F409062

General Info

Members Datasets Scaffolds Average Seq Length
328 228 264 196

Family's Representative Sequence

Representative Sequence 3300003354|JGI25160J50197_1020214|JGI25160J50197_10202143
Length 222
Sequence MAAPCDLRFDCGRICLDLAATSGAPAERFTGEGPTGERLTGPDQLRAWLLGAGLVPRGTPLDGVDGSWVGRFRALRELLRRVVHEELRGRAADADLALLNSAAASGQPPAPCAVRTADGALAGALPGPPDCAGLLAAVARDAIGLLTDPASRGQLRQCAGESCTLVYLDTSRGRRRRWCSSEVCGNRERVARHRRRTTVRGGQDGSAGQGVVTGAEKFSAEL

Samples

Sample ID Description Type Environment
1 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
2 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
3 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
4 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
5 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
6 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
7 2643221548 Streptomyces sp. Root55 Isolate Unclassified
8 2643221578 Streptomyces sp. Root63 Isolate Unclassified
9 2643221647 Streptomyces sp. Root369 Isolate Unclassified
10 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
11 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
12 2643221714 Streptomyces sp. Root264 Isolate Unclassified
13 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
14 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
15 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
16 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
17 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
18 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
19 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
20 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
21 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
22 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
23 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
24 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
25 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
26 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
27 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
28 2867475112 Streptomyces sp. TM32 Isolate Unclassified
29 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
30 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
31 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
32 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
33 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
34 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
35 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
36 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
37 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
38 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
39 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
40 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
41 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
42 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
43 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
44 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
45 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
46 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
47 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
48 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
49 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
50 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
51 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
52 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
53 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
54 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
55 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
56 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
57 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
58 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
59 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
60 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
61 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
62 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
67 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
68 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
69 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
70 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
74 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
75 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
76 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
77 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
82 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
84 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
85 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
86 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
87 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
88 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
89 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
90 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
91 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
92 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
93 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
94 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
95 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
96 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
97 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
98 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
99 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
100 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
