F409546

General Info

Members Datasets Scaffolds Average Seq Length
329 190 658 187

Family's Representative Sequence

Representative Sequence 3300005434|Ga0070709_10078184|Ga0070709_100781843
Length 192
Sequence MATLNIPDEKKTLSEFEDVRAQLASMGIDYERWKPAHEVAAGASAAEILAAYAPEIERLKAEGGYVTADVIDVTPQTPGLDAMLNRFNSEHWHDEDEVRFIIEGRGIFHIHPRSKNGDGKVVSITVEAGDLLRVPRGTWHWFDLCQERRIRAIRLFQDTSGWTPHYTESGVDRGYEPVCFGPNYFPGRANLS

Samples

Sample ID Description Type Environment
1 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
39 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
40 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
41 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
54 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
71 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
99 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
103 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
104 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
105 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
106 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
107 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
108 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
109 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
110 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
111 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
112 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
113 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
114 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
115 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
116 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
117 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
118 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
119 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
120 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
121 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
122 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
123 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
124 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
125 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
126 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
127 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
128 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
129 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
130 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
131 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
132 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
133 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
134 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
135 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
136 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
137 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
138 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
139 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
140 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
141 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
142 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
143 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
144 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
145 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
146 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
147 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
148 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
149 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
150 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
151 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
152 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
153 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
154 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
155 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
156 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
157 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
169 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
170 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
