F409383

General Info

Members Datasets Scaffolds Average Seq Length
328 180 317 294

Family's Representative Sequence

Representative Sequence 3300046501|Ga0495607_0129913|Ga0495607_0129913_104_1087
Length 327
Sequence MPALPSCETSHACTLTPHQKKYKPMEIEYMNSDHLILVTGATGATGGYAIDHLLDKGVRVRAFVRSDDARAQKLRERGVDVALGDLVDFHSVRSAMQGVHAAYFVYPIMQPGILNATAFFAEAARESGVQAIVNMSQISARRDAASHAARDHWFSEQVFNWSGIPTTHLRPTFFMEWLLYGFQLPLIAQHGILQVPAGEGRHAPIAAEDQGRLIAAILREPTRHVGKVYPLFGAKEMNHQQIAAAVGEALGREIRYVPESIAGFEQRLSGLGLPEHFIQHVSAVYQDYQNGIFAGHDSLIQDITGLPPMTVQQFVQEKRDRFMPGAN

Samples

Sample ID Description Type Environment
1 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
2 2643221664 Massilia sp. Root418 Isolate Unclassified
3 2738541280 Massilia sp. GV090 Isolate Unclassified
4 2738541300 Massilia sp. GV016 Isolate Unclassified
5 2738543018 Massilia sp. GV045 Isolate Unclassified
6 2738543030 Massilia sp. GV097 Isolate Unclassified
7 2857558681 Duganella sp. R-74565 Isolate Unclassified
8 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
9 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
10 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
11 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
12 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
27 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
28 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
29 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
35 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
36 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
37 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
38 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
46 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
51 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
52 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
53 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
54 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
55 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
56 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
57 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
76 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
77 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
78 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
79 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
80 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
81 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
82 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
83 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
84 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
85 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
86 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
87 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
88 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
89 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
90 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
91 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
92 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
93 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
94 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
95 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
96 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
97 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
98 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
99 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
100 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
101 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
102 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
103 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
104 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
105 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
106 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
107 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
108 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
109 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
110 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
111 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
112 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
113 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
114 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
115 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
116 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
117 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
118 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
119 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
120 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
121 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
122 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
123 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
124 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
125 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
126 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
127 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
128 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
129 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
130 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
131 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
132 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
133 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
134 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
135 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
136 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
137 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
138 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
139 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
140 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
141 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
142 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
143 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
144 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
145 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
146 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
147 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
148 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
149 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
150 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
151 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
152 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
153 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
154 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
155 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
156 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
157 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
158 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
159 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
160 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
161 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
162 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
163 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
164 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
165 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
166 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
167 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
168 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
169 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
171 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
172 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
173 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
174 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
