F409551

General Info

Members Datasets Scaffolds Average Seq Length
329 200 658 93

Family's Representative Sequence

Representative Sequence 3300005434|Ga0070709_10717918|Ga0070709_107179182
Length 93
Sequence MIVGLIACECIIYNAHSLKDKRAVLQRIMTRLKQKFNISIAEVDFQDTWQRTKIAMAVVSSARNPAEIELQKALKFIDSFPEIERTITDIEWL

Samples

Sample ID Description Type Environment
1 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
2 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
71 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
74 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
75 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
107 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
108 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
109 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
110 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
111 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
112 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
113 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
114 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
115 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
116 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
117 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
118 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
119 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
120 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
121 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
122 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
123 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
124 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
125 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
126 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
127 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
128 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
129 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
130 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
131 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
132 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
133 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
134 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
135 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
136 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
137 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
138 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
139 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
140 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
141 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
142 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
143 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
144 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
145 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
146 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
147 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
148 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
149 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
150 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
151 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
152 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
153 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
154 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
155 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
156 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
157 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
158 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
159 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
160 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
161 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
162 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300049131 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300049133 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300049542 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300049543 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
180 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 3300049547 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300049548 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300049554 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
193 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
195 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
196 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
197 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
198 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
199 2738543010 Bacillus sp. YR335 Isolate Unclassified
200 2818991441 Niallia circulans 3243 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 79.33
Metatranscriptomes 20.06
Isolates 0.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.04
Rhizosphere 94.22
Stem 0
Stem Tuber 0
Unclassified 17.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070709_10717918 3300005434 Bacteria 779
2 Ga0058861_10693596 3300004800 Bacteria 580
3 Ga0070683_100874304 3300005329 Bacteria 862
4 Ga0070670_101783043 3300005331 Unclassified 566
5 Ga0070680_100905958 3300005336 Unclassified 761
6 Ga0070682_101551804 3300005337 Bacteria 571
7 Ga0070660_101564110 3300005339 Bacteria 561
8 Ga0070691_10566842 3300005341 Unclassified 666
9 Ga0070692_10449366 3300005345 Unclassified 824
10 Ga0070668_100894845 3300005347 Unclassified 793
11 Ga0070675_101177972 3300005354 Bacteria 705
12 Ga0070671_101089676 3300005355 Bacteria 701
13 Ga0070674_101504478 3300005356 Bacteria 605
14 Ga0070659_101210145 3300005366 Unclassified 668
15 Ga0070667_100781160 3300005367 Unclassified 886
16 Ga0070667_100981779 3300005367 Bacteria 788
17 Ga0070709_10078081 3300005434 Bacteria 2153
18 Ga0070709_10357316 3300005434 Bacteria 1081
19 Ga0070714_101554506 3300005435 Bacteria 646
20 Ga0070711_100155243 3300005439 Bacteria 1730
21 Ga0070705_101088251 3300005440 Unclassified 653
22 Ga0070694_100134566 3300005444 Bacteria 1790
23 Ga0070708_100419504 3300005445 Bacteria 1262
24 Ga0070708_100421238 3300005445 Bacteria 1259
25 Ga0070663_100409889 3300005455 Bacteria 1110
26 Ga0070681_10226754 3300005458 Bacteria 1783
27 Ga0070681_10233198 3300005458 Bacteria 1755
28 Ga0070681_10730697 3300005458 Bacteria 906
29 Ga0068867_100874242 3300005459 Unclassified 807
30 Ga0070706_100172756 3300005467 Bacteria 2018
31 Ga0070699_100197154 3300005518 Unclassified 1790
32 Ga0070679_100020931 3300005530 Bacteria 6381
33 Ga0070679_100283218 3300005530 Bacteria 1610
34 Ga0070679_100980375 3300005530 Bacteria 789
35 Ga0070679_101102550 3300005530 Bacteria 738
36 Ga0070684_100000248 3300005535 Bacteria 37357
37 Ga0070684_100026812 3300005535 Bacteria 4858
38 Ga0070684_100712016 3300005535 Bacteria 936
39 Ga0070684_101024915 3300005535 Bacteria 775
40 Ga0070684_102232700 3300005535 Bacteria 516
41 Ga0070697_100075485 3300005536 Bacteria 2771
42 Ga0070697_100148363 3300005536 Bacteria 1976
43 Ga0070697_100657852 3300005536 Unclassified 923
44 Ga0070697_101107984 3300005536 Unclassified 705
45 Ga0070695_100115464 3300005545 Unclassified 1829
46 Ga0070695_101583772 3300005545 Bacteria 546
47 Ga0070696_100002851 3300005546 Bacteria 11497
48 Ga0070693_100029102 3300005547 Bacteria 3010
49 Ga0070704_100206719 3300005549 Bacteria 1588
50 Ga0068855_100138625 3300005563 Unclassified 2774