171 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
172 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
173 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
174 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
175 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
176 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
177 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
178 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
180 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
181 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
182 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
183 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
184 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
185 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
186 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
187 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
188 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
189 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
190 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.3
Nodule 0
Rhizoplane 4.26
Rhizosphere 94.53
Stem 0
Stem Tuber 0
Unclassified 29.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070709_10078184 3300005434 Bacteria 2152
2 JGI25407J50210_10104629 3300003373 Unclassified 699
3 Ga0065712_10281593 3300005290 Unclassified 895
4 Ga0065715_10132144 3300005293 Unclassified 1995
5 Ga0065715_10163068 3300005293 Unclassified 1611
6 Ga0070690_100085490 3300005330 Unclassified 2069
7 Ga0070690_100254011 3300005330 Bacteria 1244
8 Ga0068869_100615745 3300005334 Bacteria 918
9 Ga0070680_100001961 3300005336 Bacteria 15148
10 Ga0068868_100421058 3300005338 Bacteria 1156
11 Ga0070689_100037580 3300005340 Bacteria 3702
12 Ga0070689_100105162 3300005340 Bacteria 2239
13 Ga0070687_100266134 3300005343 Bacteria 1072
14 Ga0070675_101303338 3300005354 Bacteria 669
15 Ga0070659_100204480 3300005366 Bacteria 1626
16 Ga0070667_100332784 3300005367 Bacteria 1372
17 Ga0070709_10025317 3300005434 Bacteria 3505
18 Ga0070709_10580648 3300005434 Unclassified 861
19 Ga0070713_100281483 3300005436 Unclassified 1526
20 Ga0070711_100017454 3300005439 Bacteria 4571
21 Ga0070711_100375462 3300005439 Unclassified 1148
22 Ga0070705_100125492 3300005440 Unclassified 1665
23 Ga0070694_100002976 3300005444 Bacteria 10070
24 Ga0070708_100080481 3300005445 Bacteria 2948
25 Ga0070708_100107018 3300005445 Unclassified 2567
26 Ga0070708_100250431 3300005445 Bacteria 1664
27 Ga0070708_100262536 3300005445 Unclassified 1623
28 Ga0070706_100045470 3300005467 Bacteria 4055
29 Ga0070706_100359760 3300005467 Unclassified 1356
30 Ga0070707_100002239 3300005468 Bacteria 18472
31 Ga0070707_100011282 3300005468 Bacteria 8331
32 Ga0070707_100191766 3300005468 Unclassified 1993
33 Ga0070698_100002687 3300005471 Bacteria 19596
34 Ga0070698_100038064 3300005471 Bacteria 4956
35 Ga0070698_100053791 3300005471 Unclassified 4090
36 Ga0070698_100801253 3300005471 Bacteria 886
37 Ga0070697_100013596 3300005536 Bacteria 6385
38 Ga0070697_100040517 3300005536 Bacteria 3770
39 Ga0070697_100095527 3300005536 Bacteria 2465
40 Ga0070697_100108789 3300005536 Bacteria 2308
41 Ga0070672_100173384 3300005543 Bacteria 1795
42 Ga0070686_100158373 3300005544 Unclassified 1592
43 Ga0070695_100006888 3300005545 Bacteria 6731
44 Ga0070695_100970657 3300005545 Bacteria 690
45 Ga0070665_100002709 3300005548 Bacteria 19216
46 Ga0070704_100000496 3300005549 Bacteria 18708
47 Ga0070704_100008361 3300005549 Bacteria 6201
48 Ga0070704_100058661 3300005549 Unclassified 2742
49 Ga0070704_100204778 3300005549 Bacteria 1595
50 Ga0070704_100301027 3300005549 Unclassified 1336
51 Ga0068857_100263281 3300005577 Bacteria 1583
52 Ga0070702_100362136 3300005615 Unclassified 1025
53 Ga0068852_101004107 3300005616 Unclassified 853
54 Ga0068859_100000008 3300005617 Bacteria 383750
55 Ga0068859_100226800 3300005617 Bacteria 1956
56 Ga0068859_100325714 3300005617 Bacteria 1630
57 Ga0068859_100823915 3300005617 Bacteria 1015
58 Ga0068864_100034575 3300005618 Bacteria 4299
59 Ga0068863_100001386 3300005841 Bacteria 24026
60 Ga0068863_101195187 3300005841 Unclassified 766
