F409192

General Info

Members Datasets Scaffolds Average Seq Length
328 183 656 114

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100032967|Ga0075428_1000329673
Length 117
Sequence VTKTPARKKKPTATRRQRAKYLLRLYVTGTTGRSVRAIQNVRRICEEHLKGLYDLEVVDIYKNLPLARGDQIIAAPTLIKRLPVPLRRLIGDMSDEKRVLVGLDIRPQRAGRIDGQA

Samples

Sample ID Description Type Environment
1 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
2 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
145 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
146 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
147 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
148 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
149 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
150 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
151 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
152 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
153 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
154 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
155 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
156 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
157 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
158 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
159 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
160 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
161 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
162 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
163 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
164 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
165 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
166 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
167 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
168 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
169 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
170 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
171 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
172 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
173 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
174 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
175 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
176 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
177 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
178 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
179 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
180 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
181 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
182 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
183 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.61
Nodule 0
Rhizoplane 4.88
Rhizosphere 93.6
Stem 0
Stem Tuber 0
Unclassified 28.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075428_100032967 3300006844 Bacteria 5719
2 JGI24748J21848_1052951 3300002074 Unclassified 532
3 JGI25406J46586_10005413 3300003203 Bacteria 5921
4 Ga0065715_10009740 3300005293 Bacteria 2539
5 Ga0065715_10094021 3300005293 Bacteria 4469
6 Ga0065715_10906372 3300005293 Unclassified 573
7 Ga0070676_10007824 3300005328 Bacteria 5746
8 Ga0070676_10024292 3300005328 Bacteria 3413
9 Ga0070683_100910510 3300005329 Bacteria 844
10 Ga0070690_100230337 3300005330 Bacteria 1302