175 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
176 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
177 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
178 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
179 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
180 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.65
Metatranscriptomes 0
Isolates 3.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.74
Nodule 0.3
Rhizoplane 3.66
Rhizosphere 82.01
Stem 0
Stem Tuber 0
Unclassified 11.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10145178 3300003316 Bacteria 2766
2 rootH2_10009210 3300003320 Bacteria 76383
3 rootH2_10070197 3300003320 Bacteria 6540
4 rootH1_10219652 3300003323 Bacteria 2726
5 Ga0065714_10015673 3300005288 Bacteria 1808
6 Ga0070658_10112074 3300005327 Bacteria 2261
7 Ga0070660_100052210 3300005339 Bacteria 3151
8 Ga0070669_100018354 3300005353 Bacteria 5000
9 Ga0070671_100010479 3300005355 Bacteria 7438
10 Ga0070713_100041536 3300005436 Bacteria 3748
11 Ga0070713_100225615 3300005436 Bacteria 1701
12 Ga0070708_100373793 3300005445 Bacteria 1344
13 Ga0070698_100271649 3300005471 Bacteria 1627
14 Ga0068853_100002318 3300005539 Bacteria 14257
15 Ga0068853_100112712 3300005539 Bacteria 2417
16 Ga0068855_100013216 3300005563 Bacteria 9959
17 Ga0068855_100095430 3300005563 Unclassified 3428
18 Ga0068856_100088229 3300005614 Bacteria 3084
19 Ga0068852_100011644 3300005616 Bacteria 6635
20 Ga0075364_10187374 3300006051 Bacteria 1401
21 Ga0075367_10037239 3300006178 Bacteria 2826
22 Ga0075369_10057009 3300006186 Bacteria 1698
23 Ga0097621_100274559 3300006237 Bacteria 1482
24 Ga0105251_10000884 3300009011 Bacteria 26850
25 Ga0105240_10000105 3300009093 Bacteria 172035
26 Ga0105240_10006560 3300009093 Bacteria 17087
27 Ga0105240_10010621 3300009093 Bacteria 12935
28 Ga0111539_10219299 3300009094 Bacteria 2216
29 Ga0105245_10043687 3300009098 Bacteria 3997
30 Ga0105247_10044621 3300009101 Bacteria 2719
31 Ga0105243_10048987 3300009148 Bacteria 3332
32 Ga0105241_10034020 3300009174 Bacteria 3828
33 Ga0105241_10354061 3300009174 Bacteria 1276
34 Ga0105248_10021391 3300009177 Bacteria 7167
35 Ga0105237_10000184 3300009545 Bacteria 88328
36 Ga0105237_10091654 3300009545 Bacteria 3029
37 Ga0105237_10096594 3300009545 Bacteria 2945
38 Ga0105238_10001313 3300009551 Bacteria 24953
39 Ga0105238_10007866 3300009551 Bacteria 10665
40 Ga0105249_10878643 3300009553 Bacteria 963
41 Ga0105239_10002247 3300010375 Bacteria 24690
42 Ga0105239_10671454 3300010375 Bacteria 1184
43 Ga0157371_10000992 3300013102 Bacteria 31395
44 Ga0157370_10001546 3300013104 Bacteria 28479
45 Ga0157370_10003553 3300013104 Bacteria 18251
46 Ga0157370_10006567 3300013104 Bacteria 12810
47 Ga0157369_10001815 3300013105 Bacteria 25847
48 Ga0157369_10192692 3300013105 Bacteria 2141
49 Ga0157374_10253255 3300013296 Bacteria 1733
50 Ga0157378_10003911 3300013297 Bacteria 13200
51 Ga0163162_10068287 3300013306 Bacteria 3606
52 Ga0157375_10024566 3300013308 Bacteria 5580
53 Ga0163163_10657948 3300014325 Bacteria 1111
54 Ga0182008_10018821 3300014497 Bacteria 3573
55 Ga0182008_10024179 3300014497 Bacteria 3095
56 Ga0182008_10045853 3300014497 Bacteria 2174
57 Ga0182008_10111498 3300014497 Bacteria 1356
58 Ga0157376_10169087 3300014969 Bacteria 1989
59 Ga0182006_1014417 3300015261 Bacteria 3409
60 Ga0182007_10004009 3300015262 Bacteria 6794
61 Ga0182007_10004400 3300015262 Bacteria 6390
62 Ga0182007_10027900 3300015262 Bacteria 1943
63 Ga0182007_10041862 3300015262 Bacteria 1526
64 Ga0182005_1009293 3300015265 Bacteria 2864
65 Ga0182005_1014909 3300015265 Bacteria 2171
66 Ga0182005_1014920 3300015265 Bacteria 2170
67 Ga0182005_1021838 3300015265 Bacteria 1754
68 Ga0163161_10002296 3300017792 Bacteria 13710
69 Ga0163161_10018159 3300017792 Bacteria 4931
70 Ga0213875_10034958 3300021388 Bacteria 2372
71 Ga0209051_1000466 3300025303 Bacteria 53034
72 Ga0207713_1000705 3300025735 Bacteria 31261
73 Ga0207710_10062085 3300025900 Bacteria 1697
74 Ga0207705_10006642 3300025909 Bacteria 8559
75 Ga0207695_10000193 3300025913 Bacteria 172070
76 Ga0207695_10001845 3300025913 Bacteria 33224
77 Ga0207695_10003177 3300025913 Bacteria 23406
78 Ga0207671_10000190 3300025914 Bacteria 95031
79 Ga0207681_10000385 3300025923 Bacteria 30919
80 Ga0207694_10001321 3300025924 Bacteria 21324
81 Ga0207644_10060265 3300025931 Bacteria 2746
82 Ga0207709_10041938 3300025935 Bacteria 2749
83 Ga0207665_10210248 3300025939 Bacteria 1421
84 Ga0207711_10076063 3300025941 Bacteria 2923
85 Ga0207667_10003116 3300025949 Bacteria 20514
86 Ga0207667_10158457 3300025949 Bacteria 2329
87 Ga0207639_10226392 3300026041 Bacteria 1618
88 Ga0207702_10091891 3300026078 Bacteria 2658
89 Ga0207676_10245044 3300026095 Bacteria 1610
90 Ga0207683_10448310 3300026121 Bacteria 1190
91 Ga0207698_10044803 3300026142 Bacteria 3327
92 Ga0207428_10158517 3300027907 Bacteria 1719
93 Ga0307408_100271768 3300031548 Bacteria 1407
94 Ga0307405_10151481 3300031731 Bacteria 1631
95 Ga0307407_10062412 3300031903 Bacteria 2182
96 Ga0307412_10002580 3300031911 Bacteria 10065
97 Ga0307412_10037057 3300031911 Bacteria 3130
98 Ga0307416_100077902 3300032002 Bacteria 2786
99 Ga0395900_0140040 3300037418 Bacteria 2478
100 Ga0436364_0072478 3300037853 Bacteria 4058
101 Ga0439438_006513 3300041405 Bacteria 4108
102 Ga0439447_001705 3300041407 Bacteria 8068
103 Ga0439447_033520 3300041407 Bacteria 1280
104 Ga0439466_0000144 3300041411 Bacteria 28352
105 Ga0439466_0001952 3300041411 Bacteria 8086
106 Ga0439466_0015239 3300041411 Bacteria 2793
107 Ga0439466_0057312 3300041411 Bacteria 1262
108 Ga0439465_0006220 3300041413 Bacteria 3793
109 Ga0439465_0008389 3300041413 Bacteria 3261
110 Ga0439431_0019179 3300041997 Bacteria 1623
111 Ga0439442_006681 3300042002 Bacteria 2318
112 Ga0439445_0005876 3300042004 Bacteria 2807
113 Ga0439451_004336 3300042009 Bacteria 2880
114 Ga0439452_001012 3300042010 Bacteria 12440
115 Ga0439452_007480 3300042010 Bacteria 3343
116 Ga0439456_036094 3300042013 Bacteria 1066
117 Ga0439463_019208 3300042016 Bacteria 1702
118 Ga0450911_000009 3300042115 Bacteria 162968
119 Ga0450905_000011 3300042142 Bacteria 19765
120 Ga0439434_0015039 3300042435 Bacteria 2305
121 Ga0466959_0116091 3300045049 Bacteria 1906
122 Ga0466967_0219083 3300045976 Bacteria 1808
123 Ga0495617_000643 3300046452 Bacteria 17487
124 Ga0495617_066537 3300046452 Unclassified 1187
125 Ga0495627_019920 3300046453 Bacteria 2243
126 Ga0495603_0013296 3300046455 Bacteria 4976
127 Ga0495590_0013948 3300046457 Bacteria 2945
128 Ga0495590_0086258 3300046457 Unclassified 1108
129 Ga0495591_000739 3300046458 Bacteria 23615
130 Ga0495591_006547 3300046458 Bacteria 5127
131 Ga0495591_007970 3300046458 Bacteria 4406
132 Ga0495591_019409 3300046458 Bacteria 2275
133 Ga0495629_0288999 3300046459 Bacteria 1124
134 Ga0495638_0012338 3300046460 Bacteria 5860
135 Ga0495638_0034484 3300046460 Bacteria 3230
136 Ga0495638_0146670 3300046460 Bacteria 1372
137 Ga0495650_0000896 3300046471 Bacteria 35106
138 Ga0495650_0004671 3300046471 Bacteria 9249
139 Ga0495605_0000011 3300046474 Bacteria 314856
140 Ga0495605_0000128 3300046474 Bacteria 100439
141 Ga0495605_0000148 3300046474 Bacteria 90877
142 Ga0495605_0003905 3300046474 Bacteria 8834
143 Ga0495605_0025475 3300046474 Bacteria 3082
144 Ga0495584_0001137 3300046491 Bacteria 16464
145 Ga0495584_0019748 3300046491 Bacteria 3423
146 Ga0495594_0003210 3300046499 Bacteria 8469
147 Ga0495594_0017721 3300046499 Bacteria 3765
148 Ga0495607_0000313 3300046501 Bacteria 50578
149 Ga0495607_0001991 3300046501 Bacteria 17191
150 Ga0495607_0002696 3300046501 Bacteria 14172
151 Ga0495607_0003894 3300046501 Bacteria 11246
152 Ga0495607_0005644 3300046501 Bacteria 8922
153 Ga0495607_0012335 3300046501 Bacteria 5648