61 Ga0068858_100069264 3300005842 Bacteria 3270
62 Ga0068858_101012541 3300005842 Bacteria 814
63 Ga0068860_100004570 3300005843 Bacteria 14126
64 Ga0068860_100017650 3300005843 Bacteria 6954
65 Ga0068860_100082514 3300005843 Bacteria 3057
66 Ga0068860_100458435 3300005843 Bacteria 1268
67 Ga0068862_100193192 3300005844 Bacteria 1833
68 Ga0081455_10113278 3300005937 Unclassified 2151
69 Ga0081538_10057397 3300005981 Unclassified 2268
70 Ga0070715_10270696 3300006163 Bacteria 896
71 Ga0070715_10361897 3300006163 Unclassified 795
72 Ga0070716_100000077 3300006173 Bacteria 37966
73 Ga0070716_100009766 3300006173 Unclassified 4795
74 Ga0070716_100053644 3300006173 Bacteria 2300
75 Ga0070716_100209726 3300006173 Bacteria 1301
76 Ga0070716_100668273 3300006173 Unclassified 790
77 Ga0070712_100016257 3300006175 Unclassified 4805
78 Ga0070712_100291509 3300006175 Unclassified 1318
79 Ga0070712_100528025 3300006175 Unclassified 992
80 Ga0097621_100329946 3300006237 Unclassified 1353
81 Ga0075370_10168527 3300006353 Bacteria 1287
82 Ga0068871_100046303 3300006358 Bacteria 3503
83 Ga0075428_100123753 3300006844 Archaea 2815
84 Ga0075431_100224269 3300006847 Bacteria 1917
85 Ga0075433_10211348 3300006852 Bacteria 1724
86 Ga0075433_10528779 3300006852 Unclassified 1037
87 Ga0075434_100010924 3300006871 Bacteria 8538
88 Ga0075434_100029909 3300006871 Bacteria 5361
89 Ga0075434_100235001 3300006871 Bacteria 1853
90 Ga0075429_100201295 3300006880 Bacteria 1745
91 Ga0075436_100000292 3300006914 Bacteria 31883
92 Ga0075436_100048586 3300006914 Bacteria 2927
93 Ga0097620_100000008 3300006931 Bacteria 383750
94 Ga0097620_100226798 3300006931 Bacteria 1956
95 Ga0097620_100325743 3300006931 Bacteria 1630
96 Ga0097620_100823861 3300006931 Bacteria 1015
97 Ga0075435_100006761 3300007076 Bacteria 8136
98 Ga0075435_100229247 3300007076 Bacteria 1578
99 Ga0075435_100238543 3300007076 Bacteria 1546
100 Ga0075435_100251330 3300007076 Bacteria 1505
101 Ga0075435_100256911 3300007076 Unclassified 1488
102 Ga0099794_10010825 3300007265 Bacteria 3885
103 Ga0099794_10023784 3300007265 Bacteria 2806
104 Ga0099794_10049648 3300007265 Bacteria 2017
105 Ga0099794_10053655 3300007265 Bacteria 1944
106 Ga0099794_10143680 3300007265 Bacteria 1209
107 Ga0099795_10164694 3300007788 Bacteria 917
108 Ga0111539_10030262 3300009094 Bacteria 6583
109 Ga0111539_10275515 3300009094 Unclassified 1958
110 Ga0105245_10065833 3300009098 Unclassified 3278
111 Ga0114129_10089198 3300009147 Bacteria 4275
112 Ga0114129_10166173 3300009147 Bacteria 3011
113 Ga0114129_11993832 3300009147 Unclassified 702
114 Ga0105243_10328329 3300009148 Unclassified 1396
115 Ga0105248_10100450 3300009177 Bacteria 3260
116 Ga0105238_10657906 3300009551 Bacteria 1058
117 Ga0105249_10039142 3300009553 Bacteria 4305
118 Ga0105249_10407672 3300009553 Bacteria 1391
119 Ga0105239_10102059 3300010375 Bacteria 3175
120 Ga0157374_10433037 3300013296 Bacteria 1315
121 Ga0157378_10000036 3300013297 Bacteria 117422
122 Ga0157378_10020367 3300013297 Bacteria 5834
123 Ga0157378_10289219 3300013297 Bacteria 1582
124 Ga0163162_10030572 3300013306 Bacteria 5336
125 Ga0163162_10089499 3300013306 Bacteria 3159
126 Ga0157375_10175855 3300013308 Bacteria 2290
127 Ga0157375_10501606 3300013308 Bacteria 1378
128 Ga0163163_10152113 3300014325 Bacteria 2357
129 Ga0157379_10030690 3300014968 Bacteria 4787
130 Ga0157379_10031160 3300014968 Bacteria 4750
131 Ga0157379_10886413 3300014968 Bacteria 846
132 Ga0157376_10000032 3300014969 Bacteria 167294
133 Ga0157376_10126235 3300014969 Bacteria 2276
134 Ga0213874_10019878 3300021377 Bacteria 1834
135 Ga0207680_10411314 3300025903 Bacteria 957
136 Ga0207685_10208010 3300025905 Unclassified 923
137 Ga0207699_10081381 3300025906 Bacteria 2009
138 Ga0207684_10019631 3300025910 Bacteria 5781
139 Ga0207684_10029096 3300025910 Unclassified 4706
140 Ga0207684_10454434 3300025910 Unclassified 1099
141 Ga0207693_10061395 3300025915 Unclassified 2943
142 Ga0207663_10082852 3300025916 Bacteria 2105
143 Ga0207663_10602366 3300025916 Unclassified 863
144 Ga0207662_10005106 3300025918 Bacteria 6964
145 Ga0207646_10000012 3300025922 Bacteria 367049