11 Ga0070690_100326787 3300005330 Bacteria 1107
12 Ga0070690_100938323 3300005330 Unclassified 679
13 Ga0070677_10068482 3300005333 Bacteria 1486
14 Ga0070666_10046823 3300005335 Bacteria 2902
15 Ga0070666_10410672 3300005335 Bacteria 974
16 Ga0070666_10440325 3300005335 Unclassified 940
17 Ga0070666_10533187 3300005335 Bacteria 853
18 Ga0070680_101519985 3300005336 Unclassified 580
19 Ga0070682_100177519 3300005337 Bacteria 1485
20 Ga0068868_100023562 3300005338 Bacteria 4660
21 Ga0070689_100265605 3300005340 Bacteria 1419
22 Ga0070691_10005854 3300005341 Bacteria 5609
23 Ga0070691_10194282 3300005341 Bacteria 1063
24 Ga0070687_100145347 3300005343 Bacteria 1386
25 Ga0070661_100324646 3300005344 Unclassified 1203
26 Ga0070661_101913709 3300005344 Unclassified 504
27 Ga0070692_10216608 3300005345 Unclassified 1130
28 Ga0070692_10667164 3300005345 Unclassified 696
29 Ga0070669_100012235 3300005353 Bacteria 6091
30 Ga0070669_100020835 3300005353 Bacteria 4683
31 Ga0070675_100958311 3300005354 Unclassified 785
32 Ga0070675_101054361 3300005354 Unclassified 747
33 Ga0070675_102068446 3300005354 Unclassified 525
34 Ga0070671_100362852 3300005355 Bacteria 1237
35 Ga0070674_100031802 3300005356 Bacteria 3500
36 Ga0070674_100185681 3300005356 Bacteria 1596
37 Ga0070674_100514345 3300005356 Unclassified 999
38 Ga0070673_100024795 3300005364 Bacteria 4403
39 Ga0070673_100097611 3300005364 Bacteria 2413
40 Ga0070673_101338945 3300005364 Unclassified 673
41 Ga0070688_100103860 3300005365 Bacteria 1878
42 Ga0070688_100760560 3300005365 Unclassified 755
43 Ga0070659_100472087 3300005366 Unclassified 1066
44 Ga0070667_100526584 3300005367 Bacteria 1085
45 Ga0070703_10235126 3300005406 Unclassified 736
46 Ga0070701_10009813 3300005438 Bacteria 4209
47 Ga0070701_10030762 3300005438 Bacteria 2658
48 Ga0070705_100062370 3300005440 Bacteria 2219
49 Ga0070705_100196042 3300005440 Unclassified 1381
50 Ga0070700_100004041 3300005441 Bacteria 7635
51 Ga0070700_100298797 3300005441 Unclassified 1174
52 Ga0070700_101062580 3300005441 Bacteria 669
53 Ga0070700_101850591 3300005441 Bacteria 521
54 Ga0070694_100003083 3300005444 Bacteria 9929
55 Ga0070694_101463987 3300005444 Unclassified 577
56 Ga0070708_100474035 3300005445 Bacteria 1181
57 Ga0070663_100979161 3300005455 Bacteria 734
58 Ga0070678_100004427 3300005456 Bacteria 7968
59 Ga0070678_100137934 3300005456 Bacteria 1948
60 Ga0070678_100558444 3300005456 Bacteria 1017
61 Ga0068867_100030715 3300005459 Bacteria 3876
62 Ga0068867_100038834 3300005459 Bacteria 3468
63 Ga0068867_100496219 3300005459 Unclassified 1048
64 Ga0068867_101889043 3300005459 Unclassified 563
65 Ga0070698_100497249 3300005471 Bacteria 1157
66 Ga0070679_100270979 3300005530 Bacteria 1652
67 Ga0070684_100471665 3300005535 Bacteria 1161
68 Ga0068853_100778633 3300005539 Unclassified 915
69 Ga0070672_100040436 3300005543 Bacteria 3577
70 Ga0070672_100105987 3300005543 Bacteria 2286
71 Ga0070672_101465238 3300005543 Unclassified 611
72 Ga0070695_100013400 3300005545 Bacteria 4926
73 Ga0070695_100096015 3300005545 Bacteria 1988
74 Ga0070696_100014092 3300005546 Bacteria 5367
75 Ga0070693_100063529 3300005547 Bacteria 2152
76 Ga0070693_100068397 3300005547 Bacteria 2084
77 Ga0070693_100677013 3300005547 Bacteria 753
78 Ga0070665_100014194 3300005548 Bacteria 8004