51 Ga0068855_101724361 3300005563 Unclassified 638
52 Ga0070664_101614551 3300005564 Unclassified 614
53 Ga0068857_100399145 3300005577 Bacteria 1279
54 Ga0068857_100680116 3300005577 Bacteria 977
55 Ga0068857_101131955 3300005577 Bacteria 756
56 Ga0068852_100549828 3300005616 Bacteria 1155
57 Ga0068852_101788977 3300005616 Bacteria 637
58 Ga0068859_100896004 3300005617 Bacteria 972
59 Ga0068859_102136221 3300005617 Bacteria 618
60 Ga0068864_100535098 3300005618 Bacteria 1131
61 Ga0068866_10722629 3300005718 Unclassified 685
62 Ga0068858_100385970 3300005842 Bacteria 1344
63 Ga0068860_101542728 3300005843 Bacteria 686
64 Ga0070717_10169400 3300006028 Bacteria 1899
65 Ga0070715_10085012 3300006163 Bacteria 1444
66 Ga0070716_101166075 3300006173 Bacteria 617
67 Ga0070716_101200452 3300006173 Bacteria 609
68 Ga0097621_100468086 3300006237 Bacteria 1138
69 Ga0068871_100685720 3300006358 Bacteria 938
70 Ga0068871_100706096 3300006358 Unclassified 924
71 Ga0075434_101282008 3300006871 Bacteria 744
72 Ga0075436_100017138 3300006914 Bacteria 4957
73 Ga0097620_100896006 3300006931 Bacteria 972
74 Ga0097620_102135628 3300006931 Bacteria 618
75 Ga0075435_100386736 3300007076 Bacteria 1202
76 Ga0075435_100892360 3300007076 Bacteria 775
77 Ga0105240_10013654 3300009093 Bacteria 11139
78 Ga0105240_10138362 3300009093 Unclassified 2914
79 Ga0105240_11398366 3300009093 Unclassified 736
80 Ga0114129_12073194 3300009147 Bacteria 687
81 Ga0105241_10085258 3300009174 Bacteria 2482
82 Ga0105241_10701904 3300009174 Bacteria 924
83 Ga0105241_10878019 3300009174 Bacteria 831
84 Ga0105241_12543584 3300009174 Unclassified 513
85 Ga0105241_12658060 3300009174 Bacteria 503
86 Ga0105242_10617979 3300009176 Bacteria 1049
87 Ga0105242_12379692 3300009176 Bacteria 577
88 Ga0105248_10150112 3300009177 Bacteria 2629
89 Ga0105248_11163425 3300009177 Unclassified 872
90 Ga0105248_11788604 3300009177 Unclassified 697
91 Ga0105237_10278517 3300009545 Bacteria 1675
92 Ga0105237_10565997 3300009545 Bacteria 1143
93 Ga0105238_10155399 3300009551 Bacteria 2263
94 Ga0105238_10601933 3300009551 Bacteria 1107
95 Ga0105238_12765339 3300009551 Unclassified 527
96 Ga0105239_11361946 3300010375 Bacteria 819
97 Ga0105239_11870771 3300010375 Bacteria 696
98 Ga0105246_10088895 3300011119 Bacteria 2221
99 Ga0157371_10363589 3300013102 Bacteria 1055
100 Ga0157370_10022441 3300013104 Bacteria 6279
101 Ga0157370_10343187 3300013104 Bacteria 1376
102 Ga0157370_10675010 3300013104 Unclassified 944
103 Ga0157370_11631946 3300013104 Bacteria 579
104 Ga0157369_10006368 3300013105 Bacteria 13695
105 Ga0157369_10048502 3300013105 Bacteria 4608
106 Ga0157369_10362821 3300013105 Bacteria 1504
107 Ga0157374_10387229 3300013296 Bacteria 1393
108 Ga0157374_11474355 3300013296 Bacteria 704
109 Ga0157374_12477563 3300013296 Bacteria 546
110 Ga0157374_12607039 3300013296 Unclassified 533
111 Ga0157378_10219913 3300013297 Bacteria 1805
112 Ga0157378_10581936 3300013297 Bacteria 1128
113 Ga0157378_10998037 3300013297 Bacteria 871
114 Ga0157378_11952601 3300013297 Unclassified 636
115 Ga0157378_12239548 3300013297 Unclassified 598
116 Ga0157378_13160194 3300013297 Unclassified 511
117 Ga0163162_10570258 3300013306 Unclassified 1259
118 Ga0163162_11032430 3300013306 Bacteria 930
119 Ga0163162_12089204 3300013306 Bacteria 650
120 Ga0157372_11313186 3300013307 Bacteria 835
121 Ga0157372_13284439 3300013307 Bacteria 515
122 Ga0157375_11479243 3300013308 Unclassified 801
123 Ga0157375_11876161 3300013308 Bacteria 711
124 Ga0157375_13475899 3300013308 Bacteria 524
125 Ga0163163_10711976 3300014325 Bacteria 1067
126 Ga0163163_11433171 3300014325 Bacteria 752
127 Ga0157376_10863219 3300014969 Bacteria 921
128 Ga0157376_11108804 3300014969 Bacteria 817