154 Ga0495607_0129913 3300046501 Unclassified 1312
155 Ga0495583_0000047 3300046506 Bacteria 217720
156 Ga0495583_0003911 3300046506 Bacteria 11025
157 Ga0495583_0004769 3300046506 Bacteria 9517
158 Ga0495583_0017298 3300046506 Bacteria 3832
159 Ga0495606_0000088 3300046507 Bacteria 155985
160 Ga0495606_0000754 3300046507 Bacteria 49732
161 Ga0495606_0001407 3300046507 Bacteria 32362
162 Ga0495606_0002882 3300046507 Bacteria 19013
163 Ga0495606_0006579 3300046507 Bacteria 10685
164 Ga0495606_0023965 3300046507 Bacteria 4410
165 Ga0495606_0025815 3300046507 Bacteria 4198
166 Ga0495606_0117567 3300046507 Bacteria 1595
167 Ga0495606_0131480 3300046507 Bacteria 1487
168 Ga0495610_0004195 3300046512 Bacteria 10762
169 Ga0495610_0014667 3300046512 Bacteria 4593
170 Ga0495616_0000150 3300046513 Bacteria 60876
171 Ga0495616_0040795 3300046513 Bacteria 2370
172 Ga0495620_0000086 3300046515 Bacteria 76675
173 Ga0495620_0000225 3300046515 Bacteria 42537
174 Ga0495620_0000540 3300046515 Bacteria 24076
175 Ga0495620_0000592 3300046515 Bacteria 22694
176 Ga0495631_0000150 3300046518 Bacteria 47394
177 Ga0495631_0000337 3300046518 Bacteria 32281
178 Ga0495631_0002627 3300046518 Bacteria 10031
179 Ga0495631_0012068 3300046518 Bacteria 4233
180 Ga0495631_0051903 3300046518 Bacteria 1791
181 Ga0495632_0000467 3300046519 Bacteria 38367
182 Ga0495632_0001763 3300046519 Bacteria 17503
183 Ga0495632_0005659 3300046519 Bacteria 8216
184 Ga0495632_0072107 3300046519 Bacteria 1658
185 Ga0495637_0016593 3300046520 Bacteria 3441
186 Ga0495637_0058660 3300046520 Bacteria 1586
187 Ga0495643_0000134 3300046522 Bacteria 119143
188 Ga0495643_0005508 3300046522 Bacteria 8542
189 Ga0495643_0028287 3300046522 Bacteria 3144
190 Ga0495643_0098608 3300046522 Bacteria 1500
191 Ga0495648_0000085 3300046524 Bacteria 119901
192 Ga0495648_0012473 3300046524 Bacteria 6337
193 Ga0495648_0034798 3300046524 Bacteria 3273
194 Ga0495642_0000225 3300046528 Bacteria 32370
195 Ga0495654_0000866 3300046530 Bacteria 22797
196 Ga0495654_0037880 3300046530 Bacteria 2414
197 Ga0495609_0000004 3300046538 Bacteria 697346
198 Ga0495609_0008497 3300046538 Bacteria 5026
199 Ga0495597_0004471 3300046542 Bacteria 7673
200 Ga0495597_0019192 3300046542 Bacteria 3201
201 Ga0495597_0094132 3300046542 Bacteria 1269
202 Ga0495633_0000206 3300046558 Bacteria 74675
203 Ga0495656_0110275 3300046615 Unclassified 1286
204 Ga0495668_0024992 3300046616 Bacteria 3395
205 Ga0495611_0001735 3300046648 Bacteria 10550
206 Ga0495611_0001867 3300046648 Bacteria 10038
207 Ga0495611_0002187 3300046648 Bacteria 9108
208 Ga0495625_0004633 3300046660 Bacteria 12925
209 Ga0495625_0081954 3300046660 Bacteria 2245
210 Ga0495659_0002528 3300046664 Bacteria 5904
211 Ga0495661_0000005 3300046665 Bacteria 433622
212 Ga0495661_0001046 3300046665 Bacteria 24531
213 Ga0495661_0002090 3300046665 Bacteria 15676
214 Ga0495661_0002327 3300046665 Bacteria 14648
215 Ga0495661_0124216 3300046665 Bacteria 1422
216 Ga0495599_0021242 3300046678 Bacteria 4049
217 Ga0495671_0000089 3300046692 Bacteria 85775
218 Ga0495671_0001779 3300046692 Bacteria 13940
219 Ga0495671_0007600 3300046692 Bacteria 6162
220 Ga0495671_0043733 3300046692 Bacteria 2248
221 Ga0495671_0055928 3300046692 Bacteria 1954
222 Ga0495649_0009463 3300046694 Bacteria 5791
223 Ga0495649_0061952 3300046694 Bacteria 2011
224 Ga0495649_0077496 3300046694 Bacteria 1779
225 Ga0495589_0000046 3300046794 Bacteria 122544
226 Ga0495589_0000470 3300046794 Bacteria 29417
227 Ga0495589_0006076 3300046794 Bacteria 6379
228 Ga0495660_0000040 3300046810 Bacteria 172614
229 Ga0495660_0012815 3300046810 Bacteria 4863
230 Ga0495660_0046355 3300046810 Bacteria 2384
231 Ga0495636_0049480 3300047318 Bacteria 1757
232 Ga0495672_0000468 3300047320 Bacteria 47770
233 Ga0495672_0000489 3300047320 Bacteria 46184
234 Ga0495672_0003962 3300047320 Bacteria 12393
235 Ga0495672_0016123 3300047320 Bacteria 5048
236 Ga0495672_0061413 3300047320 Bacteria 2166
237 Ga0495676_0011804 3300047321 Bacteria 7880
238 Ga0495683_0000031 3300047323 Bacteria 150363
239 Ga0495683_0003536 3300047323 Bacteria 9093
240 Ga0495683_0009617 3300047323 Bacteria 5147
241 Ga0495687_000100 3300047443 Bacteria 130324
242 Ga0495687_022553 3300047443 Bacteria 3020
243 Ga0495687_056224 3300047443 Bacteria 1642
244 Ga0495677_0000371 3300047445 Bacteria 19395
245 Ga0495677_0007418 3300047445 Bacteria 4100
246 Ga0495677_0021294 3300047445 Bacteria 2349
247 Ga0495679_000154 3300047446 Bacteria 61634
248 Ga0495685_002019 3300047447 Bacteria 6304
249 Ga0495673_0000112 3300047469 Bacteria 164434
250 Ga0495673_0000118 3300047469 Bacteria 147670
251 Ga0495673_0000197 3300047469 Bacteria 94703
252 Ga0495673_0000383 3300047469 Bacteria 52691
253 Ga0495673_0001071 3300047469 Bacteria 23989
254 Ga0495673_0005907 3300047469 Bacteria 7308
255 Ga0495673_0010536 3300047469 Bacteria 5018
256 Ga0495673_0020151 3300047469 Bacteria 3325
257 Ga0495673_0109964 3300047469 Bacteria 1103
258 Ga0495681_0011414 3300047470 Bacteria 5291
259 Ga0495681_0019160 3300047470 Bacteria 3744
260 Ga0495681_0023174 3300047470 Bacteria 3303
261 Ga0495686_0130182 3300047472 Bacteria 1492
262 Ga0495686_0135656 3300047472 Bacteria 1455
263 Ga0495626_0000328 3300048091 Bacteria 50162
264 Ga0495626_0000765 3300048091 Bacteria 29625
265 Ga0495626_0040619 3300048091 Bacteria 2196
266 Ga0496100_0004952 3300048903 Bacteria 7120
267 Ga0496101_0000102 3300048904 Bacteria 88779
268 Ga0496102_0000037 3300048905 Bacteria 199368
269 Ga0496102_0164327 3300048905 Bacteria 2088
270 Ga0496102_0646893 3300048905 Bacteria 980
271 Ga0496103_0000004 3300048906 Bacteria 510080
272 Ga0496106_0000946 3300048909 Bacteria 21168
273 Ga0496106_0003736 3300048909 Bacteria 11359
274 Ga0496110_0424037 3300048913 Bacteria 1213
275 Ga0496112_0198914 3300048915 Bacteria 1964
276 Ga0496112_0225128 3300048915 Bacteria 1831
277 Ga0496112_0467258 3300048915 Bacteria 1199
278 Ga0496116_0000276 3300048919 Bacteria 89506
279 Ga0496116_0026862 3300048919 Bacteria 4200
280 Ga0496117_0000003 3300048920 Bacteria 1881097
281 Ga0496118_0000001 3300048921 Bacteria 1881100
282 Ga0496118_0027189 3300048921 Bacteria 4849
283 Ga0496119_0050491 3300048922 Bacteria 2563
284 Ga0496120_0029160 3300048923 Bacteria 3370
285 Ga0496121_0000338 3300048924 Bacteria 97703
286 Ga0496121_0000907 3300048924 Bacteria 53390
287 Ga0496121_0001087 3300048924 Bacteria 48027
288 Ga0496122_0135402 3300048925 Unclassified 1554
289 Ga0496122_0167788 3300048925 Bacteria 1328
290 Ga0496123_0002152 3300048926 Bacteria 25168
291 Ga0496123_0005126 3300048926 Bacteria 13374
292 Ga0496123_0030325 3300048926 Bacteria 3961
293 Ga0496124_0000261 3300048927 Bacteria 101660
294 Ga0496124_0000423 3300048927 Bacteria 75679
295 Ga0496124_0037234 3300048927 Bacteria 4233
296 Ga0496125_0006557 3300048928 Bacteria 12542
297 Ga0496125_0114571 3300048928 Bacteria 1942
298 Ga0496126_0000439 3300048929 Bacteria 82909
299 Ga0496126_0000551 3300048929 Bacteria 72093
300 Ga0496126_0028032 3300048929 Bacteria 5371
301 Ga0496126_0047726 3300048929 Bacteria 3919
302 Ga0495678_000060 3300049459 Bacteria 142851
303 Ga0495678_000119 3300049459 Bacteria 92516
304 Ga0495678_000186 3300049459 Bacteria 72357
305 Ga0495678_057249 3300049459 Bacteria 1478
306 Ga0495682_0000035 3300049460 Bacteria 126349
307 Ga0501034_0339492 3300049571 Bacteria 1432
308 Ga0501227_005390 3300049665 Bacteria 2739
309 Ga0501235_001586 3300049669 Bacteria 4873
310 Ga0501247_009907 3300049677 Bacteria 1130
311 Ga0501245_011095 3300049708 Bacteria 1307
312 nmdc:mga00v17_159341_c1 3300050491 Bacteria 1452
313 nmdc:mga08y16_762192_c1 3300050511 Bacteria 963
314 nmdc:mga0sz30_53939_c1 3300050516 Bacteria 1709
315 Ga0500594_0031665 3300053118 Bacteria 1396
316 Ga0500618_014949 3300053125 Bacteria 1971
317 Ga0500645_009461 3300053730 Bacteria 3272