101 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
102 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
103 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
104 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
105 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
106 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
107 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
108 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
109 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
110 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
111 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
112 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
113 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
114 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
115 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
116 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
117 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
118 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
119 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
120 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
121 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
122 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
123 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
124 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
125 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
126 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
127 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
128 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
129 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
130 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
131 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
132 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
133 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
134 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
135 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
136 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
137 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
138 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
139 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
140 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
141 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
142 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
143 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
144 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
145 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
146 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
147 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
148 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
149 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
150 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
151 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
152 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
153 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
154 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
155 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
156 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
157 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
158 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
159 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
160 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
161 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
162 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
163 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
164 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
165 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
166 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
167 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
168 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
169 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
170 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
171 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
172 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
173 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
174 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
175 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
176 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
177 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
178 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
179 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
180 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
181 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
182 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
183 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
184 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
185 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
186 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
187 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
188 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
189 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
190 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
191 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
192 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
193 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
194 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
195 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
205 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
206 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
207 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
209 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
210 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
211 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
212 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
213 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
214 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
215 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
216 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
217 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
218 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
219 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
220 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
221 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
222 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
223 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
224 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
225 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
226 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
227 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
228 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 79.57
Metatranscriptomes 0.61
Isolates 19.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.18
Nodule 0.61
Rhizoplane 1.52
Rhizosphere 75
Stem 0
Stem Tuber 0
Unclassified 17.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10010984 3300001990 Bacteria 2973
2 JGI24738J21930_10005597 3300002075 Bacteria 2998
3 rootH1_10009510 3300003316 Bacteria 17023
4 rootH1_10009510 3300003323 Bacteria 2999
5 rootH1_10043992 3300003316 Bacteria 1730
6 rootH2_10060871 3300003320 Bacteria 2175
7 rootH2_10131288 3300003320 Bacteria 1984
8 rootL2_10086346 3300003322 Bacteria 2829
9 rootH1_10048420 3300003323 Bacteria 7725
10 rootH1_10060517 3300003323 Bacteria 1416
11 JGI25160J50197_1018775 3300003354 Bacteria 2143
12 JGI25160J50197_1020214 3300003354 Bacteria 2016
13 JGI25160J50197_1039690 3300003354 Bacteria 1099
14 Ga0006562J51391_1064991 3300003578 Bacteria 5770
15 Ga0006562J51391_1064992 3300003578 Bacteria 3030
16 Ga0070665_100031658 3300005548 Bacteria 5323
17 Ga0068858_100527456 3300005842 Bacteria 1142
18 Ga0075368_10016324 3300006042 Bacteria 2767
19 Ga0075367_10014392 3300006178 Bacteria 4282
20 Ga0075370_10036858 3300006353 Bacteria 2748
21 Ga0099826_10061895 3300006948 Bacteria 2428
22 Ga0105251_10046208 3300009011 Bacteria 2096
23 Ga0105244_10148903 3300009036 Bacteria 1122
24 Ga0105250_10114099 3300009092 Bacteria 1108
25 Ga0105243_10034957 3300009148 Bacteria 3895
26 Ga0105243_10384210 3300009148 Bacteria 1300
27 Ga0105246_10002232 3300011119 Bacteria 11683
28 Ga0105246_10554846 3300011119 Bacteria 985
29 Ga0182008_10014008 3300014497 Bacteria 4205
30 Ga0182007_10003411 3300015262 Bacteria 7491
31 Ga0182005_1048584 3300015265 Bacteria 1153
32 Ga0207426_1003053 3300025302 Bacteria 9650
33 Ga0207426_1023427 3300025302 Bacteria 2106
34 Ga0207426_1057534 3300025302 Bacteria 1131
35 Ga0207713_1048329 3300025735 Bacteria 1714
36 Ga0207647_10030001 3300025904 Bacteria 3513
37 Ga0207709_10039917 3300025935 Bacteria 2807
38 Ga0207709_10514302 3300025935 Bacteria 936
39 Ga0209371_1022054 3300027312 Bacteria 1531
40 Ga0209813_10019238 3300027866 Bacteria 1896
41 Ga0268266_10061761 3300028379 Bacteria 3232
42 Ga0307517_10006087 3300028786 Bacteria 17978
43 Ga0307515_10022995 3300028794 Bacteria 10956
44 Ga0307515_10035191 3300028794 Bacteria 8158
45 Ga0307515_10125308 3300028794 Bacteria 2875
46 Ga0268256_1024840 3300030500 Bacteria 1531
47 Ga0307511_10050602 3300030521 Bacteria 3343
48 Ga0307511_10167184 3300030521 Bacteria 1218
49 Ga0307512_10001739 3300030522 Bacteria 29707
50 Ga0307513_10056655 3300031456 Bacteria 4182
51 Ga0307513_10230599 3300031456 Bacteria 1664
52 Ga0307509_10302936 3300031507 Bacteria 1345
53 Ga0307508_10019776 3300031616 Bacteria 6118
54 Ga0307508_10146048 3300031616 Bacteria 1969
55 Ga0307508_10217824 3300031616 Bacteria 1509
56 Ga0307514_10065105 3300031649 Bacteria 2762
57 Ga0307514_10068803 3300031649 Bacteria 2666
58 Ga0307514_10088135 3300031649 Bacteria 2271
59 Ga0307514_10130162 3300031649 Bacteria 1734
60 Ga0307514_10267315 3300031649 Bacteria 994
61 Ga0307516_10007247 3300031730 Bacteria 12777
62 Ga0307518_10176974 3300031838 Bacteria 1447
63 Ga0307416_100064800 3300032002 Bacteria 2999
64 Ga0307507_10088782 3300033179 Bacteria 2664
65 Ga0307507_10125224 3300033179 Bacteria 2036
66 Ga0307510_10005157 3300033180 Bacteria 15526
67 Ga0307510_10024034 3300033180 Bacteria 7050
68 Ga0307510_10327522 3300033180 Bacteria 987
69 Ga0395898_0020054 3300037466 Bacteria 6794
70 Ga0439436_0016296 3300041404 Bacteria 2230
71 Ga0439439_0001845 3300041406 Bacteria 4355
72 Ga0439439_0031302 3300041406 Bacteria 1355
73 Ga0439433_0023992 3300041999 Bacteria 1373
74 Ga0439448_0023950 3300042005 Bacteria 1907
75 Ga0439449_0007352 3300042007 Bacteria 4184
76 Ga0439449_0088121 3300042007 Bacteria 1145
77 Ga0439455_0000479 3300042012 Bacteria 5515
78 Ga0439457_025032 3300042014 Bacteria 1321
79 Ga0439462_0002499 3300042015 Bacteria 4281
80 Ga0450894_000398 3300042131 Bacteria 7449
81 Ga0450898_004095 3300042134 Bacteria 2134
82 Ga0450899_000297 3300042135 Bacteria 5416
83 Ga0439458_0000765 3300042157 Bacteria 8243
84 Ga0450908_004725 3300042184 Bacteria 2623
85 Ga0450901_003116 3300042533 Bacteria 1737