146 Ga0207646_10001335 3300025922 Bacteria 30678
147 Ga0207646_10666252 3300025922 Bacteria 932
148 Ga0207694_10635904 3300025924 Bacteria 899
149 Ga0207687_10047838 3300025927 Bacteria 2966
150 Ga0207700_10163957 3300025928 Bacteria 1848
151 Ga0207690_10051870 3300025932 Bacteria 2745
152 Ga0207690_10225146 3300025932 Unclassified 1437
153 Ga0207669_11198829 3300025937 Unclassified 643
154 Ga0207704_10425765 3300025938 Bacteria 1053
155 Ga0207665_10000028 3300025939 Bacteria 96657
156 Ga0207665_10021770 3300025939 Bacteria 4218
157 Ga0207665_10029214 3300025939 Bacteria 3645
158 Ga0207665_10043448 3300025939 Unclassified 3005
159 Ga0207665_10627503 3300025939 Unclassified 841
160 Ga0207711_10073430 3300025941 Bacteria 2973
161 Ga0207711_10150364 3300025941 Unclassified 2100
162 Ga0207689_10091830 3300025942 Bacteria 2494
163 Ga0207679_10542314 3300025945 Bacteria 1043
164 Ga0207651_10868380 3300025960 Unclassified 802
165 Ga0207712_10531198 3300025961 Unclassified 1009
166 Ga0207658_10283099 3300025986 Bacteria 1422
167 Ga0207677_10372429 3300026023 Bacteria 1203
168 Ga0207703_10245930 3300026035 Unclassified 1610
169 Ga0207703_10732320 3300026035 Unclassified 941
170 Ga0207641_10005653 3300026088 Bacteria 10645
171 Ga0207676_10360428 3300026095 Bacteria 1347
172 Ga0207674_10295852 3300026116 Bacteria 1568
173 Ga0209588_1002297 3300027671 Bacteria 5171
174 Ga0209588_1008594 3300027671 Bacteria 3031
175 Ga0209588_1022848 3300027671 Bacteria 1969
176 Ga0209588_1080625 3300027671 Unclassified 1051
177 Ga0207428_10010127 3300027907 Bacteria 8431
178 Ga0268266_10006017 3300028379 Bacteria 11191
179 Ga0268265_10226105 3300028380 Bacteria 1641
180 Ga0268264_10020666 3300028381 Bacteria 5379
181 Ga0268264_10024705 3300028381 Bacteria 4908
182 Ga0268264_10027057 3300028381 Bacteria 4685
183 Ga0268264_10521535 3300028381 Bacteria 1162
184 Ga0265332_10253493 3300031238 Bacteria 728
185 Ga0265314_10109427 3300031711 Bacteria 1759
186 Ga0307405_10314868 3300031731 Unclassified 1193
187 Ga0307409_100788773 3300031995 Unclassified 957
188 Ga0373931_0054070 3300035691 Bacteria 2145
189 Ga0373931_0265244 3300035691 Unclassified 1049
190 Ga0373927_0000181 3300035695 Bacteria 49692
191 Ga0373927_0051368 3300035695 Bacteria 2666
192 Ga0373947_0094319 3300035725 Bacteria 1871
193 Ga0373947_0128488 3300035725 Bacteria 1616
194 Ga0373925_0024192 3300037068 Bacteria 4433
195 Ga0373925_0905243 3300037068 Bacteria 727
196 Ga0373925_0922195 3300037068 Unclassified 720
197 Ga0395900_0508063 3300037418 Bacteria 1155
198 Ga0436364_0526721 3300037853 Bacteria 3489
199 Ga0436363_0485990 3300039450 Bacteria 2383
200 Ga0439435_0055060 3300042436 Bacteria 1147
201 Ga0439464_0069515 3300042439 Bacteria 1040
202 Ga0451577_0042697 3300042876 Bacteria 4065
203 Ga0451577_0355051 3300042876 Unclassified 1330
204 Ga0451577_0970542 3300042876 Unclassified 764
205 Ga0453683_0016003 3300044673 Bacteria 4845
206 Ga0451576_0038343 3300045051 Bacteria 5071
207 Ga0495603_0025099 3300046455 Bacteria 3605
208 Ga0495603_0320314 3300046455 Unclassified 890
209 Ga0495629_0014211 3300046459 Bacteria 5732
210 Ga0495580_0011712 3300046472 Bacteria 6777
211 Ga0495580_0649316 3300046472 Bacteria 694
212 Ga0495582_0000138 3300046473 Bacteria 39279
213 Ga0495582_0032581 3300046473 Bacteria 2865
214 Ga0495639_0013798 3300046475 Unclassified 3494
215 Ga0495664_0156134 3300046477 Bacteria 1384
216 Ga0495594_0026770 3300046499 Unclassified 3104
217 Ga0495630_0028550 3300046517 Bacteria 4145
218 Ga0495666_0158664 3300046526 Unclassified 1049
219 Ga0495666_0244688 3300046526 Bacteria 818
220 Ga0495640_0054846 3300046533 Bacteria 2728
221 Ga0495586_0022627 3300046535 Unclassified 3354
222 Ga0495621_0142463 3300046539 Bacteria 939
223 Ga0495645_0013042 3300046543 Unclassified 5869
224 Ga0495634_0181489 3300046642 Bacteria 1317
225 Ga0495635_0067149 3300046663 Bacteria 2460
226 Ga0495647_0004320 3300046681 Bacteria 4605
227 Ga0495658_0016246 3300046683 Unclassified 3831
228 Ga0495613_0123307 3300046689 Bacteria 1859
229 Ga0495624_0255636 3300046690 Bacteria 1059
230 Ga0495624_0363656 3300046690 Bacteria 870
231 Ga0495581_0042678 3300047315 Bacteria 2624