79 Ga0070665_100420297 3300005548 Unclassified 1345
80 Ga0070704_100017123 3300005549 Bacteria 4599
81 Ga0070704_100051553 3300005549 Bacteria 2899
82 Ga0070664_100040022 3300005564 Bacteria 3952
83 Ga0068854_100066621 3300005578 Bacteria 2621
84 Ga0068854_100400651 3300005578 Bacteria 1135
85 Ga0070702_100000824 3300005615 Bacteria 11901
86 Ga0070702_100082972 3300005615 Bacteria 1924
87 Ga0068852_100512949 3300005616 Unclassified 1195
88 Ga0068859_100142052 3300005617 Bacteria 2474
89 Ga0068859_100442442 3300005617 Bacteria 1396
90 Ga0068866_10022155 3300005718 Bacteria 2937
91 Ga0068866_10104172 3300005718 Bacteria 1571
92 Ga0068861_100019787 3300005719 Bacteria 4811
93 Ga0068861_100130894 3300005719 Bacteria 2036
94 Ga0068851_10208635 3300005834 Unclassified 1093
95 Ga0068863_100046714 3300005841 Bacteria 4110
96 Ga0068858_100027402 3300005842 Bacteria 5294
97 Ga0068858_100120385 3300005842 Bacteria 2454
98 Ga0068858_100729319 3300005842 Unclassified 965
99 Ga0068860_100184278 3300005843 Bacteria 2018
100 Ga0068860_100258728 3300005843 Bacteria 1696
101 Ga0068860_100410469 3300005843 Bacteria 1341
102 Ga0068860_100540179 3300005843 Bacteria 1167
103 Ga0068862_100521314 3300005844 Unclassified 1131
104 Ga0068862_100585906 3300005844 Unclassified 1069
105 Ga0081539_10000237 3300005985 Bacteria 129370
106 Ga0070717_10027968 3300006028 Bacteria 4509
107 Ga0070717_10085137 3300006028 Bacteria 2660
108 Ga0070717_11311946 3300006028 Unclassified 658
109 Ga0075364_10063419 3300006051 Bacteria 2426
110 Ga0070716_100116473 3300006173 Unclassified 1665
111 Ga0097621_100248814 3300006237 Bacteria 1556
112 Ga0097621_101251203 3300006237 Bacteria 700
113 Ga0068871_102336274 3300006358 Unclassified 510
114 Ga0075428_100013456 3300006844 Bacteria 9105
115 Ga0075430_100004576 3300006846 Bacteria 11641
116 Ga0075430_100083520 3300006846 Bacteria 2675
117 Ga0075430_100281067 3300006846 Bacteria 1377
118 Ga0075431_100005241 3300006847 Bacteria 12763
119 Ga0075431_100025090 3300006847 Bacteria 6112
120 Ga0075433_11502436 3300006852 Bacteria 582
121 Ga0075434_100761549 3300006871 Bacteria 985
122 Ga0075429_100038707 3300006880 Unclassified 4152
123 Ga0075429_100081433 3300006880 Bacteria 2822
124 Ga0068865_100038826 3300006881 Bacteria 3225
125 Ga0068865_100308086 3300006881 Unclassified 1270
126 Ga0097620_100142049 3300006931 Bacteria 2474
127 Ga0097620_100442419 3300006931 Bacteria 1396
128 Ga0075435_100058430 3300007076 Bacteria 3124
129 Ga0075435_100323892 3300007076 Bacteria 1319
130 Ga0105240_10715489 3300009093 Bacteria 1092
131 Ga0105240_11007718 3300009093 Unclassified 890
132 Ga0105245_10041631 3300009098 Bacteria 4095
133 Ga0105245_10060430 3300009098 Bacteria 3413
134 Ga0105247_10128587 3300009101 Bacteria 1649
135 Ga0105247_10627664 3300009101 Unclassified 800
136 Ga0114129_10145639 3300009147 Unclassified 3245
137 Ga0114129_10177285 3300009147 Bacteria 2903
138 Ga0105243_10020711 3300009148 Bacteria 4989
139 Ga0105243_10042170 3300009148 Bacteria 3571
140 Ga0105241_10070230 3300009174 Bacteria 2717
141 Ga0105241_10294066 3300009174 Bacteria 1392
142 Ga0105241_10320504 3300009174 Bacteria 1336
143 Ga0105242_10004234 3300009176 Bacteria 11187
144 Ga0105242_10019893 3300009176 Bacteria 5259
145 Ga0105242_10223967 3300009176 Bacteria 1682
146 Ga0105242_12062680 3300009176 Bacteria 613
