_100103306
400 Ga0070696_100000678
401 Ga0070665_100019803
402 Ga0070665_100046143
403 Ga0070704_100001825
404 Ga0070704_100103917
405 Ga0070704_100211071
406 Ga0068855_100015213
407 Ga0068854_100029677
408 Ga0068856_100209606
409 Ga0068859_100067838
410 Ga0068859_100317341
411 Ga0068866_10037480
412 Ga0068861_100066341
413 Ga0068861_100118879
414 Ga0068870_10129699
415 Ga0068870_10249422
416 Ga0068858_100007234
417 Ga0068858_100212874
418 Ga0068858_100362258
419 Ga0068860_100196212
420 Ga0068860_100227502
421 Ga0068860_100496322
422 Ga0068862_100011726
423 Ga0068862_100108893
424 Ga0068862_100205254
425 Ga0075432_10016362
426 Ga0070716_100406839
427 Ga0075366_10155939
428 Ga0097621_100269223
429 Ga0097621_100318489
430 Ga0097621_100333400
431 Ga0097621_100391961
432 Ga0068871_100016758
433 Ga0068871_100121310
434 Ga0075428_100000003
435 Ga0075428_100086703
436 Ga0075428_100294082
437 Ga0075428_100679462
438 Ga0075431_100053352
439 Ga0075431_100060076
440 Ga0075433_10077661
441 Ga0075433_10226043
442 Ga0075433_10439427
443 Ga0075434_100000260
444 Ga0075434_100009989
445 Ga0075434_100036521
446 Ga0075434_100410406
447 Ga0075434_100437130
448 Ga0075429_100138377
449 Ga0075429_100891890
450 Ga0068865_100038255
451 Ga0068865_100590842
452 Ga0075436_100000281
453 Ga0075436_100023948
454 Ga0075436_100082857
455 Ga0075436_100099635
456 Ga0075436_100342017
457 Ga0075436_100486726
458 Ga0097620_100067837
459 Ga0097620_100317327
460 Ga0075435_100000064
461 Ga0075435_100004239
462 Ga0075435_100016401
463 Ga0075435_100345919
464 Ga0099794_10297497
465 Ga0105240_10016980
466 Ga0105240_10058964
467 Ga0105240_10368694
468 Ga0105240_10697481
469 Ga0111539_10000001
470 Ga0111539_10002176
471 Ga0111539_10191757
472 Ga0111539_10633979
473 Ga0105245_10123690
474 Ga0114129_10002121
475 Ga0114129_10493852
476 Ga0105243_10101598
477 Ga0105243_10360323
478 Ga0105243_10731156
479 Ga0105243_10794820
480 Ga0105243_10829405
481 Ga0105241_10019079
482 Ga0105241_10976699
483 Ga0105242_10044908
484 Ga0105242_10547777
485 Ga0105248_10022633
486 Ga0105248_10071947
487 Ga0105248_10085674
488 Ga0105248_10089620
489 Ga0105248_10094553
490 Ga0105248_10415507
491 Ga0105248_10752706
492 Ga0105249_10038242
493 Ga0105239_10424965
494 Ga0157374_10007722
495 Ga0157378_10118966
496 Ga0163162_10084612
497 Ga0157372_10420160
498 Ga0157375_10202809
499 Ga0157375_10271565
500 Ga0157380_10183295
501 Ga0157380_10535568
502 Ga0157380_10538585
503 Ga0157379_10381382
504 Ga0157379_10513503
505 Ga0157376_10049975
506 Ga0157376_10063022
507 Ga0157376_10184902
508 Ga0157376_10845467
509 Ga0207642_10030840
510 Ga0207680_10035852
511 Ga0207680_10125065
512 Ga0207645_10005571
513 Ga0207643_10262899
514 Ga0207707_10052050
515 Ga0207695_10055537
516 Ga0207660_10069624
517 Ga0207657_10005393
518 Ga0207652_10473572
519 Ga0207681_10490524
520 Ga0207681_10660709
521 Ga0207659_10025323
522 Ga0207659_10830892
523 Ga0207687_10275302
524 Ga0207664_10193286
525 Ga0207644_10240623
526 Ga0207644_10281610
527 Ga0207690_10040279
528 Ga0207706_10270837