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047472 Ga0495686_0135656 Ga0495686_0135656_600_1397 256
2 3300048922 Ga0496119_0050491 Ga0496119_0050491_33_833 256
3 3300005327 Ga0070658_10112074 Ga0070658_101120742 267
4 3300009094 Ga0111539_10219299 Ga0111539_102192992 270
5 3300025939 Ga0207665_10210248 Ga0207665_102102482 270
6 3300027907 Ga0207428_10158517 Ga0207428_101585172 270
7 3300046507 Ga0495606_0025815 Ga0495606_0025815_223_1062 270
8 3300047320 Ga0495672_0061413 Ga0495672_0061413_320_1222 275
9 3300047469 Ga0495673_0109964 Ga0495673_0109964_62_964 275
10 3300049677 Ga0501247_009907 Ga0501247_009907_121_1011 278
11 3300009093 Ga0105240_10006560 Ga0105240_100065604 279
12 3300009098 Ga0105245_10043687 Ga0105245_100436873 279
13 3300009101 Ga0105247_10044621 Ga0105247_100446212 279
14 3300009174 Ga0105241_10034020 Ga0105241_100340203 279
15 3300009177 Ga0105248_10021391 Ga0105248_100213916 279
16 3300009551 Ga0105238_10001313 Ga0105238_100013139 279
17 3300010375 Ga0105239_10002247 Ga0105239_1000224714 279
18 3300013296 Ga0157374_10253255 Ga0157374_102532552 279
19 3300013297 Ga0157378_10003911 Ga0157378_100039112 279
20 3300025931 Ga0207644_10060265 Ga0207644_100602654 279
21 3300025941 Ga0207711_10076063 Ga0207711_100760634 279
22 3300005436 Ga0070713_100041536 Ga0070713_1000415365 281
23 iso_pu_bacteria 2857558681 2857558690 283
24 3300003320 rootH2_10009210 rootH2_1000921022 286
25 3300005539 Ga0068853_100002318 Ga0068853_1000023188 286
26 3300005539 Ga0068853_100112712 Ga0068853_1001127122 286
27 3300005563 Ga0068855_100013216 Ga0068855_1000132163 286
28 3300005563 Ga0068855_100095430 Ga0068855_1000954304 286
29 3300005614 Ga0068856_100088229 Ga0068856_1000882292 286
30 3300005616 Ga0068852_100011644 Ga0068852_1000116444 286
31 3300006051 Ga0075364_10187374 Ga0075364_101873742 286
32 3300006178 Ga0075367_10037239 Ga0075367_100372394 286
33 3300006186 Ga0075369_10057009 Ga0075369_100570091 286
34 3300009093 Ga0105240_10010621 Ga0105240_100106214 286
35 3300009553 Ga0105249_10878643 Ga0105249_108786431 286
36 3300010375 Ga0105239_10671454 Ga0105239_106714541 286
37 3300013104 Ga0157370_10001546 Ga0157370_1000154613 286
38 3300013104 Ga0157370_10006567 Ga0157370_1000656711 286
39 3300013105 Ga0157369_10001815 Ga0157369_100018154 286
40 3300013105 Ga0157369_10192692 Ga0157369_101926922 286
41 3300013306 Ga0163162_10068287 Ga0163162_100682872 286
42 3300014325 Ga0163163_10657948 Ga0163163_106579481 286
43 3300025303 Ga0209051_1000466 Ga0209051_100046611 286
44 3300025909 Ga0207705_10006642 Ga0207705_100066427 286
45 3300025913 Ga0207695_10001845 Ga0207695_1000184515 286
46 3300025949 Ga0207667_10003116 Ga0207667_1000311617 286
47 3300025949 Ga0207667_10158457 Ga0207667_101584573 286
48 3300026041 Ga0207639_10226392 Ga0207639_102263923 286
49 3300026078 Ga0207702_10091891 Ga0207702_100918912 286
50 3300026095 Ga0207676_10245044 Ga0207676_102450441 286
51 3300026121 Ga0207683_10448310 Ga0207683_104483102 286
52 3300026142 Ga0207698_10044803 Ga0207698_100448032 286
53 3300037418 Ga0395900_0140040 Ga0395900_0140040_1059_1946 286
54 3300041411 Ga0439466_0001952 Ga0439466_0001952_4548_5444 286
55 3300041411 Ga0439466_0057312 Ga0439466_0057312_146_1030 286
56 3300041413 Ga0439465_0006220 Ga0439465_0006220_1170_2066 286
57 3300041413 Ga0439465_0008389 Ga0439465_0008389_2199_3083 286
58 3300041997 Ga0439431_0019179 Ga0439431_0019179_410_1306 286
59 3300042002 Ga0439442_006681 Ga0439442_006681_778_1674 286
60 3300042004 Ga0439445_0005876 Ga0439445_0005876_1554_2450 286
61 3300042435 Ga0439434_0015039 Ga0439434_0015039_681_1577 286
62 3300045976 Ga0466967_0219083 Ga0466967_0219083_199_1101 286
63 3300046507 Ga0495606_0000088 Ga0495606_0000088_1879_2754 286
64 3300046507 Ga0495606_0000754 Ga0495606_0000754_23445_24314 286
65 3300046507 Ga0495606_0001407 Ga0495606_0001407_30410_31300 286
66 3300046524 Ga0495648_0034798 Ga0495648_0034798_1592_2467 286
67 3300046692 Ga0495671_0043733 Ga0495671_0043733_158_1033 286
68 3300047443 Ga0495687_022553 Ga0495687_022553_1387_2274 286
69 3300048903 Ga0496100_0004952 Ga0496100_0004952_2691_3581 286
70 3300048904 Ga0496101_0000102 Ga0496101_0000102_6549_7439 286
71 3300048905 Ga0496102_0000037 Ga0496102_0000037_81366_82256 286
72 3300048905 Ga0496102_0646893 Ga0496102_0646893_26_910 286
73 3300048906 Ga0496103_0000004 Ga0496103_0000004_392078_392968 286
74 3300048909 Ga0496106_0000946 Ga0496106_0000946_13249_14136 286
75 3300048909 Ga0496106_0003736 Ga0496106_0003736_1974_2864 286
76 3300048915 Ga0496112_0467258 Ga0496112_0467258_41_925 286
77 3300048919 Ga0496116_0000276 Ga0496116_0000276_81340_82230 286
78 3300048920 Ga0496117_0000003 Ga0496117_0000003_1590481_1591371 286
79 3300048921 Ga0496118_0000001 Ga0496118_0000001_1590484_1591374 286
80 3300048923 Ga0496120_0029160 Ga0496120_0029160_750_1640 286
81 3300048924 Ga0496121_0000338 Ga0496121_0000338_90265_91155 286
82 3300048926 Ga0496123_0002152 Ga0496123_0002152_12780_13652 286
83 3300048928 Ga0496125_0114571 Ga0496125_0114571_887_1762 286
84 3300048929 Ga0496126_0000551 Ga0496126_0000551_63908_64798 286