86 Ga0466972_0061213 3300044658 Bacteria 1805
87 Ga0466963_0093569 3300044694 Bacteria 2049
88 Ga0466964_0049402 3300044706 Bacteria 1722
89 Ga0466970_0009628 3300044765 Bacteria 4888
90 Ga0466970_0253178 3300044765 Bacteria 987
91 Ga0466960_0092898 3300044901 Bacteria 1541
92 Ga0466960_0116482 3300044901 Bacteria 1394
93 Ga0466967_0459816 3300045976 Bacteria 1245
94 Ga0495617_002709 3300046452 Bacteria 6866
95 Ga0495592_0004581 3300046454 Bacteria 10124
96 Ga0495603_0013092 3300046455 Bacteria 5014
97 Ga0495603_0018372 3300046455 Bacteria 4230
98 Ga0495603_0048097 3300046455 Bacteria 2539
99 Ga0495603_0082555 3300046455 Bacteria 1883
100 Ga0495629_0008089 3300046459 Bacteria 7740
101 Ga0495629_0034352 3300046459 Bacteria 3585
102 Ga0495629_0034399 3300046459 Bacteria 3582
103 Ga0495629_0039863 3300046459 Bacteria 3305
104 Ga0495629_0070684 3300046459 Bacteria 2435
105 Ga0495629_0094891 3300046459 Bacteria 2081
106 Ga0495629_0213433 3300046459 Bacteria 1332
107 Ga0495638_0282619 3300046460 Bacteria 901
108 Ga0495651_0001316 3300046462 Bacteria 19237
109 Ga0495582_0013680 3300046473 Bacteria 4467
110 Ga0495582_0022404 3300046473 Bacteria 3457
111 Ga0495582_0055288 3300046473 Bacteria 2188
112 Ga0495582_0169751 3300046473 Bacteria 1242
113 Ga0495605_0006478 3300046474 Bacteria 6727
114 Ga0495605_0094222 3300046474 Bacteria 1383
115 Ga0495639_0011764 3300046475 Bacteria 3774
116 Ga0495639_0136141 3300046475 Bacteria 1178
117 Ga0495662_0002928 3300046476 Bacteria 8618
118 Ga0495662_0028640 3300046476 Bacteria 2688
119 Ga0495662_0038285 3300046476 Bacteria 2317
120 Ga0495662_0096207 3300046476 Bacteria 1447
121 Ga0495662_0157009 3300046476 Bacteria 1120
122 Ga0495664_0004188 3300046477 Bacteria 7880
123 Ga0495585_0057575 3300046492 Bacteria 2144
124 Ga0495594_0000183 3300046499 Bacteria 30417
125 Ga0495594_0021227 3300046499 Bacteria 3465
126 Ga0495594_0021627 3300046499 Bacteria 3434
127 Ga0495607_0021943 3300046501 Bacteria 4015
128 Ga0495583_0034581 3300046506 Bacteria 2419
129 Ga0495583_0104256 3300046506 Bacteria 1207
130 Ga0495606_0102669 3300046507 Bacteria 1738
131 Ga0495608_0213671 3300046511 Bacteria 1212
132 Ga0495610_0049725 3300046512 Bacteria 2051
133 Ga0495616_0014499 3300046513 Bacteria 4410
134 Ga0495618_0093877 3300046514 Bacteria 1918
135 Ga0495618_0226763 3300046514 Bacteria 1177
136 Ga0495620_0033572 3300046515 Bacteria 2328
137 Ga0495620_0181035 3300046515 Bacteria 815
138 Ga0495628_0136559 3300046516 Bacteria 1874
139 Ga0495628_0346761 3300046516 Bacteria 1092
140 Ga0495631_0010287 3300046518 Bacteria 4634
141 Ga0495632_0282975 3300046519 Bacteria 738
142 Ga0495637_0028110 3300046520 Bacteria 2513
143 Ga0495643_0002686 3300046522 Bacteria 13722
144 Ga0495666_0084463 3300046526 Bacteria 1500
145 Ga0495666_0086110 3300046526 Bacteria 1484
146 Ga0495666_0245411 3300046526 Bacteria 816
147 Ga0495642_0234810 3300046528 Bacteria 801
148 Ga0495652_0049218 3300046529 Bacteria 3609
149 Ga0495652_0060988 3300046529 Bacteria 3185
150 Ga0495665_0153197 3300046531 Bacteria 1203
151 Ga0495640_0048720 3300046533 Bacteria 2926
152 Ga0495640_0379048 3300046533 Bacteria 870
153 Ga0495586_0034070 3300046535 Bacteria 2734
154 Ga0495587_0003125 3300046536 Bacteria 11074
155 Ga0495609_0101063 3300046538 Bacteria 1249
156 Ga0495597_0022335 3300046542 Bacteria 2935
157 Ga0495622_0005705 3300046557 Bacteria 5775
158 Ga0495622_0009277 3300046557 Bacteria 4554
159 Ga0495633_0009712 3300046558 Bacteria 5291
160 Ga0495633_0108623 3300046558 Bacteria 1286
161 Ga0495667_0083918 3300046559 Bacteria 2069
162 Ga0495667_0100191 3300046559 Bacteria 1875
163 Ga0495668_0010792 3300046616 Bacteria 5512
164 Ga0495668_0077259 3300046616 Bacteria 1827
165 Ga0495634_0041260 3300046642 Bacteria 3134
166 Ga0495634_0047716 3300046642 Bacteria 2884
167 Ga0495611_0329852 3300046648 Bacteria 701
168 Ga0495625_0016142 3300046660 Bacteria 5884
169 Ga0495625_0187934 3300046660 Bacteria 1370
170 Ga0495625_0362328 3300046660 Bacteria 913
171 Ga0495635_0000979 3300046663 Bacteria 18813
172 Ga0495635_0036827 3300046663 Bacteria 3388
173 Ga0495635_0063012 3300046663 Bacteria 2546
174 Ga0495661_0003290 3300046665 Bacteria 11992
175 Ga0495588_0002755 3300046674 Bacteria 7545
176 Ga0495588_0003169 3300046674 Bacteria 7118
177 Ga0495588_0090299 3300046674 Bacteria 1604
178 Ga0495657_0006307 3300046675 Bacteria 9291
179 Ga0495657_0022433 3300046675 Bacteria 4520
180 Ga0495657_0184668 3300046675 Bacteria 1277
181 Ga0495657_0207307 3300046675 Bacteria 1192
182 Ga0495623_0136411 3300046679 Bacteria 1464
183 Ga0495646_0000748 3300046680 Bacteria 18098
184 Ga0495658_0133610 3300046683 Bacteria 1512
185 Ga0495613_0031485 3300046689 Bacteria 3940
186 Ga0495613_0058725 3300046689 Bacteria 2822
187 Ga0495613_0063855 3300046689 Bacteria 2693
188 Ga0495613_0163496 3300046689 Bacteria 1582
189 Ga0495613_0301720 3300046689 Bacteria 1108
190 Ga0495670_0274113 3300046691 Bacteria 902
191 Ga0495671_0034212 3300046692 Bacteria 2585
192 Ga0495649_0059972 3300046694 Bacteria 2048
193 Ga0495649_0093210 3300046694 Bacteria 1603
194 Ga0495649_0227847 3300046694 Bacteria 962
195 Ga0495589_0013269 3300046794 Bacteria 4252
196 Ga0495589_0096226 3300046794 Bacteria 1435
197 Ga0495589_0171037 3300046794 Bacteria 1033
198 Ga0495600_0119484 3300046809 Bacteria 1714
199 Ga0495581_0023726 3300047315 Bacteria 3554
200 Ga0495581_0052198 3300047315 Bacteria 2361
201 Ga0495604_0001062 3300047317 Bacteria 22788
202 Ga0495604_0100344 3300047317 Bacteria 2128
203 Ga0495604_0255705 3300047317 Bacteria 1192