147 Ga0105248_10019432 3300009177 Bacteria 7518
148 Ga0105248_10244441 3300009177 Bacteria 2020
149 Ga0105248_10342021 3300009177 Bacteria 1684
150 Ga0105248_11467701 3300009177 Unclassified 772
151 Ga0105248_11598850 3300009177 Bacteria 738
152 Ga0105248_12538448 3300009177 Unclassified 584
153 Ga0105238_12801616 3300009551 Bacteria 524
154 Ga0105249_10352646 3300009553 Bacteria 1491
155 Ga0105249_11073920 3300009553 Unclassified 875
156 Ga0105249_11802031 3300009553 Unclassified 685
157 Ga0105239_10128132 3300010375 Bacteria 2822
158 Ga0105239_12709747 3300010375 Unclassified 578
159 Ga0105246_10801547 3300011119 Unclassified 836
160 Ga0157374_10011634 3300013296 Bacteria 7627
161 Ga0157378_11145486 3300013297 Unclassified 816
162 Ga0157378_11567156 3300013297 Bacteria 704
163 Ga0163162_10177363 3300013306 Bacteria 2256
164 Ga0163162_10513725 3300013306 Bacteria 1328
165 Ga0163162_10825503 3300013306 Bacteria 1043
166 Ga0163162_11614208 3300013306 Unclassified 740
167 Ga0157375_11381236 3300013308 Unclassified 829
168 Ga0163163_10217327 3300014325 Bacteria 1960
169 Ga0157377_10452158 3300014745 Unclassified 887
170 Ga0157379_10004339 3300014968 Bacteria 12132
171 Ga0157379_10160405 3300014968 Bacteria 2030
172 Ga0157379_11980174 3300014968 Unclassified 575
173 Ga0157376_10169326 3300014969 Bacteria 1987
174 Ga0157376_10367030 3300014969 Bacteria 1382
175 Ga0207697_10001011 3300025315 Bacteria 15737
176 Ga0207697_10040232 3300025315 Bacteria 1920
177 Ga0207656_10101816 3300025321 Bacteria 1317
178 Ga0207682_10007229 3300025893 Bacteria 4438
179 Ga0207642_10071929 3300025899 Bacteria 1649
180 Ga0207642_10086937 3300025899 Bacteria 1534
181 Ga0207710_10358132 3300025900 Unclassified 744
182 Ga0207688_10006673 3300025901 Bacteria 6279
183 Ga0207688_10627243 3300025901 Unclassified 678
184 Ga0207688_11037430 3300025901 Bacteria 518
185 Ga0207680_10020776 3300025903 Bacteria 3543
186 Ga0207680_10095373 3300025903 Bacteria 1901
187 Ga0207680_10484161 3300025903 Unclassified 880
188 Ga0207647_10213404 3300025904 Unclassified 1114
189 Ga0207699_10043258 3300025906 Bacteria 2615
190 Ga0207645_10012773 3300025907 Bacteria 5691
191 Ga0207645_10016652 3300025907 Bacteria 4863
192 Ga0207654_10190689 3300025911 Bacteria 1343
193 Ga0207695_10421799 3300025913 Bacteria 1218
194 Ga0207695_10506346 3300025913 Bacteria 1089
195 Ga0207660_10670720 3300025917 Bacteria 845
196 Ga0207660_11570657 3300025917 Unclassified 531
197 Ga0207662_10015810 3300025918 Bacteria 4251
198 Ga0207649_10348677 3300025920 Unclassified 1095
199 Ga0207649_11332820 3300025920 Unclassified 568
200 Ga0207652_10685989 3300025921 Unclassified 915
201 Ga0207681_10011535 3300025923 Bacteria 5430
202 Ga0207681_10088346 3300025923 Bacteria 2207
203 Ga0207681_10537541 3300025923 Bacteria 961
204 Ga0207694_10830658 3300025924 Unclassified 781
205 Ga0207694_11873821 3300025924 Unclassified 503
206 Ga0207650_10290205 3300025925 Bacteria 1334
207 Ga0207650_10302237 3300025925 Unclassified 1307
208 Ga0207650_11686261 3300025925 Unclassified 537
209 Ga0207659_10456805 3300025926 Bacteria 1076
210 Ga0207659_11387321 3300025926 Bacteria 602
211 Ga0207687_10152473 3300025927 Bacteria 1765
212 Ga0207687_10189967 3300025927 Bacteria 1598
213 Ga0207700_10037579 3300025928 Bacteria 3508
214 Ga0207644_10309907 3300025931 Bacteria 1274