232 Ga0495674_0008072 3300047319 Bacteria 10050
233 Ga0495676_0199386 3300047321 Bacteria 1391
234 Ga0495680_0028266 3300047322 Bacteria 4599
235 Ga0495677_0072132 3300047445 Bacteria 1288
236 Ga0495677_0138056 3300047445 Bacteria 935
237 Ga0495684_0129154 3300047471 Bacteria 1899
238 Ga0495593_0034581 3300047673 Bacteria 2748
239 Ga0495614_0020004 3300048089 Bacteria 2895
240 Ga0496100_0431529 3300048903 Unclassified 1008
241 Ga0496101_0103845 3300048904 Bacteria 2130
242 Ga0496102_0068206 3300048905 Bacteria 3263
243 Ga0496104_0494877 3300048907 Unclassified 1134
244 Ga0496105_0046608 3300048908 Bacteria 3578
245 Ga0496105_0385541 3300048908 Unclassified 1115
246 Ga0496106_0148271 3300048909 Bacteria 1849
247 Ga0496107_0329565 3300048910 Bacteria 1136
248 Ga0496111_0476061 3300048914 Bacteria 920
249 Ga0496112_0158343 3300048915 Bacteria 2231
250 Ga0496114_0044196 3300048917 Bacteria 3695
251 Ga0496114_0044963 3300048917 Bacteria 3666
252 Ga0496115_0007685 3300048918 Bacteria 7947
253 Ga0496115_0439119 3300048918 Unclassified 1056
254 Ga0501298_032370 3300049521 Unclassified 1032
255 Ga0501031_0284604 3300049568 Unclassified 1072
256 Ga0501033_0096440 3300049570 Bacteria 2161
257 Ga0501036_0009525 3300049572 Bacteria 7990
258 Ga0501036_0133374 3300049572 Unclassified 2096
259 Ga0501038_0325130 3300049574 Unclassified 1202
260 Ga0501039_0127198 3300049575 Bacteria 1999
261 Ga0501039_0211397 3300049575 Unclassified 1525
262 Ga0501040_0045980 3300049576 Bacteria 2979
263 Ga0501040_0057289 3300049576 Unclassified 2675
264 Ga0501040_0320017 3300049576 Bacteria 1109
265 Ga0501041_0001985 3300049577 Bacteria 11498
266 Ga0501041_0060355 3300049577 Bacteria 2321
267 Ga0501041_0326151 3300049577 Unclassified 969
268 Ga0501042_0172338 3300049578 Bacteria 1561
269 Ga0501042_0268347 3300049578 Unclassified 1232
270 Ga0501043_0249327 3300049579 Bacteria 1368
271 Ga0501046_0048090 3300049580 Bacteria 3379
272 Ga0501046_0199103 3300049580 Unclassified 1491
273 Ga0501048_0176478 3300049582 Unclassified 1514
274 Ga0501048_0218375 3300049582 Bacteria 1352
275 Ga0501068_0054096 3300049584 Bacteria 2432
276 Ga0501071_0018149 3300049587 Unclassified 4866
277 Ga0501071_0031261 3300049587 Bacteria 3773
278 Ga0501072_0017797 3300049588 Bacteria 5464
279 Ga0501072_0107155 3300049588 Unclassified 2223
280 Ga0501072_0124433 3300049588 Unclassified 2054
281 Ga0501074_0114227 3300049590 Bacteria 1932
282 Ga0501075_0004590 3300049591 Bacteria 9365
283 Ga0501075_0138750 3300049591 Bacteria 1852
284 Ga0501076_0004113 3300049592 Bacteria 10286
285 Ga0501076_0022212 3300049592 Unclassified 4874
286 Ga0501076_0082942 3300049592 Bacteria 2574
287 Ga0501076_0392262 3300049592 Unclassified 1141
288 Ga0501079_0000362 3300049741 Bacteria 29215
289 Ga0501079_0036835 3300049741 Unclassified 3768
290 Ga0501079_0333221 3300049741 Bacteria 1188
291 Ga0501080_0095506 3300049742 Bacteria 2760
292 Ga0501080_0211354 3300049742 Unclassified 1778
293 Ga0501081_0137032 3300049743 Unclassified 1752
294 Ga0501081_0145145 3300049743 Bacteria 1702
295 Ga0501081_0626934 3300049743 Bacteria 805
296 Ga0501083_0000821 3300049744 Bacteria 20331
297 Ga0501035_0069049 3300049822 Bacteria 3133
298 Ga0501045_0000073 3300049824 Bacteria 47539
299 Ga0501045_0018439 3300049824 Bacteria 4964
300 Ga0501045_0733702 3300049824 Bacteria 728
301 nmdc:mga05p37_189350_c1 3300050507 Bacteria 2499
302 nmdc:mga05p37_257961_c1 3300050507 Unclassified 2088
303 nmdc:mga06r32_116653_c1 3300050510 Bacteria 2631
304 nmdc:mga06r32_175350_c1 3300050510 Bacteria 2128
305 nmdc:mga08y16_23282_c1 3300050511 Bacteria 6541
306 nmdc:mga0n895_103919_c1 3300050512 Bacteria 2853
307 nmdc:mga0n895_126303_c1 3300050512 Bacteria 2582
308 nmdc:mga0n895_642361_c1 3300050512 Unclassified 1061
309 nmdc:mga0n895_830397_c1 3300050512 Unclassified 913
310 nmdc:mga0rr50_298245_c1 3300050513 Bacteria 1348
311 nmdc:mga0rr50_6268_c1 3300050513 Bacteria 7218
312 nmdc:mga0rr50_755853_c1 3300050513 Unclassified 830
313 nmdc:mga0rr50_758028_c1 3300050513 Bacteria 828
314 nmdc:mga08x19_180_c1 3300050514 Bacteria 50906
315 nmdc:mga08x19_18320_c1 3300050514 Bacteria 4291