85 3300049571 Ga0501034_0339492 Ga0501034_0339492_41_910 286
86 3300050491 nmdc:mga00v17_159341_c1 nmdc:mga00v17_159341_c1_432_1316 286
87 3300050511 nmdc:mga08y16_762192_c1 nmdc:mga08y16_762192_c1_44_931 286
88 3300053118 Ga0500594_0031665 Ga0500594_0031665_336_1211 286
89 3300053730 Ga0500645_009461 Ga0500645_009461_1310_2188 286
90 iso_pu_bacteria 2643221565 2643844865 286
91 iso_pu_bacteria 2643221664 2644355850 286
92 iso_pu_bacteria 2738541280 2738740652 286
93 iso_pu_bacteria 2738541300 2738844973 286
94 iso_pu_bacteria 2738543018 2739277388 286
95 iso_pu_bacteria 2738543030 2739346431 286
96 iso_pu_bacteria 2878029506 2878030490 286
97 iso_pu_bacteria 2931396565 2931399182 286
98 iso_pu_bacteria 3007861166 3007862752 286
99 3300045049 Ga0466959_0116091 Ga0466959_0116091_587_1462 287
100 3300050516 nmdc:mga0sz30_53939_c1 nmdc:mga0sz30_53939_c1_619_1530 287
101 iso_pu_bacteria 8055266321 8055272313 287
102 3300005339 Ga0070660_100052210 Ga0070660_1000522102 288
103 3300005355 Ga0070671_100010479 Ga0070671_1000104796 288
104 3300006237 Ga0097621_100274559 Ga0097621_1002745592 288
105 3300009545 Ga0105237_10096594 Ga0105237_100965942 288
106 3300014969 Ga0157376_10169087 Ga0157376_101690872 288
107 3300025900 Ga0207710_10062085 Ga0207710_100620851 288
108 3300025913 Ga0207695_10003177 Ga0207695_1000317712 288
109 3300025924 Ga0207694_10001321 Ga0207694_1000132116 288
110 3300025935 Ga0207709_10041938 Ga0207709_100419382 288
111 3300048929 Ga0496126_0000439 Ga0496126_0000439_24573_25439 288
112 3300003323 rootH1_10219652 rootH1_102196521 289
113 3300005288 Ga0065714_10015673 Ga0065714_100156732 289
114 3300005353 Ga0070669_100018354 Ga0070669_1000183544 289
115 3300005436 Ga0070713_100225615 Ga0070713_1002256151 289
116 3300005445 Ga0070708_100373793 Ga0070708_1003737931 289
117 3300005471 Ga0070698_100271649 Ga0070698_1002716491 289
118 3300009011 Ga0105251_10000884 Ga0105251_1000088422 289
119 3300009148 Ga0105243_10048987 Ga0105243_100489872 289
120 3300009545 Ga0105237_10000184 Ga0105237_100001847 289
121 3300009545 Ga0105237_10091654 Ga0105237_100916542 289
122 3300009551 Ga0105238_10007866 Ga0105238_100078665 289
123 3300013102 Ga0157371_10000992 Ga0157371_1000099215 289
124 3300013104 Ga0157370_10003553 Ga0157370_1000355318 289
125 3300013308 Ga0157375_10024566 Ga0157375_100245665 289
126 3300014497 Ga0182008_10018821 Ga0182008_100188213 289
127 3300014497 Ga0182008_10024179 Ga0182008_100241793 289
128 3300014497 Ga0182008_10045853 Ga0182008_100458532 289
129 3300014497 Ga0182008_10111498 Ga0182008_101114982 289
130 3300015261 Ga0182006_1014417 Ga0182006_10144173 289
131 3300015262 Ga0182007_10004009 Ga0182007_100040093 289
132 3300015262 Ga0182007_10004400 Ga0182007_100044008 289
133 3300015262 Ga0182007_10027900 Ga0182007_100279002 289
134 3300015262 Ga0182007_10041862 Ga0182007_100418622 289
135 3300015265 Ga0182005_1009293 Ga0182005_10092933 289
136 3300015265 Ga0182005_1014909 Ga0182005_10149092 289
137 3300015265 Ga0182005_1014920 Ga0182005_10149202 289
138 3300015265 Ga0182005_1021838 Ga0182005_10218381 289
139 3300017792 Ga0163161_10002296 Ga0163161_1000229610 289
140 3300017792 Ga0163161_10018159 Ga0163161_100181593 289
141 3300021388 Ga0213875_10034958 Ga0213875_100349584 289
142 3300025735 Ga0207713_1000705 Ga0207713_100070522 289
143 3300025914 Ga0207671_10000190 Ga0207671_100001908 289
144 3300025923 Ga0207681_10000385 Ga0207681_100003852 289
145 3300031548 Ga0307408_100271768 Ga0307408_1002717681 289
146 3300031731 Ga0307405_10151481 Ga0307405_101514811 289
147 3300031903 Ga0307407_10062412 Ga0307407_100624122 289
148 3300031911 Ga0307412_10002580 Ga0307412_1000258010 289
149 3300031911 Ga0307412_10037057 Ga0307412_100370571 289
150 3300032002 Ga0307416_100077902 Ga0307416_1000779022 289
151 3300037853 Ga0436364_0072478 Ga0436364_0072478_1819_2703 289
152 3300041405 Ga0439438_006513 Ga0439438_006513_790_1713 289
153 3300041407 Ga0439447_001705 Ga0439447_001705_2396_3319 289
154 3300041407 Ga0439447_033520 Ga0439447_033520_379_1260 289
155 3300041411 Ga0439466_0000144 Ga0439466_0000144_25034_25957 289
156 3300041411 Ga0439466_0015239 Ga0439466_0015239_1052_1966 289
157 3300042009 Ga0439451_004336 Ga0439451_004336_518_1441 289
158 3300042010 Ga0439452_001012 Ga0439452_001012_11130_12011 289
159 3300042010 Ga0439452_007480 Ga0439452_007480_2396_3319 289
160 3300042013 Ga0439456_036094 Ga0439456_036094_129_1010 289
161 3300042016 Ga0439463_019208 Ga0439463_019208_589_1470 289
162 3300042115 Ga0450911_000009 Ga0450911_000009_44767_45690 289
163 3300042142 Ga0450905_000011 Ga0450905_000011_18248_19129 289
164 3300046452 Ga0495617_000643 Ga0495617_000643_15845_16768 289
165 3300046452 Ga0495617_066537 Ga0495617_066537_121_999 289
166 3300046453 Ga0495627_019920 Ga0495627_019920_932_1813 289
167 3300046455 Ga0495603_0013296 Ga0495603_0013296_3413_4318 289
168 3300046457 Ga0495590_0013948 Ga0495590_0013948_1207_2085 289
169 3300046457 Ga0495590_0086258 Ga0495590_0086258_190_1071 289
170 3300046458 Ga0495591_006547 Ga0495591_006547_2544_3425 289
171 3300046458 Ga0495591_007970 Ga0495591_007970_1282_2163 289