215 Ga0207690_10107500 3300025932 Bacteria 2004
216 Ga0207706_10231877 3300025933 Bacteria 1615
217 Ga0207706_11484163 3300025933 Unclassified 554
218 Ga0207686_10008369 3300025934 Bacteria 5583
219 Ga0207686_10020885 3300025934 Bacteria 3748
220 Ga0207686_10201614 3300025934 Bacteria 1425
221 Ga0207709_10006429 3300025935 Bacteria 6594
222 Ga0207709_10153537 3300025935 Bacteria 1597
223 Ga0207670_10140135 3300025936 Bacteria 1783
224 Ga0207670_10309090 3300025936 Unclassified 1240
225 Ga0207669_10209915 3300025937 Bacteria 1420
226 Ga0207669_10551441 3300025937 Unclassified 930
227 Ga0207669_10751246 3300025937 Unclassified 805
228 Ga0207704_10041819 3300025938 Bacteria 2691
229 Ga0207704_10912573 3300025938 Unclassified 739
230 Ga0207665_10163587 3300025939 Bacteria 1602
231 Ga0207691_10023578 3300025940 Bacteria 5794
232 Ga0207691_10044644 3300025940 Bacteria 4078
233 Ga0207711_10046701 3300025941 Bacteria 3700
234 Ga0207711_10195743 3300025941 Bacteria 1843
235 Ga0207711_10275385 3300025941 Bacteria 1549
236 Ga0207689_10028761 3300025942 Bacteria 4648
237 Ga0207661_10202142 3300025944 Bacteria 1747
238 Ga0207679_10421916 3300025945 Bacteria 1177
239 Ga0207651_10004480 3300025960 Bacteria 7047
240 Ga0207651_10012200 3300025960 Bacteria 4851
241 Ga0207651_11007691 3300025960 Unclassified 744
242 Ga0207712_11413696 3300025961 Unclassified 623
243 Ga0207712_12100654 3300025961 Unclassified 505
244 Ga0207668_11800154 3300025972 Bacteria 553
245 Ga0207640_10104787 3300025981 Bacteria 1992
246 Ga0207658_10865306 3300025986 Bacteria 822
247 Ga0207677_10311801 3300026023 Unclassified 1304
248 Ga0207677_10787781 3300026023 Bacteria 850
249 Ga0207703_10059449 3300026035 Bacteria 3122
250 Ga0207703_11296042 3300026035 Bacteria 700
251 Ga0207639_11712053 3300026041 Unclassified 589
252 Ga0207708_10008858 3300026075 Bacteria 7449
253 Ga0207708_10011459 3300026075 Bacteria 6606
254 Ga0207641_10063447 3300026088 Bacteria 3156
255 Ga0207641_11654024 3300026088 Bacteria 642
256 Ga0207641_11895655 3300026088 Bacteria 598
257 Ga0207648_10011561 3300026089 Bacteria 8311
258 Ga0207648_10082705 3300026089 Bacteria 2800
259 Ga0207648_10150257 3300026089 Bacteria 2055
260 Ga0207648_10552409 3300026089 Unclassified 1058
261 Ga0207675_100003313 3300026118 Bacteria 15760
262 Ga0207675_100019551 3300026118 Bacteria 6321
263 Ga0207675_101392814 3300026118 Unclassified 722
264 Ga0207683_10020882 3300026121 Bacteria 5604
265 Ga0207683_10113593 3300026121 Bacteria 2426
266 Ga0207683_10224729 3300026121 Bacteria 1711
267 Ga0207683_10679694 3300026121 Bacteria 954
268 Ga0207698_10037516 3300026142 Bacteria 3570
269 Ga0268266_10005859 3300028379 Bacteria 11371
270 Ga0268266_10028139 3300028379 Bacteria 4779
271 Ga0268265_10542841 3300028380 Unclassified 1102
272 Ga0268265_10646631 3300028380 Unclassified 1016
273 Ga0268264_10134066 3300028381 Bacteria 2200
274 Ga0268264_10175257 3300028381 Unclassified 1943
275 Ga0268264_10204843 3300028381 Bacteria 1807
276 Ga0268264_10218884 3300028381 Bacteria 1752
277 Ga0265330_10129720 3300031235 Unclassified 1073
278 Ga0307408_100072251 3300031548 Bacteria 2554
279 Ga0307408_100438069 3300031548 Bacteria 1131
280 Ga0307405_10368276 3300031731 Bacteria 1114
281 Ga0307412_10343682 3300031911 Bacteria 1195
282 Ga0307416_100668497 3300032002 Bacteria 1125
283 Ga0307411_10094018 3300032005 Bacteria 2101