529 Ga0207706_10448722
530 Ga0207686_10095508
531 Ga0207686_10569025
532 Ga0207709_10023898
533 Ga0207709_10475542
534 Ga0207669_10053030
535 Ga0207704_10206268
536 Ga0207704_10522241
537 Ga0207691_10190987
538 Ga0207691_10219951
539 Ga0207711_10037027
540 Ga0207711_10043000
541 Ga0207711_10098009
542 Ga0207711_10196331
543 Ga0207689_10052424
544 Ga0207679_10493146
545 Ga0207667_10093582
546 Ga0207651_10530933
547 Ga0207712_10126750
548 Ga0207668_10156924
549 Ga0207658_10276506
550 Ga0207658_10358728
551 Ga0207677_10328078
552 Ga0207703_10165643
553 Ga0207639_10759512
554 Ga0207708_10432088
555 Ga0207708_10582522
556 Ga0207648_10011936
557 Ga0207648_10447239
558 Ga0207675_100006714
559 Ga0207675_100018747
560 Ga0207675_100164875
561 Ga0207675_100177566
562 Ga0207675_100267549
563 Ga0207428_10000002
564 Ga0207428_10011735
565 Ga0268266_10030913
566 Ga0268266_10036642
567 Ga0268266_10467105
568 Ga0268265_10010135
569 Ga0268265_10160053
570 Ga0268265_10205438
571 Ga0268265_10270550
572 Ga0268265_10274041
573 Ga0268265_10416609
574 Ga0268264_10338540
575 Ga0268264_10446317
576 Ga0307405_10523482
577 Ga0307410_10512094
578 Ga0307412_10436436
579 Ga0307416_100224102
580 Ga0307416_100247495
581 Ga0307416_100556893
582 Ga0307415_100248676
583 Ga0307415_100794995
584 Ga0373930_0002148
585 Ga0373948_0033851
586 Ga0373950_0004006
587 Ga0373958_0000409
588 Ga0373959_0006982
589 Ga0373928_0002349
590 Ga0373929_0006627
591 Ga0373949_0004961
592 Ga0373951_0000583
593 Ga0373952_0000539
594 Ga0373932_0000989
595 Ga0373939_0000976
596 Ga0373960_0001642
597 Ga0373942_0000122
598 Ga0373961_0002548
599 Ga0373962_0001652
600 Ga0373931_0087151
601 Ga0373935_0360687
602 Ga0373933_0472336
603 Ga0373933_0514325
604 Ga0373947_0361086
605 Ga0373937_0140942
606 Ga0373925_0060882
607 Ga0439435_0037392
608 Ga0450918_060112
609 Ga0451576_0008076
610 Ga0451576_0090130
611 Ga0495628_0777140
612 Ga0495630_0268827
613 Ga0495640_0124088
614 Ga0495640_0421906
615 Ga0495587_0185265
616 Ga0495645_0002003
617 Ga0495599_0255711
618 Ga0495658_0011084
619 Ga0495658_0157225
620 Ga0495624_0284225
621 Ga0495604_0240322
622 Ga0495674_0158854
623 Ga0495684_0035897
624 Ga0495684_0415971
625 Ga0496104_0043149
626 Ga0496106_0024068
627 Ga0496109_0184219
628 Ga0496115_0077971
629 Ga0501031_0155844
630 Ga0501225_0035920
631 Ga0501283_051562
632 nmdc:mga0k408_213075_c1
633 nmdc:mga09592_849847_c1
634 nmdc:mga06r32_43087_c1
635 nmdc:mga08y16_3_c1
636 nmdc:mga08y16_5181_c1
637 nmdc:mga0n895_130_c1
638 nmdc:mga0n895_18520_c1
639 nmdc:mga0n895_376131_c1
640 nmdc:mga0n895_613369_c1
641 nmdc:mga0n895_72468_c1
642 nmdc:mga0n895_875226_c1
643 nmdc:mga0rr50_184166_c1
644 nmdc:mga0rr50_31153_c1
645 nmdc:mga0rr50_3877_c1
646 nmdc:mga0rr50_40852_c1
647 nmdc:mga0rr50_4452_c1
648 nmdc:mga0rr50_5_c1
649 nmdc:mga08x19_270_c1
650 nmdc:mga08x19_297202_c1
651 nmdc:mga08x19_299908_c1
652 nmdc:mga08x19_38887_c1
653 nmdc:mga0a205_118854_c1
654 nmdc:mga0a205_41365_c1
655 nmdc:mga0a205_593005_c1
656 Ga0495601_0033879
657 Ga0495595_0048051
658 Ga0495619_0023050