129 Ga0182007_10226266 3300015262 Bacteria 663
130 Ga0206352_10117449 3300020078 Bacteria 2443
131 Ga0206354_10438636 3300020081 Bacteria 534
132 Ga0154015_1633877 3300020610 Bacteria 647
133 Ga0213876_10400733 3300021384 Unclassified 730
134 Ga0213876_10663701 3300021384 Bacteria 555
135 Ga0207688_10937669 3300025901 Unclassified 548
136 Ga0207685_10118617 3300025905 Bacteria 1158
137 Ga0207699_10020098 3300025906 Bacteria 3573
138 Ga0207699_10113320 3300025906 Bacteria 1742
139 Ga0207699_10569726 3300025906 Bacteria 823
140 Ga0207645_11099061 3300025907 Unclassified 536
141 Ga0207654_10046403 3300025911 Bacteria 2477
142 Ga0207654_11146135 3300025911 Bacteria 567
143 Ga0207707_10584564 3300025912 Unclassified 946
144 Ga0207707_10703656 3300025912 Bacteria 848
145 Ga0207695_10006856 3300025913 Bacteria 14663
146 Ga0207695_10107634 3300025913 Unclassified 2773
147 Ga0207671_10010888 3300025914 Bacteria 7455
148 Ga0207663_10031734 3300025916 Bacteria 3130
149 Ga0207663_11003257 3300025916 Bacteria 670
150 Ga0207660_11191834 3300025917 Unclassified 620
151 Ga0207657_10069989 3300025919 Bacteria 2975
152 Ga0207652_10129452 3300025921 Bacteria 2250
153 Ga0207652_10326908 3300025921 Bacteria 1384
154 Ga0207687_11196436 3300025927 Unclassified 653
155 Ga0207664_10970286 3300025929 Bacteria 762
156 Ga0207669_11083711 3300025937 Unclassified 676
157 Ga0207665_10182249 3300025939 Bacteria 1521
158 Ga0207665_10678981 3300025939 Bacteria 809
159 Ga0207665_11367087 3300025939 Unclassified 564
160 Ga0207711_10099386 3300025941 Unclassified 2572
161 Ga0207689_10312800 3300025942 Bacteria 1303
162 Ga0207661_10000754 3300025944 Bacteria 21040
163 Ga0207661_10099329 3300025944 Bacteria 2441
164 Ga0207661_10245809 3300025944 Unclassified 1589
165 Ga0207661_11806471 3300025944 Unclassified 557
166 Ga0207667_12091267 3300025949 Unclassified 525
167 Ga0207668_11374909 3300025972 Bacteria 636
168 Ga0207703_10618957 3300026035 Bacteria 1025
169 Ga0207703_10635614 3300026035 Bacteria 1012
170 Ga0207639_10381510 3300026041 Unclassified 1266
171 Ga0207678_10219139 3300026067 Bacteria 1629
172 Ga0207678_10503332 3300026067 Bacteria 1056
173 Ga0207702_12501047 3300026078 Unclassified 503
174 Ga0207641_10970301 3300026088 Bacteria 846
175 Ga0207648_10442750 3300026089 Bacteria 1182
176 Ga0207676_10840975 3300026095 Bacteria 897
177 Ga0207674_10396548 3300026116 Bacteria 1334
178 Ga0207674_10431663 3300026116 Bacteria 1273
179 Ga0207698_10359638 3300026142 Bacteria 1378
180 Ga0207698_11023675 3300026142 Bacteria 837
181 Ga0268266_10280881 3300028379 Unclassified 1548
182 Ga0265325_10177713 3300031241 Bacteria 993
183 Ga0265339_10164455 3300031249 Bacteria 1115
184 Ga0373926_0258563 3300035083 Bacteria 676
185 Ga0373935_1100752 3300035692 Bacteria 591
186 Ga0373927_0009686 3300035695 Bacteria 6461
187 Ga0373927_0343897 3300035695 Bacteria 983
188 Ga0373947_0392957 3300035725 Bacteria 935
189 Ga0373947_0444289 3300035725 Bacteria 878
190 Ga0373937_1664913 3300036401 Bacteria 585
191 Ga0373925_0212632 3300037068 Bacteria 1541
192 Ga0395900_0446780 3300037418 Bacteria 1250
193 Ga0395898_0106964 3300037466 Bacteria 2683
194 Ga0436364_0331537 3300037853 Bacteria 1537
195 Ga0395901_0474319 3300038443 Unclassified 1277
196 Ga0436365_0352729 3300039437 Bacteria 791
197 Ga0436365_0557838 3300039437 Unclassified 604
198 Ga0436363_0061867 3300039450 Bacteria 1687
199 Ga0436363_0423289 3300039450 Unclassified 533
200 Ga0451789_0509404 3300041443 Bacteria 788
201 Ga0451793_0982190 3300041452 Bacteria 776
202 Ga0451576_0316616 3300045051 Unclassified 1633
203 Ga0451576_0968431 3300045051 Bacteria 892
204 Ga0451576_1130626 3300045051 Bacteria 819
205 Ga0495592_0139138 3300046454 Bacteria 1690
206 Ga0495603_0363876 3300046455 Bacteria 830