284 Ga0373957_0322670 3300035120 Bacteria 657
285 Ga0373955_0144015 3300035172 Bacteria 1399
286 Ga0373942_0014442 3300035207 Bacteria 1912
287 Ga0373931_0079920 3300035691 Bacteria 1802
288 Ga0373937_0007350 3300036401 Bacteria 9538
289 Ga0436365_0195464 3300039437 Unclassified 827
290 Ga0439436_0264635 3300041404 Unclassified 501
291 Ga0439439_0144933 3300041406 Unclassified 672
292 Ga0451807_0288252 3300041486 Bacteria 1133
293 Ga0451853_1224884 3300041512 Bacteria 852
294 Ga0451853_3857286 3300041512 Bacteria 748
295 Ga0439431_0212669 3300041997 Unclassified 566
296 Ga0466958_0761818 3300045836 Bacteria 631
297 Ga0495603_0295167 3300046455 Unclassified 931
298 Ga0495594_0029771 3300046499 Bacteria 2952
299 Ga0495594_0421460 3300046499 Bacteria 759
300 Ga0495674_0954833 3300047319 Unclassified 659
301 Ga0496102_0373914 3300048905 Unclassified 1341
302 Ga0496106_0690719 3300048909 Bacteria 814
303 Ga0496107_0168505 3300048910 Bacteria 1625
304 Ga0496108_0374741 3300048911 Bacteria 1243
305 Ga0496108_0453309 3300048911 Bacteria 1121
306 Ga0496109_0717216 3300048912 Unclassified 938
307 Ga0496109_0901878 3300048912 Unclassified 822
308 Ga0496109_2037312 3300048912 Unclassified 506
309 Ga0496110_0095349 3300048913 Bacteria 2665
310 Ga0496110_1217975 3300048913 Unclassified 662
311 Ga0496112_0162366 3300048915 Bacteria 2201
312 Ga0496113_0613695 3300048916 Unclassified 871
313 Ga0496114_0044487 3300048917 Bacteria 3684
314 Ga0496114_0510663 3300048917 Bacteria 1063
315 Ga0496115_0428821 3300048918 Unclassified 1070
316 Ga0501074_0868049 3300049590 Bacteria 635
317 Ga0501080_0354046 3300049742 Unclassified 1325
318 nmdc:mga07m45_887978_c1 3300050496 Unclassified 510
319 nmdc:mga05p37_152791_c1 3300050507 Bacteria 2822
320 nmdc:mga05p37_279429_c1 3300050507 Unclassified 1992
321 nmdc:mga09592_95511_c1 3300050508 Unclassified 2543
322 nmdc:mga0qj67_145617_c1 3300050509 Unclassified 1921
323 nmdc:mga0qj67_580546_c1 3300050509 Bacteria 898
324 nmdc:mga06r32_20600_c1 3300050510 Bacteria 6074
325 nmdc:mga06r32_31386_c1 3300050510 Bacteria 4990
326 nmdc:mga0rr50_41667_c1 3300050513 Bacteria 3348
327 nmdc:mga0rr50_474528_c1 3300050513 Bacteria 1062
328 Ga0495601_0071464 3300053077 Bacteria 2216
329 Ga0075428_100032967
330 JGI24748J21848_1052951
331 JGI25406J46586_10005413
332 Ga0065715_10009740
333 Ga0065715_10094021
334 Ga0065715_10906372
335 Ga0070676_10007824
336 Ga0070676_10024292
337 Ga0070683_100910510
338 Ga0070690_100230337
339 Ga0070690_100326787
340 Ga0070690_100938323
341 Ga0070677_10068482
342 Ga0070666_10046823
343 Ga0070666_10410672
344 Ga0070666_10440325
345 Ga0070666_10533187
346 Ga0070680_101519985
347 Ga0070682_100177519
348 Ga0068868_100023562
349 Ga0070689_100265605
350 Ga0070691_10005854
351 Ga0070691_10194282
352 Ga0070687_100145347
353 Ga0070661_100324646
354 Ga0070661_101913709
355 Ga0070692_10216608
356 Ga0070692_10667164
357 Ga0070669_100012235
358 Ga0070669_100020835
359 Ga0070675_100958311
360 Ga0070675_101054361
361 Ga0070675_102068446
362 Ga0070671_100362852
363 Ga0070674_100031802
364 Ga0070674_100185681
365 Ga0070674_100514345
366 Ga0070673_100024795
367 Ga0070673_100097611
368 Ga0070673_101338945
369 Ga0070688_100103860
370 Ga0070688_100760560
371 Ga0070659_100472087
372 Ga0070667_100526584
373 Ga0070703_10235126
374 Ga0070701_10009813