172 3300046458 Ga0495591_019409 Ga0495591_019409_1341_2222 289
173 3300046459 Ga0495629_0288999 Ga0495629_0288999_119_1024 289
174 3300046460 Ga0495638_0012338 Ga0495638_0012338_1698_2576 289
175 3300046460 Ga0495638_0034484 Ga0495638_0034484_1770_2684 289
176 3300046460 Ga0495638_0146670 Ga0495638_0146670_85_990 289
177 3300046471 Ga0495650_0000896 Ga0495650_0000896_11480_12361 289
178 3300046471 Ga0495650_0004671 Ga0495650_0004671_116_997 289
179 3300046474 Ga0495605_0000011 Ga0495605_0000011_127228_128109 289
180 3300046474 Ga0495605_0000148 Ga0495605_0000148_68840_69718 289
181 3300046474 Ga0495605_0003905 Ga0495605_0003905_3981_4862 289
182 3300046474 Ga0495605_0025475 Ga0495605_0025475_1221_2102 289
183 3300046491 Ga0495584_0001137 Ga0495584_0001137_4698_5579 289
184 3300046491 Ga0495584_0019748 Ga0495584_0019748_2240_3163 289
185 3300046499 Ga0495594_0003210 Ga0495594_0003210_5702_6583 289
186 3300046499 Ga0495594_0017721 Ga0495594_0017721_775_1680 289
187 3300046501 Ga0495607_0000313 Ga0495607_0000313_1782_2660 289
188 3300046501 Ga0495607_0001991 Ga0495607_0001991_16269_17150 289
189 3300046501 Ga0495607_0002696 Ga0495607_0002696_8709_9590 289
190 3300046501 Ga0495607_0003894 Ga0495607_0003894_6110_6988 289
191 3300046501 Ga0495607_0005644 Ga0495607_0005644_4612_5490 289
192 3300046501 Ga0495607_0012335 Ga0495607_0012335_170_1051 289
193 3300046506 Ga0495583_0000047 Ga0495583_0000047_186311_187192 289
194 3300046506 Ga0495583_0003911 Ga0495583_0003911_8024_8902 289
195 3300046506 Ga0495583_0004769 Ga0495583_0004769_494_1375 289
196 3300046506 Ga0495583_0017298 Ga0495583_0017298_1508_2386 289
197 3300046507 Ga0495606_0002882 Ga0495606_0002882_11135_12016 289
198 3300046507 Ga0495606_0006579 Ga0495606_0006579_6263_7144 289
199 3300046507 Ga0495606_0023965 Ga0495606_0023965_977_1882 289
200 3300046507 Ga0495606_0131480 Ga0495606_0131480_59_937 289
201 3300046512 Ga0495610_0004195 Ga0495610_0004195_406_1329 289
202 3300046512 Ga0495610_0014667 Ga0495610_0014667_205_1086 289
203 3300046513 Ga0495616_0000150 Ga0495616_0000150_15905_16783 289
204 3300046513 Ga0495616_0040795 Ga0495616_0040795_38_916 289
205 3300046515 Ga0495620_0000225 Ga0495620_0000225_29580_30461 289
206 3300046515 Ga0495620_0000540 Ga0495620_0000540_148_1029 289
207 3300046515 Ga0495620_0000592 Ga0495620_0000592_6374_7252 289
208 3300046518 Ga0495631_0000150 Ga0495631_0000150_31696_32577 289
209 3300046518 Ga0495631_0000337 Ga0495631_0000337_20027_20905 289
210 3300046518 Ga0495631_0002627 Ga0495631_0002627_6384_7265 289
211 3300046518 Ga0495631_0012068 Ga0495631_0012068_13_894 289
212 3300046518 Ga0495631_0051903 Ga0495631_0051903_803_1681 289
213 3300046519 Ga0495632_0000467 Ga0495632_0000467_25900_26778 289
214 3300046519 Ga0495632_0001763 Ga0495632_0001763_10865_11746 289
215 3300046519 Ga0495632_0005659 Ga0495632_0005659_802_1683 289
216 3300046519 Ga0495632_0072107 Ga0495632_0072107_142_1020 289
217 3300046520 Ga0495637_0016593 Ga0495637_0016593_2043_2924 289
218 3300046520 Ga0495637_0058660 Ga0495637_0058660_428_1309 289
219 3300046522 Ga0495643_0000134 Ga0495643_0000134_96107_96985 289
220 3300046522 Ga0495643_0005508 Ga0495643_0005508_4606_5487 289
221 3300046522 Ga0495643_0028287 Ga0495643_0028287_1141_2025 289
222 3300046522 Ga0495643_0098608 Ga0495643_0098608_520_1443 289
223 3300046524 Ga0495648_0000085 Ga0495648_0000085_88471_89352 289
224 3300046524 Ga0495648_0012473 Ga0495648_0012473_955_1836 289
225 3300046528 Ga0495642_0000225 Ga0495642_0000225_19490_20368 289
226 3300046530 Ga0495654_0000866 Ga0495654_0000866_17424_18305 289
227 3300046530 Ga0495654_0037880 Ga0495654_0037880_63_944 289
228 3300046538 Ga0495609_0000004 Ga0495609_0000004_514468_515349 289
229 3300046538 Ga0495609_0008497 Ga0495609_0008497_2345_3223 289
230 3300046542 Ga0495597_0004471 Ga0495597_0004471_5735_6616 289
231 3300046542 Ga0495597_0019192 Ga0495597_0019192_1673_2578 289
232 3300046542 Ga0495597_0094132 Ga0495597_0094132_378_1256 289
233 3300046558 Ga0495633_0000206 Ga0495633_0000206_29717_30598 289
234 3300046615 Ga0495656_0110275 Ga0495656_0110275_392_1270 289
235 3300046616 Ga0495668_0024992 Ga0495668_0024992_314_1192 289
236 3300046648 Ga0495611_0001735 Ga0495611_0001735_7304_8185 289
237 3300046648 Ga0495611_0001867 Ga0495611_0001867_5356_6237 289
238 3300046648 Ga0495611_0002187 Ga0495611_0002187_6868_7746 289
239 3300046660 Ga0495625_0004633 Ga0495625_0004633_834_1739 289
240 3300046660 Ga0495625_0081954 Ga0495625_0081954_46_924 289
241 3300046664 Ga0495659_0002528 Ga0495659_0002528_1509_2387 289
242 3300046665 Ga0495661_0000005 Ga0495661_0000005_193149_194030 289
243 3300046665 Ga0495661_0001046 Ga0495661_0001046_1414_2292 289
244 3300046665 Ga0495661_0002327 Ga0495661_0002327_8135_9016 289
245 3300046665 Ga0495661_0124216 Ga0495661_0124216_341_1264 289
246 3300046692 Ga0495671_0000089 Ga0495671_0000089_12711_13616 289
247 3300046692 Ga0495671_0001779 Ga0495671_0001779_5592_6473 289
248 3300046692 Ga0495671_0007600 Ga0495671_0007600_2683_3564 289
249 3300046692 Ga0495671_0055928 Ga0495671_0055928_18_971 289