316 nmdc:mga08x19_3620_c1 3300050514 Bacteria 9202
317 nmdc:mga0a205_1097940_c1 3300050515 Unclassified 643
318 nmdc:mga0a205_35118_c1 3300050515 Bacteria 4814
319 nmdc:mga0a205_707963_c1 3300050515 Unclassified 857
320 nmdc:mga0a205_911348_c1 3300050515 Unclassified 726
321 Ga0495619_0134993 3300053085 Bacteria 1697
322 Ga0501084_0022318 3300054114 Bacteria 5283
323 Ga0501082_0000290 3300060353 Bacteria 44323
324 Ga0501082_0031903 3300060353 Unclassified 4544
325 Ga0501082_0100575 3300060353 Unclassified 2501
326 Ga0501082_0364650 3300060353 Bacteria 1260
327 Ga0501082_1229635 3300060353 Unclassified 654
328 Ga0530510_0002349 3300061734 Bacteria 12987
329 Ga0530510_0240516 3300061734 Unclassified 1348
330 Ga0070709_10078184
331 JGI25407J50210_10104629
332 Ga0065712_10281593
333 Ga0065715_10132144
334 Ga0065715_10163068
335 Ga0070690_100085490
336 Ga0070690_100254011
337 Ga0068869_100615745
338 Ga0070680_100001961
339 Ga0068868_100421058
340 Ga0070689_100037580
341 Ga0070689_100105162
342 Ga0070687_100266134
343 Ga0070675_101303338
344 Ga0070659_100204480
345 Ga0070667_100332784
346 Ga0070709_10025317
347 Ga0070709_10580648
348 Ga0070713_100281483
349 Ga0070711_100017454
350 Ga0070711_100375462
351 Ga0070705_100125492
352 Ga0070694_100002976
353 Ga0070708_100080481
354 Ga0070708_100107018
355 Ga0070708_100250431
356 Ga0070708_100262536
357 Ga0070706_100045470
358 Ga0070706_100359760
359 Ga0070707_100002239
360 Ga0070707_100011282
361 Ga0070707_100191766
362 Ga0070698_100002687
363 Ga0070698_100038064
364 Ga0070698_100053791
365 Ga0070698_100801253
366 Ga0070697_100013596
367 Ga0070697_100040517
368 Ga0070697_100095527
369 Ga0070697_100108789
370 Ga0070672_100173384
371 Ga0070686_100158373
372 Ga0070695_100006888
373 Ga0070695_100970657
374 Ga0070665_100002709
375 Ga0070704_100000496
376 Ga0070704_100008361
377 Ga0070704_100058661
378 Ga0070704_100204778
379 Ga0070704_100301027
380 Ga0068857_100263281
381 Ga0070702_100362136
382 Ga0068852_101004107
383 Ga0068859_100000008
384 Ga0068859_100226800
385 Ga0068859_100325714
386 Ga0068859_100823915
387 Ga0068864_100034575
388 Ga0068863_100001386
389 Ga0068863_101195187
390 Ga0068858_100069264
391 Ga0068858_101012541
392 Ga0068860_100004570
393 Ga0068860_100017650
394 Ga0068860_100082514
395 Ga0068860_100458435
396 Ga0068862_100193192
397 Ga0081455_10113278
398 Ga0081538_10057397
399 Ga0070715_10270696
400 Ga0070715_10361897
401 Ga0070716_100000077
402 Ga0070716_100009766
403 Ga0070716_100053644
404 Ga0070716_100209726
405 Ga0070716_100668273
406 Ga0070712_100016257
407 Ga0070712_100291509
408 Ga0070712_100528025
409 Ga0097621_100329946
410 Ga0075370_10168527
411 Ga0068871_100046303
412 Ga0075428_100123753
413 Ga0075431_100224269
414 Ga0075433_10211348
415 Ga0075433_10528779
416 Ga0075434_100010924
417 Ga0075434_100029909
418 Ga0075434_100235001
419 Ga0075429_100201295
420 Ga0075436_100000292
421 Ga0075436_100048586
422 Ga0097620_100000008
423 Ga0097620_100226798
424 Ga0097620_100325743
425 Ga0097620_100823861
426 Ga0075435_100006761
427 Ga0075435_100229247
428 Ga0075435_100238543
429 Ga0075435_100251330
430 Ga0075435_100256911
431 Ga0099794_10010825
432 Ga0099794_10023784
433 Ga0099794_10049648
434 Ga0099794_10053655
435 Ga0099794_10143680
436 Ga0099795_10164694
437 Ga0111539_10030262
438 Ga0111539_10275515
439 Ga0105245_10065833
440 Ga0114129_10089198
441 Ga0114129_10166173
442 Ga0114129_11993832
443 Ga0105243_10328329
444 Ga0105248_10100450
445 Ga0105238_10657906
446 Ga0105249_10039142
447 Ga0105249_10407672
448 Ga0105239_10102059
449 Ga0157374_10433037
450 Ga0157378_10000036
451 Ga0157378_10020367
452 Ga0157378_10289219
453 Ga0163162_10030572
454 Ga0163162_10089499
455 Ga0157375_10175855
456 Ga0157375_10501606
457 Ga0163163_10152113
458 Ga0157379_10030690
459 Ga0157379_10031160
460 Ga0157379_10886413
461 Ga0157376_10000032
462 Ga0157376_10126235
463 Ga0213874_10019878
464 Ga0207680_10411314
465 Ga0207685_10208010
466 Ga0207699_10081381
467 Ga0207684_10019631
468 Ga0207684_10029096
469 Ga0207684_10454434
470 Ga0207693_10061395
471 Ga0207663_10082852
472 Ga0207663_10602366
473 Ga0207662_10005106
474 Ga0207646_10000012
475 Ga0207646_10001335
476 Ga0207646_10666252