204 Ga0495636_0004377 3300047318 Bacteria 5541
205 Ga0495636_0078517 3300047318 Bacteria 1418
206 Ga0495674_0201385 3300047319 Bacteria 1651
207 Ga0495676_0018814 3300047321 Bacteria 6088
208 Ga0495676_0077597 3300047321 Bacteria 2532
209 Ga0495680_0008433 3300047322 Bacteria 9366
210 Ga0495683_0075882 3300047323 Bacteria 1645
211 Ga0495687_015329 3300047443 Bacteria 3903
212 Ga0495687_026222 3300047443 Bacteria 2747
213 Ga0495687_170758 3300047443 Bacteria 720
214 Ga0495675_0008782 3300047444 Bacteria 6273
215 Ga0495685_004303 3300047447 Bacteria 4591
216 Ga0495685_007247 3300047447 Bacteria 3657
217 Ga0495685_015696 3300047447 Bacteria 2586
218 Ga0495685_016607 3300047447 Bacteria 2516
219 Ga0495673_0176684 3300047469 Bacteria 811
220 Ga0495681_0000117 3300047470 Bacteria 69601
221 Ga0495681_0048434 3300047470 Bacteria 2014
222 Ga0495684_0049303 3300047471 Bacteria 3218
223 Ga0495686_0015649 3300047472 Bacteria 5172
224 Ga0495686_0099367 3300047472 Bacteria 1757
225 Ga0495686_0364421 3300047472 Bacteria 783
226 Ga0495593_0062807 3300047673 Bacteria 1940
227 Ga0495593_0162140 3300047673 Bacteria 1128
228 Ga0495602_0156466 3300048088 Bacteria 1784
229 Ga0495614_0017742 3300048089 Bacteria 3089
230 Ga0495614_0018131 3300048089 Bacteria 3050
231 Ga0495614_0210333 3300048089 Bacteria 882
232 Ga0495626_0024406 3300048091 Bacteria 2964
233 Ga0496104_0269609 3300048907 Bacteria 1615
234 Ga0496106_0097554 3300048909 Bacteria 2275
235 Ga0496107_0211623 3300048910 Bacteria 1442
236 Ga0496109_0774570 3300048912 Bacteria 897
237 Ga0501032_0031194 3300049569 Bacteria 3655
238 Ga0501033_0000628 3300049570 Bacteria 32661
239 Ga0501033_0210277 3300049570 Bacteria 1387
240 Ga0501034_0002014 3300049571 Bacteria 25631
241 Ga0501034_0057707 3300049571 Bacteria 3902
242 Ga0501036_0002400 3300049572 Bacteria 14661
243 Ga0501036_0546759 3300049572 Bacteria 962
244 Ga0501037_0333545 3300049573 Bacteria 1048
245 Ga0501038_0002006 3300049574 Bacteria 18789
246 Ga0501038_0146966 3300049574 Bacteria 1924
247 Ga0501039_0019002 3300049575 Bacteria 5274
248 Ga0501043_0019054 3300049579 Bacteria 5388
249 Ga0501047_0043814 3300049581 Bacteria 4322
250 Ga0501070_0298074 3300049586 Bacteria 1314
251 Ga0501073_0074471 3300049589 Bacteria 2364
252 Ga0501080_0142166 3300049742 Bacteria 2218
253 Ga0501035_0070447 3300049822 Bacteria 3097
254 Ga0501035_0141863 3300049822 Bacteria 2088
255 Ga0501044_0287141 3300049823 Bacteria 1577
256 Ga0501044_0409612 3300049823 Bacteria 1267
257 nmdc:mga03n38_90409_c1 3300050490 Bacteria 1456
258 nmdc:mga06z11_7915_c1 3300050494 Bacteria 4401
259 nmdc:mga04h51_22605_c1 3300050495 Bacteria 1905
260 Ga0495655_0129730 3300053083 Bacteria 775
261 Ga0500644_0025611 3300053088 Bacteria 1817
262 Ga0500647_0102875 3300053091 Bacteria 1362
263 Ga0500560_010560 3300053107 Bacteria 2318
264 Ga0500573_0046289 3300053140 Bacteria 2507

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048907 Ga0496104_0269609 Ga0496104_0269609_1120_1593 153
2 3300046473 Ga0495582_0013680 Ga0495582_0013680_3970_4449 155
3 3300048909 Ga0496106_0097554 Ga0496106_0097554_62_610 168
4 iso_pu_bacteria 2862178590 2862184574 171
5 3300045976 Ga0466967_0459816 Ga0466967_0459816_273_866 175
6 iso_pu_bacteria 3006486233 3006488917 176
7 3300049823 Ga0501044_0409612 Ga0501044_0409612_478_1071 178
8 3300005548 Ga0070665_100031658 Ga0070665_1000316585 180
9 3300028379 Ga0268266_10061761 Ga0268266_100617612 180
10 iso_pu_bacteria 2966598605 2966602934 180
11 iso_pu_bacteria 8008558824 8008559943 180
12 iso_pu_bacteria 8025478263 8025482557 180
13 iso_pu_bacteria 8054160619 8054161023 180
14 3300041406 Ga0439439_0031302 Ga0439439_0031302_92_658 181
15 3300044658 Ga0466972_0061213 Ga0466972_0061213_715_1374 181
16 3300044765 Ga0466970_0253178 Ga0466970_0253178_259_918 181
17 3300044901 Ga0466960_0116482 Ga0466960_0116482_260_919 181
18 iso_pu_bacteria 2643221678 2644436751 181
19 iso_pu_bacteria 2808606359 2808841649 181
20 iso_pu_bacteria 2912723979 2912724677 181
21 iso_pu_bacteria 2919468124 2919474804 181
22 3300042131 Ga0450894_000398 Ga0450894_000398_4942_5511 182
23 3300042134 Ga0450898_004095 Ga0450898_004095_213_782 182
24 3300042135 Ga0450899_000297 Ga0450899_000297_3174_3743 182
25 3300042184 Ga0450908_004725 Ga0450908_004725_1246_1815 182
26 iso_pu_bacteria 2643221548 2643765480 182
27 iso_pu_bacteria 2643221682 2644462449 182
28 iso_pu_bacteria 2784746763 2785343833 182
29 iso_pu_bacteria 2791355406 2793982689 182
30 iso_pu_bacteria 2818991463 2819693320 182
31 iso_pu_bacteria 2867475112 2867477319 182
32 iso_pu_bacteria 2990059506 2990062807 182
33 iso_pu_bacteria 2997451912 2997456851 182
34 iso_pu_bacteria 8047893842 8047898483 182
35 iso_pu_bacteria 8048127548 8048134907 182
36 iso_pu_bacteria 8048356638 8048360427 182
37 iso_pu_bacteria 8048369669 8048375445 182
38 iso_pu_bacteria 8048379754 8048382760 182
39 iso_pu_bacteria 8048406513 8048411123 182
40 iso_pu_bacteria 8056667051 8056672672 182
41 iso_pu_bacteria 2863404153 2863405129 184
42 iso_pu_bacteria 2912757875 2912760273 184
43 iso_pu_bacteria 8025530807 8025533743 184
44 3300003578 Ga0006562J51391_1064991 Ga0006562J51391_10649911 185
45 3300003578 Ga0006562J51391_1064992 Ga0006562J51391_10649923 185
46 iso_pu_bacteria 2643221578 2643898265 185
47 3300003354 JGI25160J50197_1018775 JGI25160J50197_10187752 186
48 3300003354 JGI25160J50197_1020214 JGI25160J50197_10202143 186
49 3300003354 JGI25160J50197_1039690 JGI25160J50197_10396901 186
50 3300025302 Ga0207426_1003053 Ga0207426_10030534 186