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03548

LolA

Outer membrane lipoprotein carrier protein LolA

61

230

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
8v1k-assembly2.cif.gz_B crystal structure of outer membrane lipoprotein carrier protein (lola) from francisella tularensis 0.8622 31 220
1ua8-assembly1.cif.gz_A crystal structure of the lipoprotein localization factor, lola 0.8618 31 218
3ksn-assembly1.cif.gz_A crystal structure of the lipoprotein localization factor, lola 0.8582 30 218
4ki3-assembly4.cif.gz_L 1.70 angstrom resolution crystal structure of outer-membrane lipoprotein carrier protein (lola) from yersinia pestis co92 0.8566 31 216
4ki3-assembly4.cif.gz_J 1.70 angstrom resolution crystal structure of outer-membrane lipoprotein carrier protein (lola) from yersinia pestis co92 0.8536 31 216
ID Description Score Start End Superfamily
4ki3G00 Mainly Beta;Clam;outer membrane lipoprotein receptor (LolB), chain A;Lipoprotein localisation LolA/LolB/LppX 0.8528 31 216 2.50.20.10
4ki3G00 Mainly Beta;Clam;outer membrane lipoprotein receptor (LolB), chain A;Lipoprotein localisation LolA/LolB/LppX 0.831 31 216 2.50.20.10
2w7qB00 Mainly Beta;Clam;outer membrane lipoprotein receptor (LolB), chain A;Lipoprotein localisation LolA/LolB/LppX 0.82 29 217 2.50.20.10
2w7qB00 Mainly Beta;Clam;outer membrane lipoprotein receptor (LolB), chain A;Lipoprotein localisation LolA/LolB/LppX 0.8118 29 217 2.50.20.10
af_Q58100_22_207_2.50.20.10 Mainly Beta;Clam;outer membrane lipoprotein receptor (LolB), chain A;Lipoprotein localisation LolA/LolB/LppX 0.7515 23 217 2.50.20.10
ID Description Score Start End GO Terms
AF-A0A3N5ZJB8-F1-model_v4 Outer membrane lipoprotein carrier protein LolA 0.9435 83 217
AF-A0A2D5TXV2-F1-model_v4 Outer-membrane lipoprotein carrier protein 0.9099 31 218 GO:0042597
GO:0042953
AF-A0A0X3TNM5-F1-model_v4 Outer-membrane lipoprotein carrier protein 0.903 27 215 GO:0042597
GO:0042953
GO:0044874
AF-A0A3N5ZJB8-F1-model_v4 Outer membrane lipoprotein carrier protein LolA 0.8988 83 217
AF-A0A7C9PFE7-F1-model_v4 Outer-membrane lipoprotein carrier protein 0.8975 27 217 GO:0042597
GO:0042953
GO:0044874

Map