375 Ga0070701_10030762
376 Ga0070705_100062370
377 Ga0070705_100196042
378 Ga0070700_100004041
379 Ga0070700_100298797
380 Ga0070700_101062580
381 Ga0070700_101850591
382 Ga0070694_100003083
383 Ga0070694_101463987
384 Ga0070708_100474035
385 Ga0070663_100979161
386 Ga0070678_100004427
387 Ga0070678_100137934
388 Ga0070678_100558444
389 Ga0068867_100030715
390 Ga0068867_100038834
391 Ga0068867_100496219
392 Ga0068867_101889043
393 Ga0070698_100497249
394 Ga0070679_100270979
395 Ga0070684_100471665
396 Ga0068853_100778633
397 Ga0070672_100040436
398 Ga0070672_100105987
399 Ga0070672_101465238
400 Ga0070695_100013400
401 Ga0070695_100096015
402 Ga0070696_100014092
403 Ga0070693_100063529
404 Ga0070693_100068397
405 Ga0070693_100677013
406 Ga0070665_100014194
407 Ga0070665_100420297
408 Ga0070704_100017123
409 Ga0070704_100051553
410 Ga0070664_100040022
411 Ga0068854_100066621
412 Ga0068854_100400651
413 Ga0070702_100000824
414 Ga0070702_100082972
415 Ga0068852_100512949
416 Ga0068859_100142052
417 Ga0068859_100442442
418 Ga0068866_10022155
419 Ga0068866_10104172
420 Ga0068861_100019787
421 Ga0068861_100130894
422 Ga0068851_10208635
423 Ga0068863_100046714
424 Ga0068858_100027402
425 Ga0068858_100120385
426 Ga0068858_100729319
427 Ga0068860_100184278
428 Ga0068860_100258728
429 Ga0068860_100410469
430 Ga0068860_100540179
431 Ga0068862_100521314
432 Ga0068862_100585906
433 Ga0081539_10000237
434 Ga0070717_10027968
435 Ga0070717_10085137
436 Ga0070717_11311946
437 Ga0075364_10063419
438 Ga0070716_100116473
439 Ga0097621_100248814
440 Ga0097621_101251203
441 Ga0068871_102336274
442 Ga0075428_100013456
443 Ga0075430_100004576
444 Ga0075430_100083520
445 Ga0075430_100281067
446 Ga0075431_100005241
447 Ga0075431_100025090
448 Ga0075433_11502436
449 Ga0075434_100761549
450 Ga0075429_100038707
451 Ga0075429_100081433
452 Ga0068865_100038826
453 Ga0068865_100308086
454 Ga0097620_100142049
455 Ga0097620_100442419
456 Ga0075435_100058430
457 Ga0075435_100323892
458 Ga0105240_10715489
459 Ga0105240_11007718
460 Ga0105245_10041631
461 Ga0105245_10060430
462 Ga0105247_10128587
463 Ga0105247_10627664
464 Ga0114129_10145639
465 Ga0114129_10177285
466 Ga0105243_10020711
467 Ga0105243_10042170
468 Ga0105241_10070230
469 Ga0105241_10294066
470 Ga0105241_10320504
471 Ga0105242_10004234
472 Ga0105242_10019893
473 Ga0105242_10223967
474 Ga0105242_12062680
475 Ga0105248_10019432
476 Ga0105248_10244441
477 Ga0105248_10342021
478 Ga0105248_11467701
479 Ga0105248_11598850
480 Ga0105248_12538448
481 Ga0105238_12801616
482 Ga0105249_10352646
483 Ga0105249_11073920
484 Ga0105249_11802031
485 Ga0105239_10128132
486 Ga0105239_12709747
487 Ga0105246_10801547
488 Ga0157374_10011634
489 Ga0157378_11145486
490 Ga0157378_11567156
491 Ga0163162_10177363
492 Ga0163162_10513725
493 Ga0163162_10825503
494 Ga0163162_11614208
495 Ga0157375_11381236
496 Ga0163163_10217327
497 Ga0157377_10452158
498 Ga0157379_10004339
499 Ga0157379_10160405
500 Ga0157379_11980174
501 Ga0157376_10169326
502 Ga0157376_10367030
503 Ga0207697_10001011
504 Ga0207697_10040232
505 Ga0207656_10101816
506 Ga0207682_10007229
507 Ga0207642_10071929
508 Ga0207642_10086937
509 Ga0207710_10358132
510 Ga0207688_10006673
511 Ga0207688_10627243
512 Ga0207688_11037430
513 Ga0207680_10020776
514 Ga0207680_10095373
515 Ga0207680_10484161
516 Ga0207647_10213404