207 Ga0495651_0099991 3300046462 Bacteria 2161
208 Ga0495580_0040300 3300046472 Bacteria 3337
209 Ga0495580_0358765 3300046472 Bacteria 987
210 Ga0495662_0012299 3300046476 Bacteria 4177
211 Ga0495664_0001617 3300046477 Bacteria 11989
212 Ga0495594_0867140 3300046499 Unclassified 508
213 Ga0495607_0111117 3300046501 Bacteria 1453
214 Ga0495618_0181755 3300046514 Unclassified 1336
215 Ga0495628_0021845 3300046516 Bacteria 5259
216 Ga0495630_0350107 3300046517 Bacteria 1130
217 Ga0495630_0897017 3300046517 Bacteria 675
218 Ga0495652_0028386 3300046529 Bacteria 4924
219 Ga0495640_0075092 3300046533 Bacteria 2258
220 Ga0495586_0085310 3300046535 Bacteria 1740
221 Ga0495587_0033986 3300046536 Bacteria 3076
222 Ga0495645_0784911 3300046543 Bacteria 572
223 Ga0495622_0004503 3300046557 Bacteria 6454
224 Ga0495667_0016022 3300046559 Bacteria 5065
225 Ga0495667_0815327 3300046559 Unclassified 575
226 Ga0495634_0019489 3300046642 Bacteria 4819
227 Ga0495635_0039194 3300046663 Bacteria 3278
228 Ga0495657_0381941 3300046675 Bacteria 831
229 Ga0495599_0017121 3300046678 Bacteria 4504
230 Ga0495599_0306070 3300046678 Bacteria 958
231 Ga0495623_0051385 3300046679 Bacteria 2608
232 Ga0495646_0192240 3300046680 Bacteria 1115
233 Ga0495646_0239427 3300046680 Bacteria 975
234 Ga0495613_0099709 3300046689 Bacteria 2098
235 Ga0495649_0120257 3300046694 Bacteria 1389
236 Ga0495604_0083208 3300047317 Bacteria 2392
237 Ga0495674_0015551 3300047319 Bacteria 7110
238 Ga0495674_0559729 3300047319 Bacteria 909
239 Ga0495680_0657362 3300047322 Bacteria 696
240 Ga0495684_0370936 3300047471 Bacteria 1011
241 Ga0495602_0073728 3300048088 Bacteria 2904
242 Ga0495602_0812602 3300048088 Unclassified 627
243 Ga0496100_0362586 3300048903 Bacteria 1097
244 Ga0496101_0163171 3300048904 Bacteria 1710
245 Ga0496104_0967767 3300048907 Bacteria 755
246 Ga0496104_1480975 3300048907 Unclassified 582
247 Ga0496105_0804013 3300048908 Bacteria 715
248 Ga0496106_0823910 3300048909 Bacteria 735
249 Ga0496112_0565369 3300048915 Bacteria 1070
250 Ga0496113_0109709 3300048916 Bacteria 2146
251 Ga0496126_0120378 3300048929 Bacteria 2278
252 Ga0501308_071537 3300049128 Bacteria 539
253 Ga0501341_01611 3300049131 Bacteria 1148
254 Ga0501341_05796 3300049131 Bacteria 747
255 Ga0501341_11153 3300049131 Bacteria 598
256 Ga0501343_008992 3300049132 Bacteria 803
257 Ga0501343_010330 3300049132 Bacteria 761
258 Ga0501344_09441 3300049133 Bacteria 590
259 Ga0501344_10649 3300049133 Bacteria 565
260 Ga0501344_13871 3300049133 Bacteria 513
261 Ga0501305_001473 3300049161 Bacteria 2312
262 Ga0501305_043906 3300049161 Bacteria 734
263 Ga0501305_095436 3300049161 Bacteria 549
264 Ga0501307_049873 3300049162 Bacteria 627
265 Ga0501307_056169 3300049162 Bacteria 602
266 Ga0501311_034171 3300049527 Bacteria 748
267 Ga0501311_067503 3300049527 Bacteria 588
268 Ga0501311_078505 3300049527 Bacteria 558
269 Ga0501312_000048 3300049528 Bacteria 7587
270 Ga0501312_034791 3300049528 Bacteria 804
271 Ga0501312_074251 3300049528 Bacteria 607
272 Ga0501313_001080 3300049529 Bacteria 2223
273 Ga0501313_014887 3300049529 Bacteria 924
274 Ga0501313_054915 3300049529 Bacteria 557
275 Ga0501315_036291 3300049531 Bacteria 730
276 Ga0501315_047697 3300049531 Bacteria 665
277 Ga0501315_051439 3300049531 Bacteria 648
278 Ga0501316_000603 3300049532 Bacteria 2600
279 Ga0501316_019541 3300049532 Bacteria 844
280 Ga0501316_025017 3300049532 Bacteria 774
281 Ga0501317_004945 3300049533 Bacteria 1408
282 Ga0501317_060028 3300049533 Bacteria 622
283 Ga0501318_001046 3300049534 Bacteria 2036
284 Ga0501318_030820 3300049534 Bacteria 729
285 Ga0501320_007600 3300049536 Bacteria 1047
286 Ga0501320_010531 3300049536 Bacteria 943