250 3300046694 Ga0495649_0009463 Ga0495649_0009463_4743_5621 289
251 3300046694 Ga0495649_0061952 Ga0495649_0061952_631_1509 289
252 3300046694 Ga0495649_0077496 Ga0495649_0077496_375_1253 289
253 3300046794 Ga0495589_0000046 Ga0495589_0000046_38921_39799 289
254 3300046794 Ga0495589_0000470 Ga0495589_0000470_5491_6372 289
255 3300046794 Ga0495589_0006076 Ga0495589_0006076_5014_5892 289
256 3300046810 Ga0495660_0000040 Ga0495660_0000040_39400_40278 289
257 3300046810 Ga0495660_0012815 Ga0495660_0012815_3394_4275 289
258 3300046810 Ga0495660_0046355 Ga0495660_0046355_1405_2310 289
259 3300047318 Ga0495636_0049480 Ga0495636_0049480_172_1050 289
260 3300047320 Ga0495672_0000468 Ga0495672_0000468_18269_19147 289
261 3300047320 Ga0495672_0000489 Ga0495672_0000489_25816_26721 289
262 3300047320 Ga0495672_0003962 Ga0495672_0003962_1922_2800 289
263 3300047320 Ga0495672_0016123 Ga0495672_0016123_1213_2094 289
264 3300047321 Ga0495676_0011804 Ga0495676_0011804_1836_2741 289
265 3300047323 Ga0495683_0000031 Ga0495683_0000031_105460_106341 289
266 3300047323 Ga0495683_0003536 Ga0495683_0003536_1138_2016 289
267 3300047323 Ga0495683_0009617 Ga0495683_0009617_469_1347 289
268 3300047443 Ga0495687_000100 Ga0495687_000100_97985_98863 289
269 3300047443 Ga0495687_056224 Ga0495687_056224_65_943 289
270 3300047445 Ga0495677_0000371 Ga0495677_0000371_13549_14427 289
271 3300047445 Ga0495677_0007418 Ga0495677_0007418_1160_2038 289
272 3300047445 Ga0495677_0021294 Ga0495677_0021294_25_903 289
273 3300047446 Ga0495679_000154 Ga0495679_000154_22908_23789 289
274 3300047447 Ga0495685_002019 Ga0495685_002019_504_1382 289
275 3300047469 Ga0495673_0000112 Ga0495673_0000112_26257_27138 289
276 3300047469 Ga0495673_0000118 Ga0495673_0000118_143441_144322 289
277 3300047469 Ga0495673_0000197 Ga0495673_0000197_40031_40912 289
278 3300047469 Ga0495673_0000383 Ga0495673_0000383_14753_15634 289
279 3300047469 Ga0495673_0001071 Ga0495673_0001071_19902_20783 289
280 3300047469 Ga0495673_0010536 Ga0495673_0010536_61_939 289
281 3300047470 Ga0495681_0011414 Ga0495681_0011414_3131_4012 289
282 3300047470 Ga0495681_0019160 Ga0495681_0019160_251_1129 289
283 3300047470 Ga0495681_0023174 Ga0495681_0023174_1066_1944 289
284 3300047472 Ga0495686_0130182 Ga0495686_0130182_109_990 289
285 3300048091 Ga0495626_0000328 Ga0495626_0000328_43897_44775 289
286 3300048091 Ga0495626_0000765 Ga0495626_0000765_24623_25501 289
287 3300048091 Ga0495626_0040619 Ga0495626_0040619_169_1047 289
288 3300048915 Ga0496112_0225128 Ga0496112_0225128_376_1254 289
289 3300048924 Ga0496121_0001087 Ga0496121_0001087_220_1098 289
290 3300048925 Ga0496122_0135402 Ga0496122_0135402_62_943 289
291 3300048925 Ga0496122_0167788 Ga0496122_0167788_218_1096 289
292 3300048926 Ga0496123_0005126 Ga0496123_0005126_1598_2476 289
293 3300048927 Ga0496124_0000423 Ga0496124_0000423_70918_71796 289
294 3300048928 Ga0496125_0006557 Ga0496125_0006557_6559_7440 289
295 3300048929 Ga0496126_0028032 Ga0496126_0028032_2218_3093 289
296 3300049459 Ga0495678_000060 Ga0495678_000060_96513_97391 289
297 3300049459 Ga0495678_000119 Ga0495678_000119_6178_7059 289
298 3300049459 Ga0495678_000186 Ga0495678_000186_48432_49313 289
299 3300049459 Ga0495678_057249 Ga0495678_057249_248_1126 289
300 3300049460 Ga0495682_0000035 Ga0495682_0000035_80398_81276 289
301 3300049665 Ga0501227_005390 Ga0501227_005390_660_1541 289
302 3300049669 Ga0501235_001586 Ga0501235_001586_3388_4311 289
303 3300049708 Ga0501245_011095 Ga0501245_011095_190_1113 289
304 3300053125 Ga0500618_014949 Ga0500618_014949_160_1041 289
305 3300009093 Ga0105240_10000105 Ga0105240_10000105128 290
306 3300025913 Ga0207695_10000193 Ga0207695_1000019310 290
307 3300046458 Ga0495591_000739 Ga0495591_000739_13768_14664 290
308 3300046474 Ga0495605_0000128 Ga0495605_0000128_62871_63794 290
309 3300046501 Ga0495607_0129913 Ga0495607_0129913_104_1087 290
310 3300046507 Ga0495606_0117567 Ga0495606_0117567_454_1401 290
311 3300046515 Ga0495620_0000086 Ga0495620_0000086_31668_32615 290
312 3300046665 Ga0495661_0002090 Ga0495661_0002090_2356_3279 290
313 3300046678 Ga0495599_0021242 Ga0495599_0021242_2544_3425 290
314 3300047469 Ga0495673_0005907 Ga0495673_0005907_2414_3397 290
315 3300047469 Ga0495673_0020151 Ga0495673_0020151_2070_3017 290
316 3300048905 Ga0496102_0164327 Ga0496102_0164327_938_1849 290
317 3300048913 Ga0496110_0424037 Ga0496110_0424037_44_940 290
318 3300048915 Ga0496112_0198914 Ga0496112_0198914_908_1804 290
319 3300048919 Ga0496116_0026862 Ga0496116_0026862_2721_3617 290
320 3300048921 Ga0496118_0027189 Ga0496118_0027189_148_1044 290
321 3300048924 Ga0496121_0000907 Ga0496121_0000907_24624_25520 290
322 3300048926 Ga0496123_0030325 Ga0496123_0030325_2615_3511 290
323 3300048927 Ga0496124_0000261 Ga0496124_0000261_26973_27869 290
324 3300048927 Ga0496124_0037234 Ga0496124_0037234_2949_3845 290
325 3300003316 rootH1_10145178 rootH1_101451782 291
326 3300003320 rootH2_10070197 rootH2_1007019710 291
327 3300009174 Ga0105241_10354061 Ga0105241_103540612 291
328 3300048929 Ga0496126_0047726 Ga0496126_0047726_1712_2587 291