517 Ga0207699_10043258
518 Ga0207645_10012773
519 Ga0207645_10016652
520 Ga0207654_10190689
521 Ga0207695_10421799
522 Ga0207695_10506346
523 Ga0207660_10670720
524 Ga0207660_11570657
525 Ga0207662_10015810
526 Ga0207649_10348677
527 Ga0207649_11332820
528 Ga0207652_10685989
529 Ga0207681_10011535
530 Ga0207681_10088346
531 Ga0207681_10537541
532 Ga0207694_10830658
533 Ga0207694_11873821
534 Ga0207650_10290205
535 Ga0207650_10302237
536 Ga0207650_11686261
537 Ga0207659_10456805
538 Ga0207659_11387321
539 Ga0207687_10152473
540 Ga0207687_10189967
541 Ga0207700_10037579
542 Ga0207644_10309907
543 Ga0207690_10107500
544 Ga0207706_10231877
545 Ga0207706_11484163
546 Ga0207686_10008369
547 Ga0207686_10020885
548 Ga0207686_10201614
549 Ga0207709_10006429
550 Ga0207709_10153537
551 Ga0207670_10140135
552 Ga0207670_10309090
553 Ga0207669_10209915
554 Ga0207669_10551441
555 Ga0207669_10751246
556 Ga0207704_10041819
557 Ga0207704_10912573
558 Ga0207665_10163587
559 Ga0207691_10023578
560 Ga0207691_10044644
561 Ga0207711_10046701
562 Ga0207711_10195743
563 Ga0207711_10275385
564 Ga0207689_10028761
565 Ga0207661_10202142
566 Ga0207679_10421916
567 Ga0207651_10004480
568 Ga0207651_10012200
569 Ga0207651_11007691
570 Ga0207712_11413696
571 Ga0207712_12100654
572 Ga0207668_11800154
573 Ga0207640_10104787
574 Ga0207658_10865306
575 Ga0207677_10311801
576 Ga0207677_10787781
577 Ga0207703_10059449
578 Ga0207703_11296042
579 Ga0207639_11712053
580 Ga0207708_10008858
581 Ga0207708_10011459
582 Ga0207641_10063447
583 Ga0207641_11654024
584 Ga0207641_11895655
585 Ga0207648_10011561
586 Ga0207648_10082705
587 Ga0207648_10150257
588 Ga0207648_10552409
589 Ga0207675_100003313
590 Ga0207675_100019551
591 Ga0207675_101392814
592 Ga0207683_10020882
593 Ga0207683_10113593
594 Ga0207683_10224729
595 Ga0207683_10679694
596 Ga0207698_10037516
597 Ga0268266_10005859
598 Ga0268266_10028139
599 Ga0268265_10542841
600 Ga0268265_10646631
601 Ga0268264_10134066
602 Ga0268264_10175257
603 Ga0268264_10204843
604 Ga0268264_10218884
605 Ga0265330_10129720
606 Ga0307408_100072251
607 Ga0307408_100438069
608 Ga0307405_10368276
609 Ga0307412_10343682
610 Ga0307416_100668497
611 Ga0307411_10094018
612 Ga0373957_0322670
613 Ga0373955_0144015
614 Ga0373942_0014442
615 Ga0373931_0079920
616 Ga0373937_0007350
617 Ga0436365_0195464
618 Ga0439436_0264635
619 Ga0439439_0144933
620 Ga0451807_0288252
621 Ga0451853_1224884
622 Ga0451853_3857286
623 Ga0439431_0212669
624 Ga0466958_0761818
625 Ga0495603_0295167
626 Ga0495594_0029771
627 Ga0495594_0421460
628 Ga0495674_0954833
629 Ga0496102_0373914
630 Ga0496106_0690719
631 Ga0496107_0168505
632 Ga0496108_0374741
633 Ga0496108_0453309
634 Ga0496109_0717216
635 Ga0496109_0901878
636 Ga0496109_2037312
637 Ga0496110_0095349
638 Ga0496110_1217975
639 Ga0496112_0162366
640 Ga0496113_0613695
641 Ga0496114_0044487
642 Ga0496114_0510663
643 Ga0496115_0428821
644 Ga0501074_0868049
645 Ga0501080_0354046
646 nmdc:mga07m45_887978_c1
647 nmdc:mga05p37_152791_c1
648 nmdc:mga05p37_279429_c1
649 nmdc:mga09592_95511_c1
650 nmdc:mga0qj67_145617_c1
651 nmdc:mga0qj67_580546_c1
652 nmdc:mga06r32_20600_c1
653 nmdc:mga06r32_31386_c1
654 nmdc:mga0rr50_41667_c1
655 nmdc:mga0rr50_474528_c1
656 Ga0495601_0071464

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07689

KaiB

KaiB domain

24

105

0.98

Map