477 Ga0207694_10635904
478 Ga0207687_10047838
479 Ga0207700_10163957
480 Ga0207690_10051870
481 Ga0207690_10225146
482 Ga0207669_11198829
483 Ga0207704_10425765
484 Ga0207665_10000028
485 Ga0207665_10021770
486 Ga0207665_10029214
487 Ga0207665_10043448
488 Ga0207665_10627503
489 Ga0207711_10073430
490 Ga0207711_10150364
491 Ga0207689_10091830
492 Ga0207679_10542314
493 Ga0207651_10868380
494 Ga0207712_10531198
495 Ga0207658_10283099
496 Ga0207677_10372429
497 Ga0207703_10245930
498 Ga0207703_10732320
499 Ga0207641_10005653
500 Ga0207676_10360428
501 Ga0207674_10295852
502 Ga0209588_1002297
503 Ga0209588_1008594
504 Ga0209588_1022848
505 Ga0209588_1080625
506 Ga0207428_10010127
507 Ga0268266_10006017
508 Ga0268265_10226105
509 Ga0268264_10020666
510 Ga0268264_10024705
511 Ga0268264_10027057
512 Ga0268264_10521535
513 Ga0265332_10253493
514 Ga0265314_10109427
515 Ga0307405_10314868
516 Ga0307409_100788773
517 Ga0373931_0054070
518 Ga0373931_0265244
519 Ga0373927_0000181
520 Ga0373927_0051368
521 Ga0373947_0094319
522 Ga0373947_0128488
523 Ga0373925_0024192
524 Ga0373925_0905243
525 Ga0373925_0922195
526 Ga0395900_0508063
527 Ga0436364_0526721
528 Ga0436363_0485990
529 Ga0439435_0055060
530 Ga0439464_0069515
531 Ga0451577_0042697
532 Ga0451577_0355051
533 Ga0451577_0970542
534 Ga0453683_0016003
535 Ga0451576_0038343
536 Ga0495603_0025099
537 Ga0495603_0320314
538 Ga0495629_0014211
539 Ga0495580_0011712
540 Ga0495580_0649316
541 Ga0495582_0000138
542 Ga0495582_0032581
543 Ga0495639_0013798
544 Ga0495664_0156134
545 Ga0495594_0026770
546 Ga0495630_0028550
547 Ga0495666_0158664
548 Ga0495666_0244688
549 Ga0495640_0054846
550 Ga0495586_0022627
551 Ga0495621_0142463
552 Ga0495645_0013042
553 Ga0495634_0181489
554 Ga0495635_0067149
555 Ga0495647_0004320
556 Ga0495658_0016246
557 Ga0495613_0123307
558 Ga0495624_0255636
559 Ga0495624_0363656
560 Ga0495581_0042678
561 Ga0495674_0008072
562 Ga0495676_0199386
563 Ga0495680_0028266
564 Ga0495677_0072132
565 Ga0495677_0138056
566 Ga0495684_0129154
567 Ga0495593_0034581
568 Ga0495614_0020004
569 Ga0496100_0431529
570 Ga0496101_0103845
571 Ga0496102_0068206
572 Ga0496104_0494877
573 Ga0496105_0046608
574 Ga0496105_0385541
575 Ga0496106_0148271
576 Ga0496107_0329565
577 Ga0496111_0476061
578 Ga0496112_0158343
579 Ga0496114_0044196
580 Ga0496114_0044963
581 Ga0496115_0007685
582 Ga0496115_0439119
583 Ga0501298_032370
584 Ga0501031_0284604
585 Ga0501033_0096440
586 Ga0501036_0009525
587 Ga0501036_0133374
588 Ga0501038_0325130
589 Ga0501039_0127198
590 Ga0501039_0211397
591 Ga0501040_0045980
592 Ga0501040_0057289
593 Ga0501040_0320017
594 Ga0501041_0001985
595 Ga0501041_0060355
596 Ga0501041_0326151
597 Ga0501042_0172338
598 Ga0501042_0268347
599 Ga0501043_0249327
600 Ga0501046_0048090
601 Ga0501046_0199103
602 Ga0501048_0176478
603 Ga0501048_0218375
604 Ga0501068_0054096
605 Ga0501071_0018149
606 Ga0501071_0031261
607 Ga0501072_0017797
608 Ga0501072_0107155
609 Ga0501072_0124433
610 Ga0501074_0114227
611 Ga0501075_0004590
612 Ga0501075_0138750
613 Ga0501076_0004113
614 Ga0501076_0022212
615 Ga0501076_0082942
616 Ga0501076_0392262
617 Ga0501079_0000362
618 Ga0501079_0036835
619 Ga0501079_0333221
620 Ga0501080_0095506
621 Ga0501080_0211354
622 Ga0501081_0137032
623 Ga0501081_0145145
624 Ga0501081_0626934
625 Ga0501083_0000821
626 Ga0501035_0069049
627 Ga0501045_0000073
628 Ga0501045_0018439
629 Ga0501045_0733702
630 nmdc:mga05p37_189350_c1
631 nmdc:mga05p37_257961_c1
632 nmdc:mga06r32_116653_c1
633 nmdc:mga06r32_175350_c1
634 nmdc:mga08y16_23282_c1
635 nmdc:mga0n895_103919_c1
636 nmdc:mga0n895_126303_c1
637 nmdc:mga0n895_642361_c1
638 nmdc:mga0n895_830397_c1
639 nmdc:mga0rr50_298245_c1
640 nmdc:mga0rr50_6268_c1
641 nmdc:mga0rr50_755853_c1
642 nmdc:mga0rr50_758028_c1
643 nmdc:mga08x19_180_c1
644 nmdc:mga08x19_18320_c1
645 nmdc:mga08x19_3620_c1
646 nmdc:mga0a205_1097940_c1
647 nmdc:mga0a205_35118_c1
648 nmdc:mga0a205_707963_c1
649 nmdc:mga0a205_911348_c1
650 Ga0495619_0134993
651 Ga0501084_0022318
652 Ga0501082_0000290
653 Ga0501082_0031903
654 Ga0501082_0100575
655 Ga0501082_0364650
656 Ga0501082_1229635
657 Ga0530510_0002349
658 Ga0530510_0240516