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

36

148

0.87

PF05368

NmrA

NmrA-like family

36

258

0.85

PF13460

NAD_binding_10

NAD(P)H-binding

40

221

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
1i8t-assembly1.cif.gz_B structure of udp-galactopyranose mutase from e.coli 0.9059 3 35
3e48-assembly1.cif.gz_A crystal structure of a nucleoside-diphosphate-sugar epimerase (sav0421) from staphylococcus aureus, northeast structural genomics consortium target zr319 0.899 4 284
3e48-assembly1.cif.gz_A crystal structure of a nucleoside-diphosphate-sugar epimerase (sav0421) from staphylococcus aureus, northeast structural genomics consortium target zr319 0.8899 4 284
2zcv-assembly1.cif.gz_A crystal structure of nadph-dependent quinone oxidoreductase qor2 complexed with nadph from escherichia coli 0.8879 5 285
2zcu-assembly1.cif.gz_A crystal structure of a new type of nadph-dependent quinone oxidoreductase (qor2) from escherichia coli 0.8774 5 285
ID Description Score Start End Superfamily
af_P9WNY9_4_366_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9252 3 32 3.50.50.60
5xgvB01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.925 3 35 3.50.50.60
af_Q54LX4_3_401_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9195 3 34 3.50.50.60
3zdnC01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.915 3 35 3.50.50.60
af_A0A1D6IP12_4_87_3.40.50.20 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9097 4 71 3.40.50.20
ID Description Score Start End GO Terms
AF-A0A6I1Z0D5-F1-model_v4 NAD(P)H azoreductase (EC 1.7.-.-) 0.9765 1 291 GO:0016491
AF-A0A6I1Z0D5-F1-model_v4 NAD(P)H azoreductase (EC 1.7.-.-) 0.9732 1 291 GO:0016491
AF-D7C9H2-F1-model_v4 NmrA family protein 0.9707 1 290
AF-A0A2A4Y6L1-F1-model_v4 NmrA family transcriptional regulator 0.9697 1 291
AF-A0A090T8P3-F1-model_v4 NAD(P)-binding domain-containing protein 0.9672 69 291

Feature Viewer

pLDDT pTM Quality
95.67 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map