51 3300025302 Ga0207426_1023427 Ga0207426_10234273 186
52 3300025302 Ga0207426_1057534 Ga0207426_10575342 186
53 3300028794 Ga0307515_10035191 Ga0307515_100351914 186
54 3300031456 Ga0307513_10056655 Ga0307513_100566551 186
55 3300031649 Ga0307514_10065105 Ga0307514_100651052 186
56 3300032002 Ga0307416_100064800 Ga0307416_1000648002 186
57 iso_pu_bacteria 2808606982 2811848601 186
58 3300049570 Ga0501033_0000628 Ga0501033_0000628_21813_22424 187
59 3300049571 Ga0501034_0002014 Ga0501034_0002014_10548_11159 187
60 3300049572 Ga0501036_0002400 Ga0501036_0002400_5200_5811 187
61 3300049575 Ga0501039_0019002 Ga0501039_0019002_2313_2924 187
62 3300049579 Ga0501043_0019054 Ga0501043_0019054_3657_4268 187
63 iso_pu_bacteria 2582581312 2585299004 187
64 iso_pu_bacteria 2616644814 2616697436 187
65 iso_pu_bacteria 2616644941 2616900445 187
66 iso_pu_bacteria 2547132111 2547407174 188
67 iso_pu_bacteria 2582581313 2585310578 188
68 iso_pu_bacteria 2643221647 2644264491 188
69 iso_pu_bacteria 2784132148 2784588226 188
70 iso_pu_bacteria 2784746768 2785369030 188
71 iso_pu_bacteria 2786546132 2786670178 188
72 iso_pu_bacteria 2877676314 2877681527 188
73 iso_pu_bacteria 2954673503 2954676515 188
74 iso_pu_bacteria 2954682443 2954687652 188
75 iso_pu_bacteria 2954691527 2954697468 188
76 iso_pu_bacteria 2954701450 2954704766 188
77 iso_pu_bacteria 2954711539 2954716630 188
78 iso_pu_bacteria 2954721474 2954726578 188
79 iso_pu_bacteria 2954731030 2954735218 188
80 iso_pu_bacteria 2954740390 2954745500 188
81 iso_pu_bacteria 2954749733 2954754088 188
82 iso_pu_bacteria 2954759201 2954764474 188
83 iso_pu_bacteria 8023623736 8023631856 188
84 iso_pu_bacteria 2582581314 2585315685 189
85 iso_pu_bacteria 2643221714 2644625451 189
86 iso_pu_bacteria 2811994879 2812358603 189
87 iso_pu_bacteria 2811994917 2812480927 189
88 iso_pu_bacteria 2852635781 2852642731 189
89 iso_pu_bacteria 2862507626 2862514952 189
90 iso_pu_bacteria 2912715099 2912720477 189
91 iso_pu_bacteria 2946064051 2946067274 189
92 iso_pu_bacteria 2946072368 2946075548 189
93 iso_pu_bacteria 2947224130 2947229970 189
94 iso_pu_bacteria 3006493962 3006496517 189
95 3300047443 Ga0495687_170758 Ga0495687_170758_123_707 190
96 3300047447 Ga0495685_016607 Ga0495685_016607_347_931 190
97 iso_pu_bacteria 2954002825 2954003177 190
98 3300005842 Ga0068858_100527456 Ga0068858_1005274562 191
99 3300006353 Ga0075370_10036858 Ga0075370_100368582 191
100 3300009011 Ga0105251_10046208 Ga0105251_100462083 191
101 3300009092 Ga0105250_10114099 Ga0105250_101140991 191
102 3300025735 Ga0207713_1048329 Ga0207713_10483292 191
103 3300030521 Ga0307511_10050602 Ga0307511_100506022 191
104 3300031649 Ga0307514_10267315 Ga0307514_102673152 191
105 3300046452 Ga0495617_002709 Ga0495617_002709_5727_6314 191
106 3300046455 Ga0495603_0013092 Ga0495603_0013092_4023_4610 191
107 3300046455 Ga0495603_0018372 Ga0495603_0018372_3161_3748 191
108 3300046455 Ga0495603_0048097 Ga0495603_0048097_1573_2190 191
109 3300046455 Ga0495603_0082555 Ga0495603_0082555_1053_1640 191
110 3300046459 Ga0495629_0008089 Ga0495629_0008089_6693_7310 191
111 3300046459 Ga0495629_0034352 Ga0495629_0034352_28_615 191
112 3300046459 Ga0495629_0034399 Ga0495629_0034399_2118_2705 191
113 3300046459 Ga0495629_0070684 Ga0495629_0070684_1110_1697 191
114 3300046459 Ga0495629_0094891 Ga0495629_0094891_1002_1589 191
115 3300046459 Ga0495629_0213433 Ga0495629_0213433_319_906 191
116 3300046473 Ga0495582_0022404 Ga0495582_0022404_2855_3442 191
117 3300046473 Ga0495582_0055288 Ga0495582_0055288_1582_2169 191
118 3300046473 Ga0495582_0169751 Ga0495582_0169751_231_818 191
119 3300046474 Ga0495605_0006478 Ga0495605_0006478_4330_4917 191
120 3300046474 Ga0495605_0094222 Ga0495605_0094222_449_1036 191
121 3300046475 Ga0495639_0011764 Ga0495639_0011764_2111_2698 191
122 3300046475 Ga0495639_0136141 Ga0495639_0136141_190_777 191
123 3300046476 Ga0495662_0002928 Ga0495662_0002928_519_1106 191
124 3300046476 Ga0495662_0028640 Ga0495662_0028640_1008_1595 191
125 3300046476 Ga0495662_0096207 Ga0495662_0096207_377_964 191
126 3300046476 Ga0495662_0157009 Ga0495662_0157009_296_883 191
127 3300046492 Ga0495585_0057575 Ga0495585_0057575_1269_1856 191
128 3300046499 Ga0495594_0000183 Ga0495594_0000183_15796_16413 191
129 3300046499 Ga0495594_0021627 Ga0495594_0021627_1686_2273 191
130 3300046501 Ga0495607_0021943 Ga0495607_0021943_3362_3949 191
131 3300046506 Ga0495583_0034581 Ga0495583_0034581_1129_1716 191
132 3300046506 Ga0495583_0104256 Ga0495583_0104256_290_877 191
133 3300046507 Ga0495606_0102669 Ga0495606_0102669_318_905 191
134 3300046511 Ga0495608_0213671 Ga0495608_0213671_597_1184 191
135 3300046512 Ga0495610_0049725 Ga0495610_0049725_1183_1770 191
136 3300046513 Ga0495616_0014499 Ga0495616_0014499_1082_1669 191
137 3300046514 Ga0495618_0093877 Ga0495618_0093877_1222_1809 191
138 3300046515 Ga0495620_0033572 Ga0495620_0033572_558_1145 191
139 3300046516 Ga0495628_0346761 Ga0495628_0346761_266_853 191
140 3300046518 Ga0495631_0010287 Ga0495631_0010287_281_868 191
141 3300046520 Ga0495637_0028110 Ga0495637_0028110_1359_1946 191
142 3300046522 Ga0495643_0002686 Ga0495643_0002686_10465_11052 191
143 3300046526 Ga0495666_0086110 Ga0495666_0086110_473_1060 191
144 3300046526 Ga0495666_0245411 Ga0495666_0245411_159_746 191
145 3300046528 Ga0495642_0234810 Ga0495642_0234810_31_618 191
146 3300046529 Ga0495652_0060988 Ga0495652_0060988_1485_2072 191
147 3300046531 Ga0495665_0153197 Ga0495665_0153197_46_633 191