287 Ga0501321_002828 3300049537 Bacteria 1542
288 Ga0501321_024115 3300049537 Bacteria 776
289 Ga0501321_062742 3300049537 Bacteria 565
290 Ga0501321_081561 3300049537 Bacteria 516
291 Ga0501323_038858 3300049539 Bacteria 692
292 Ga0501326_05273 3300049542 Bacteria 701
293 Ga0501327_02265 3300049543 Bacteria 989
294 Ga0501330_006081 3300049546 Bacteria 783
295 Ga0501331_14728 3300049547 Bacteria 513
296 Ga0501332_04158 3300049548 Bacteria 855
297 Ga0501332_10107 3300049548 Bacteria 628
298 Ga0501332_18070 3300049548 Bacteria 514
299 Ga0501333_009661 3300049549 Bacteria 679
300 Ga0501333_012059 3300049549 Bacteria 629
301 Ga0501334_13133 3300049550 Bacteria 619
302 Ga0501335_002713 3300049551 Bacteria 1452
303 Ga0501335_011680 3300049551 Bacteria 861
304 Ga0501335_015519 3300049551 Bacteria 778
305 Ga0501335_032987 3300049551 Bacteria 591
306 Ga0501335_051962 3300049551 Bacteria 501
307 Ga0501336_014743 3300049552 Bacteria 665
308 Ga0501337_002424 3300049553 Bacteria 1140
309 Ga0501337_013831 3300049553 Bacteria 612
310 Ga0501338_07712 3300049554 Bacteria 697
311 Ga0501338_10826 3300049554 Bacteria 618
312 Ga0501340_016019 3300049556 Bacteria 596
313 Ga0501340_021404 3300049556 Bacteria 545
314 Ga0501031_0565728 3300049568 Unclassified 732
315 Ga0501047_0046591 3300049581 Bacteria 4190
316 Ga0501047_0285269 3300049581 Unclassified 1495
317 Ga0501070_0015096 3300049586 Bacteria 6502
318 Ga0501035_0198047 3300049822 Bacteria 1724
319 Ga0501044_0001615 3300049823 Bacteria 26407
320 Ga0501044_0003757 3300049823 Bacteria 17064
321 Ga0501044_0072586 3300049823 Bacteria 3499
322 nmdc:mga05p37_2188762_c1 3300050507 Bacteria 514
323 nmdc:mga0rr50_1075640_c1 3300050513 Bacteria 684
324 nmdc:mga0rr50_1722975_c1 3300050513 Bacteria 528
325 nmdc:mga0rr50_190042_c1 3300050513 Bacteria 1682
326 nmdc:mga08x19_5292_c1 3300050514 Bacteria 7628
327 Ga0501082_0000813 3300060353 Bacteria 27437
328 2739231215 2738543010 Bacteria 5583595
329 2819567557 2818991441 Bacteria 5062707
330 Ga0070709_10717918
331 Ga0058861_10693596
332 Ga0070683_100874304
333 Ga0070670_101783043
334 Ga0070680_100905958
335 Ga0070682_101551804
336 Ga0070660_101564110
337 Ga0070691_10566842
338 Ga0070692_10449366
339 Ga0070668_100894845
340 Ga0070675_101177972
341 Ga0070671_101089676
342 Ga0070674_101504478
343 Ga0070659_101210145
344 Ga0070667_100781160
345 Ga0070667_100981779
346 Ga0070709_10078081
347 Ga0070709_10357316
348 Ga0070714_101554506
349 Ga0070711_100155243
350 Ga0070705_101088251
351 Ga0070694_100134566
352 Ga0070708_100419504
353 Ga0070708_100421238
354 Ga0070663_100409889
355 Ga0070681_10226754
356 Ga0070681_10233198
357 Ga0070681_10730697
358 Ga0068867_100874242
359 Ga0070706_100172756
360 Ga0070699_100197154
361 Ga0070679_100020931
362 Ga0070679_100283218
363 Ga0070679_100980375
364 Ga0070679_101102550
365 Ga0070684_100000248
366 Ga0070684_100026812
367 Ga0070684_100712016
368 Ga0070684_101024915
369 Ga0070684_102232700
370 Ga0070697_100075485
371 Ga0070697_100148363
372 Ga0070697_100657852
373 Ga0070697_101107984
374 Ga0070695_100115464
375 Ga0070695_101583772
376 Ga0070696_100002851
377 Ga0070693_100029102
378 Ga0070704_100206719
379 Ga0068855_100138625
380 Ga0068855_101724361
381 Ga0070664_101614551
382 Ga0068857_100399145
383 Ga0068857_100680116
384 Ga0068857_101131955
385 Ga0068852_100549828
386 Ga0068852_101788977
387 Ga0068859_100896004
388 Ga0068859_102136221
389 Ga0068864_100535098
390 Ga0068866_10722629
391 Ga0068858_100385970
392 Ga0068860_101542728
393 Ga0070717_10169400
394 Ga0070715_10085012
395 Ga0070716_101166075
396 Ga0070716_101200452
397 Ga0097621_100468086
398 Ga0068871_100685720
399 Ga0068871_100706096
400 Ga0075434_101282008
401 Ga0075436_100017138
402 Ga0097620_100896006
403 Ga0097620_102135628