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

85

153

0.87

PF03079

ARD

ARD/ARD' family

5

164

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
4qgm-assembly1.cif.gz_A acireductone dioxygenase from bacillus anthracis with cadmium ion in active center 0.9208 1 161
8awn-assembly1.cif.gz_A-2 crystal structure of a manganese-containing cupin (tm1459) from thermotoga maritima, variant c106q 0.8701 88 150
3myx-assembly2.cif.gz_B crystal structure of a pspto_0244 (protein with unknown function which belongs to pfam duf861 family) from pseudomonas syringae pv. tomato str. dc3000 at 1.30 a resolution 0.8699 88 150
4qgm-assembly1.cif.gz_A acireductone dioxygenase from bacillus anthracis with cadmium ion in active center 0.8546 1 161
2ozj-assembly2.cif.gz_B-3 crystal structure of a cupin superfamily protein (dsy2733) from desulfitobacterium hafniense dcb-2 at 1.60 a resolution 0.8504 88 151
ID Description Score Start End Superfamily
4qgmA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9208 1 161 2.60.120.10
af_Q54ER6_1_147_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8819 1 161 2.60.120.10
af_A0A0R0J2E3_68_132_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8778 90 153 2.60.120.10
af_A0A1D6GLE7_2_119_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8775 23 147 2.60.120.10
af_A0A1D6H377_2_150_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8669 23 165 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A2V8XS93-F1-model_v4 acireductone dioxygenase (Fe(2+)-requiring) (EC 1.13.11.54) 0.9813 1 133 GO:0009086
GO:0010309
GO:0046872
AF-A0A3D1EWJ1-F1-model_v4 acireductone dioxygenase (Fe(2+)-requiring) (EC 1.13.11.54) 0.9806 1 153 GO:0005506
GO:0010308
GO:0010309
GO:0016151
GO:0019284
AF-A0A6I5NX87-F1-model_v4 Acireductone dioxygenase (1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase) (DHK-MTPene dioxygenase) (Acireductone dioxygenase (Fe(2+)-requiring)) (ARD') (Fe-ARD) (EC 1.13.11.54) (Acireductone dioxygenase (Ni(2+)-requiring)) (ARD) (Ni-ARD) (EC 1.13.11.53) 0.9766 1 168 GO:0005506
GO:0010308
GO:0010309
GO:0016151
GO:0019284
GO:0019509
AF-A0A1F6GAE3-F1-model_v4 Acireductone dioxygenase (1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase) (DHK-MTPene dioxygenase) (Acireductone dioxygenase (Fe(2+)-requiring)) (ARD') (Fe-ARD) (EC 1.13.11.54) (Acireductone dioxygenase (Ni(2+)-requiring)) (ARD) (Ni-ARD) (EC 1.13.11.53) 0.9669 1 168 GO:0005506
GO:0010308
GO:0010309
GO:0016151
GO:0019284
GO:0019509
AF-A0A532BZV0-F1-model_v4 Acireductone dioxygenase (1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase) (DHK-MTPene dioxygenase) (Acireductone dioxygenase (Fe(2+)-requiring)) (ARD') (Fe-ARD) (EC 1.13.11.54) (Acireductone dioxygenase (Ni(2+)-requiring)) (ARD) (Ni-ARD) (EC 1.13.11.53) 0.965 1 168 GO:0005506
GO:0010308
GO:0010309
GO:0016151
GO:0019284
GO:0019509

Map