148 3300046533 Ga0495640_0379048 Ga0495640_0379048_255_842 191
149 3300046538 Ga0495609_0101063 Ga0495609_0101063_240_827 191
150 3300046542 Ga0495597_0022335 Ga0495597_0022335_502_1089 191
151 3300046557 Ga0495622_0005705 Ga0495622_0005705_1660_2277 191
152 3300046558 Ga0495633_0009712 Ga0495633_0009712_4035_4622 191
153 3300046558 Ga0495633_0108623 Ga0495633_0108623_66_653 191
154 3300046559 Ga0495667_0083918 Ga0495667_0083918_900_1487 191
155 3300046559 Ga0495667_0100191 Ga0495667_0100191_1047_1634 191
156 3300046616 Ga0495668_0010792 Ga0495668_0010792_2743_3330 191
157 3300046616 Ga0495668_0077259 Ga0495668_0077259_908_1495 191
158 3300046642 Ga0495634_0041260 Ga0495634_0041260_1142_1729 191
159 3300046648 Ga0495611_0329852 Ga0495611_0329852_48_635 191
160 3300046660 Ga0495625_0362328 Ga0495625_0362328_37_624 191
161 3300046663 Ga0495635_0036827 Ga0495635_0036827_1302_1889 191
162 3300046663 Ga0495635_0063012 Ga0495635_0063012_229_816 191
163 3300046665 Ga0495661_0003290 Ga0495661_0003290_7039_7626 191
164 3300046674 Ga0495588_0002755 Ga0495588_0002755_603_1220 191
165 3300046674 Ga0495588_0003169 Ga0495588_0003169_3942_4529 191
166 3300046675 Ga0495657_0022433 Ga0495657_0022433_177_764 191
167 3300046675 Ga0495657_0184668 Ga0495657_0184668_425_1012 191
168 3300046675 Ga0495657_0207307 Ga0495657_0207307_266_853 191
169 3300046689 Ga0495613_0058725 Ga0495613_0058725_218_805 191
170 3300046689 Ga0495613_0063855 Ga0495613_0063855_433_1020 191
171 3300046689 Ga0495613_0301720 Ga0495613_0301720_218_805 191
172 3300046691 Ga0495670_0274113 Ga0495670_0274113_28_645 191
173 3300046692 Ga0495671_0034212 Ga0495671_0034212_1922_2509 191
174 3300046694 Ga0495649_0059972 Ga0495649_0059972_1037_1624 191
175 3300046694 Ga0495649_0093210 Ga0495649_0093210_170_757 191
176 3300046694 Ga0495649_0227847 Ga0495649_0227847_30_617 191
177 3300046794 Ga0495589_0013269 Ga0495589_0013269_1732_2319 191
178 3300046794 Ga0495589_0096226 Ga0495589_0096226_16_603 191
179 3300046794 Ga0495589_0171037 Ga0495589_0171037_238_855 191
180 3300047315 Ga0495581_0023726 Ga0495581_0023726_2894_3481 191
181 3300047315 Ga0495581_0052198 Ga0495581_0052198_35_622 191
182 3300047317 Ga0495604_0100344 Ga0495604_0100344_266_853 191
183 3300047317 Ga0495604_0255705 Ga0495604_0255705_266_853 191
184 3300047318 Ga0495636_0004377 Ga0495636_0004377_3882_4469 191
185 3300047318 Ga0495636_0078517 Ga0495636_0078517_241_828 191
186 3300047319 Ga0495674_0201385 Ga0495674_0201385_191_778 191
187 3300047321 Ga0495676_0018814 Ga0495676_0018814_257_874 191
188 3300047321 Ga0495676_0077597 Ga0495676_0077597_1680_2267 191
189 3300047322 Ga0495680_0008433 Ga0495680_0008433_8640_9227 191
190 3300047323 Ga0495683_0075882 Ga0495683_0075882_755_1342 191
191 3300047443 Ga0495687_015329 Ga0495687_015329_1056_1643 191
192 3300047443 Ga0495687_026222 Ga0495687_026222_1860_2447 191
193 3300047444 Ga0495675_0008782 Ga0495675_0008782_488_1075 191
194 3300047447 Ga0495685_004303 Ga0495685_004303_407_994 191
195 3300047447 Ga0495685_015696 Ga0495685_015696_631_1218 191
196 3300047469 Ga0495673_0176684 Ga0495673_0176684_174_761 191
197 3300047470 Ga0495681_0048434 Ga0495681_0048434_243_830 191
198 3300047471 Ga0495684_0049303 Ga0495684_0049303_1535_2122 191
199 3300047472 Ga0495686_0015649 Ga0495686_0015649_2904_3491 191
200 3300047673 Ga0495593_0062807 Ga0495593_0062807_968_1555 191
201 3300047673 Ga0495593_0162140 Ga0495593_0162140_217_804 191
202 3300048089 Ga0495614_0017742 Ga0495614_0017742_1007_1594 191
203 3300048089 Ga0495614_0210333 Ga0495614_0210333_217_804 191
204 3300048091 Ga0495626_0024406 Ga0495626_0024406_705_1292 191
205 3300048910 Ga0496107_0211623 Ga0496107_0211623_224_811 191
206 3300048912 Ga0496109_0774570 Ga0496109_0774570_52_639 191
207 3300050490 nmdc:mga03n38_90409_c1 nmdc:mga03n38_90409_c1_434_1021 191
208 3300003316 rootH1_10009510 rootH1_100095101 192
209 3300003316 rootH1_10043992 rootH1_100439922 192
210 3300003320 rootH2_10060871 rootH2_100608711 192
211 3300003322 rootL2_10086346 rootL2_100863464 192
212 3300003323 rootH1_10048420 rootH1_100484205 192
213 3300006948 Ga0099826_10061895 Ga0099826_100618952 192
214 3300027312 Ga0209371_1022054 Ga0209371_10220541 192
215 3300030500 Ga0268256_1024840 Ga0268256_10248402 192
216 3300031616 Ga0307508_10146048 Ga0307508_101460483 192
217 3300042005 Ga0439448_0023950 Ga0439448_0023950_1284_1868 192
218 3300042012 Ga0439455_0000479 Ga0439455_0000479_677_1261 192
219 3300042157 Ga0439458_0000765 Ga0439458_0000765_6453_7037 192
220 3300042533 Ga0450901_003116 Ga0450901_003116_1067_1651 192
221 3300046515 Ga0495620_0181035 Ga0495620_0181035_80_676 192
222 3300046519 Ga0495632_0282975 Ga0495632_0282975_134_718 192
223 3300046660 Ga0495625_0187934 Ga0495625_0187934_658_1254 192
224 3300047447 Ga0495685_007247 Ga0495685_007247_2350_2946 192
225 3300047472 Ga0495686_0364421 Ga0495686_0364421_19_603 192
226 3300049586 Ga0501070_0298074 Ga0501070_0298074_201_785 192
227 3300049822 Ga0501035_0070447 Ga0501035_0070447_1799_2386 192
228 3300009148 Ga0105243_10034957 Ga0105243_100349573 193
229 3300011119 Ga0105246_10554846 Ga0105246_105548461 193
230 3300025935 Ga0207709_10039917 Ga0207709_100399172 193
231 3300028786 Ga0307517_10006087 Ga0307517_1000608712 193
232 3300028794 Ga0307515_10022995 Ga0307515_100229951 193
233 3300028794 Ga0307515_10125308 Ga0307515_101253083 193
234 3300030521 Ga0307511_10167184 Ga0307511_101671841 193
235 3300031456 Ga0307513_10230599 Ga0307513_102305991 193
236 3300031507 Ga0307509_10302936 Ga0307509_103029362 193