404 Ga0075435_100386736
405 Ga0075435_100892360
406 Ga0105240_10013654
407 Ga0105240_10138362
408 Ga0105240_11398366
409 Ga0114129_12073194
410 Ga0105241_10085258
411 Ga0105241_10701904
412 Ga0105241_10878019
413 Ga0105241_12543584
414 Ga0105241_12658060
415 Ga0105242_10617979
416 Ga0105242_12379692
417 Ga0105248_10150112
418 Ga0105248_11163425
419 Ga0105248_11788604
420 Ga0105237_10278517
421 Ga0105237_10565997
422 Ga0105238_10155399
423 Ga0105238_10601933
424 Ga0105238_12765339
425 Ga0105239_11361946
426 Ga0105239_11870771
427 Ga0105246_10088895
428 Ga0157371_10363589
429 Ga0157370_10022441
430 Ga0157370_10343187
431 Ga0157370_10675010
432 Ga0157370_11631946
433 Ga0157369_10006368
434 Ga0157369_10048502
435 Ga0157369_10362821
436 Ga0157374_10387229
437 Ga0157374_11474355
438 Ga0157374_12477563
439 Ga0157374_12607039
440 Ga0157378_10219913
441 Ga0157378_10581936
442 Ga0157378_10998037
443 Ga0157378_11952601
444 Ga0157378_12239548
445 Ga0157378_13160194
446 Ga0163162_10570258
447 Ga0163162_11032430
448 Ga0163162_12089204
449 Ga0157372_11313186
450 Ga0157372_13284439
451 Ga0157375_11479243
452 Ga0157375_11876161
453 Ga0157375_13475899
454 Ga0163163_10711976
455 Ga0163163_11433171
456 Ga0157376_10863219
457 Ga0157376_11108804
458 Ga0182007_10226266
459 Ga0206352_10117449
460 Ga0206354_10438636
461 Ga0154015_1633877
462 Ga0213876_10400733
463 Ga0213876_10663701
464 Ga0207688_10937669
465 Ga0207685_10118617
466 Ga0207699_10020098
467 Ga0207699_10113320
468 Ga0207699_10569726
469 Ga0207645_11099061
470 Ga0207654_10046403
471 Ga0207654_11146135
472 Ga0207707_10584564
473 Ga0207707_10703656
474 Ga0207695_10006856
475 Ga0207695_10107634
476 Ga0207671_10010888
477 Ga0207663_10031734
478 Ga0207663_11003257
479 Ga0207660_11191834
480 Ga0207657_10069989
481 Ga0207652_10129452
482 Ga0207652_10326908
483 Ga0207687_11196436
484 Ga0207664_10970286
485 Ga0207669_11083711
486 Ga0207665_10182249
487 Ga0207665_10678981
488 Ga0207665_11367087
489 Ga0207711_10099386
490 Ga0207689_10312800
491 Ga0207661_10000754
492 Ga0207661_10099329
493 Ga0207661_10245809
494 Ga0207661_11806471
495 Ga0207667_12091267
496 Ga0207668_11374909
497 Ga0207703_10618957
498 Ga0207703_10635614
499 Ga0207639_10381510
500 Ga0207678_10219139
501 Ga0207678_10503332
502 Ga0207702_12501047
503 Ga0207641_10970301
504 Ga0207648_10442750
505 Ga0207676_10840975
506 Ga0207674_10396548
507 Ga0207674_10431663
508 Ga0207698_10359638
509 Ga0207698_11023675
510 Ga0268266_10280881
511 Ga0265325_10177713
512 Ga0265339_10164455
513 Ga0373926_0258563
514 Ga0373935_1100752
515 Ga0373927_0009686
516 Ga0373927_0343897
517 Ga0373947_0392957
518 Ga0373947_0444289
519 Ga0373937_1664913
520 Ga0373925_0212632
521 Ga0395900_0446780
522 Ga0395898_0106964
523 Ga0436364_0331537
524 Ga0395901_0474319
525 Ga0436365_0352729
526 Ga0436365_0557838
527 Ga0436363_0061867
528 Ga0436363_0423289
529 Ga0451789_0509404
530 Ga0451793_0982190
531 Ga0451576_0316616
532 Ga0451576_0968431
533 Ga0451576_1130626
534 Ga0495592_0139138
535 Ga0495603_0363876
536 Ga0495651_0099991
537 Ga0495580_0040300
538 Ga0495580_0358765
539 Ga0495662_0012299
540 Ga0495664_0001617
541 Ga0495594_0867140
542 Ga0495607_0111117
543 Ga0495618_0181755
544 Ga0495628_0021845
545 Ga0495630_0350107
546 Ga0495630_0897017
547 Ga0495652_0028386
548 Ga0495640_0075092
549 Ga0495586_0085310
550 Ga0495587_0033986
551 Ga0495645_0784911
552 Ga0495622_0004503
553 Ga0495667_0016022
554 Ga0495667_0815327
555 Ga0495634_0019489
556 Ga0495635_0039194
557 Ga0495657_0381941
558 Ga0495599_0017121
559 Ga0495599_0306070
560 Ga0495623_0051385
561 Ga0495646_0192240
562 Ga0495646_0239427
563 Ga0495613_0099709
564 Ga0495649_0120257
565 Ga0495604_0083208
566 Ga0495674_0015551
567 Ga0495674_0559729
568 Ga0495680_0657362
569 Ga0495684_0370936
570 Ga0495602_0073728
571 Ga0495602_0812602
572 Ga0496100_0362586
573 Ga0496101_0163171
574 Ga0496104_0967767
575 Ga0496104_1480975
576 Ga0496105_0804013
577 Ga0496106_0823910
578 Ga0496112_0565369
579 Ga0496113_0109709
580 Ga0496126_0120378
581 Ga0501308_071537
582 Ga0501341_01611
583 Ga0501341_05796
584 Ga0501341_11153
585 Ga0501343_008992
586 Ga0501343_010330
587 Ga0501344_09441
588 Ga0501344_10649
589 Ga0501344_13871
590 Ga0501305_001473
591 Ga0501305_043906
592 Ga0501305_095436
593 Ga0501307_049873
594 Ga0501307_056169
595 Ga0501311_034171
596 Ga0501311_067503
597 Ga0501311_078505
598 Ga0501312_000048
599 Ga0501312_034791
600 Ga0501312_074251
601 Ga0501313_001080
602 Ga0501313_014887
603 Ga0501313_054915
604 Ga0501315_036291
605 Ga0501315_047697
606 Ga0501315_051439
607 Ga0501316_000603
608 Ga0501316_019541
609 Ga0501316_025017
610 Ga0501317_004945
611 Ga0501317_060028
612 Ga0501318_001046
613 Ga0501318_030820
614 Ga0501320_007600
615 Ga0501320_010531
616 Ga0501321_002828
617 Ga0501321_024115
618 Ga0501321_062742
619 Ga0501321_081561
620 Ga0501323_038858
621 Ga0501326_05273
622 Ga0501327_02265
623 Ga0501330_006081
624 Ga0501331_14728
625 Ga0501332_04158
626 Ga0501332_10107
627 Ga0501332_18070
628 Ga0501333_009661
629 Ga0501333_012059
630 Ga0501334_13133
631 Ga0501335_002713
632 Ga0501335_011680
633 Ga0501335_015519
634 Ga0501335_032987
635 Ga0501335_051962
636 Ga0501336_014743
637 Ga0501337_002424
638 Ga0501337_013831
639 Ga0501338_07712
640 Ga0501338_10826
641 Ga0501340_016019
642 Ga0501340_021404
643 Ga0501031_0565728
644 Ga0501047_0046591
645 Ga0501047_0285269
646 Ga0501070_0015096
647 Ga0501035_0198047
648 Ga0501044_0001615
649 Ga0501044_0003757
650 Ga0501044_0072586
651 nmdc:mga05p37_2188762_c1
652 nmdc:mga0rr50_1075640_c1
653 nmdc:mga0rr50_1722975_c1
654 nmdc:mga0rr50_190042_c1
655 nmdc:mga08x19_5292_c1
656 Ga0501082_0000813
657 2739231215
658 2819567557

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04456

DUF503

Protein of unknown function (DUF503)

3

90

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1j27-assembly1.cif.gz_A crystal structure of a hypothetical protein, tt1725, from thermus thermophilus hb8 at 1.7a resolution 0.8838 2 95
1j27-assembly1.cif.gz_A crystal structure of a hypothetical protein, tt1725, from thermus thermophilus hb8 at 1.7a resolution 0.8663 2 95
3zzp-assembly1.cif.gz_A circular permutant of ribosomal protein s6, lacking edge strand beta- 2 of wild-type s6. 0.7637 6 83
3zzp-assembly1.cif.gz_A circular permutant of ribosomal protein s6, lacking edge strand beta- 2 of wild-type s6. 0.7288 6 83
7bfd-assembly1.cif.gz_K circular permutant of ribosomal protein s6, p54-55 truncated, y4a mutant. 0.7263 5 92
ID Description Score Start End Superfamily
af_O33252_1_96_3.30.70.1120 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;TT1725-like 0.9117 1 95 3.30.70.1120
af_O33252_1_96_3.30.70.1120 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;TT1725-like 0.8936 1 95 3.30.70.1120
1j27A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;TT1725-like 0.8838 2 95 3.30.70.1120
1j27A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;TT1725-like 0.8663 2 95 3.30.70.1120
3zzpA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein S6/Translation elongation factor EF1B 0.7637 6 83 3.30.70.60
ID Description Score Start End GO Terms
AF-A0A7V5YSE3-F1-model_v4 DUF503 domain-containing protein 1.004 1 95
AF-A0A6L8HII2-F1-model_v4 deleted 0.9947 2 94
AF-A0A7X3VG68-F1-model_v4 DUF503 domain-containing protein 0.9934 1 94
AF-A0A538TY32-F1-model_v4 Ribosome-binding factor A 0.9929 4 80 GO:0005829
GO:0030490
GO:0043024
AF-A0A2E5FM84-F1-model_v4 DUF503 domain-containing protein 0.9888 2 94

Map