237 3300031616 Ga0307508_10217824 Ga0307508_102178241 193
238 3300031649 Ga0307514_10068803 Ga0307514_100688033 193
239 3300031649 Ga0307514_10088135 Ga0307514_100881352 193
240 3300031649 Ga0307514_10130162 Ga0307514_101301623 193
241 3300031730 Ga0307516_10007247 Ga0307516_100072478 193
242 3300031838 Ga0307518_10176974 Ga0307518_101769741 193
243 3300033179 Ga0307507_10088782 Ga0307507_100887822 193
244 3300033179 Ga0307507_10125224 Ga0307507_101252242 193
245 3300033180 Ga0307510_10005157 Ga0307510_1000515712 193
246 3300033180 Ga0307510_10024034 Ga0307510_100240341 193
247 3300033180 Ga0307510_10327522 Ga0307510_103275221 193
248 3300037466 Ga0395898_0020054 Ga0395898_0020054_6123_6716 193
249 3300041404 Ga0439436_0016296 Ga0439436_0016296_730_1323 193
250 3300041406 Ga0439439_0001845 Ga0439439_0001845_2388_2981 193
251 3300041999 Ga0439433_0023992 Ga0439433_0023992_380_973 193
252 3300042007 Ga0439449_0007352 Ga0439449_0007352_1448_2041 193
253 3300042007 Ga0439449_0088121 Ga0439449_0088121_519_1112 193
254 3300042014 Ga0439457_025032 Ga0439457_025032_150_743 193
255 3300042015 Ga0439462_0002499 Ga0439462_0002499_505_1098 193
256 3300046454 Ga0495592_0004581 Ga0495592_0004581_620_1213 193
257 3300046459 Ga0495629_0039863 Ga0495629_0039863_361_954 193
258 3300046460 Ga0495638_0282619 Ga0495638_0282619_119_712 193
259 3300046462 Ga0495651_0001316 Ga0495651_0001316_15264_15857 193
260 3300046476 Ga0495662_0038285 Ga0495662_0038285_544_1137 193
261 3300046477 Ga0495664_0004188 Ga0495664_0004188_928_1521 193
262 3300046499 Ga0495594_0021227 Ga0495594_0021227_1894_2487 193
263 3300046514 Ga0495618_0226763 Ga0495618_0226763_68_661 193
264 3300046516 Ga0495628_0136559 Ga0495628_0136559_261_854 193
265 3300046526 Ga0495666_0084463 Ga0495666_0084463_677_1270 193
266 3300046529 Ga0495652_0049218 Ga0495652_0049218_626_1219 193
267 3300046533 Ga0495640_0048720 Ga0495640_0048720_1889_2482 193
268 3300046535 Ga0495586_0034070 Ga0495586_0034070_443_1036 193
269 3300046536 Ga0495587_0003125 Ga0495587_0003125_990_1583 193
270 3300046557 Ga0495622_0009277 Ga0495622_0009277_3271_3864 193
271 3300046642 Ga0495634_0047716 Ga0495634_0047716_321_914 193
272 3300046660 Ga0495625_0016142 Ga0495625_0016142_3715_4314 193
273 3300046663 Ga0495635_0000979 Ga0495635_0000979_17016_17609 193
274 3300046674 Ga0495588_0090299 Ga0495588_0090299_901_1494 193
275 3300046675 Ga0495657_0006307 Ga0495657_0006307_6332_6925 193
276 3300046679 Ga0495623_0136411 Ga0495623_0136411_363_956 193
277 3300046680 Ga0495646_0000748 Ga0495646_0000748_2409_3002 193
278 3300046683 Ga0495658_0133610 Ga0495658_0133610_96_689 193
279 3300046689 Ga0495613_0031485 Ga0495613_0031485_806_1399 193
280 3300046689 Ga0495613_0163496 Ga0495613_0163496_418_1011 193
281 3300046809 Ga0495600_0119484 Ga0495600_0119484_68_661 193
282 3300047317 Ga0495604_0001062 Ga0495604_0001062_6360_6953 193
283 3300047470 Ga0495681_0000117 Ga0495681_0000117_64424_65017 193
284 3300047472 Ga0495686_0099367 Ga0495686_0099367_150_743 193
285 3300048088 Ga0495602_0156466 Ga0495602_0156466_32_625 193
286 3300048089 Ga0495614_0018131 Ga0495614_0018131_361_954 193
287 3300049570 Ga0501033_0210277 Ga0501033_0210277_571_1164 193
288 3300049574 Ga0501038_0146966 Ga0501038_0146966_1293_1886 193
289 3300053083 Ga0495655_0129730 Ga0495655_0129730_115_708 193
290 3300053088 Ga0500644_0025611 Ga0500644_0025611_179_772 193
291 3300053091 Ga0500647_0102875 Ga0500647_0102875_115_708 193
292 3300053107 Ga0500560_010560 Ga0500560_010560_170_763 193
293 3300053140 Ga0500573_0046289 Ga0500573_0046289_1609_2202 193
294 3300003320 rootH2_10131288 rootH2_101312883 194
295 iso_pu_bacteria 2808606375 2808920184 194
296 3300003323 rootH1_10060517 rootH1_100605172 195
297 3300044765 Ga0466970_0009628 Ga0466970_0009628_1297_1905 195
298 iso_pu_bacteria 2954380949 2954386656 195
299 3300030522 Ga0307512_10001739 Ga0307512_1000173920 198
300 3300031616 Ga0307508_10019776 Ga0307508_100197764 198
301 3300044694 Ga0466963_0093569 Ga0466963_0093569_1042_1638 198
302 3300044706 Ga0466964_0049402 Ga0466964_0049402_1060_1656 198
303 3300049569 Ga0501032_0031194 Ga0501032_0031194_2319_2915 198
304 3300049571 Ga0501034_0057707 Ga0501034_0057707_2438_3034 198
305 3300049572 Ga0501036_0546759 Ga0501036_0546759_64_660 198
306 3300049573 Ga0501037_0333545 Ga0501037_0333545_52_648 198
307 3300049574 Ga0501038_0002006 Ga0501038_0002006_15979_16575 198
308 3300049581 Ga0501047_0043814 Ga0501047_0043814_1680_2276 198
309 3300049589 Ga0501073_0074471 Ga0501073_0074471_38_634 198
310 3300049742 Ga0501080_0142166 Ga0501080_0142166_1397_1993 198
311 3300049822 Ga0501035_0141863 Ga0501035_0141863_1287_1883 198
312 3300049823 Ga0501044_0287141 Ga0501044_0287141_355_951 198
313 3300001990 JGI24737J22298_10010984 JGI24737J22298_100109841 199
314 3300002075 JGI24738J21930_10005597 JGI24738J21930_100055972 199
315 3300006042 Ga0075368_10016324 Ga0075368_100163242 199
316 3300006178 Ga0075367_10014392 Ga0075367_100143922 199
317 3300009036 Ga0105244_10148903 Ga0105244_101489032 199
318 3300009148 Ga0105243_10384210 Ga0105243_103842101 199
319 3300011119 Ga0105246_10002232 Ga0105246_100022325 199
320 3300014497 Ga0182008_10014008 Ga0182008_100140081 199
321 3300015262 Ga0182007_10003411 Ga0182007_100034114 199
322 3300015265 Ga0182005_1048584 Ga0182005_10485842 199
323 3300025904 Ga0207647_10030001 Ga0207647_100300012 199
324 3300025935 Ga0207709_10514302 Ga0207709_105143021 199
325 3300027866 Ga0209813_10019238 Ga0209813_100192381 199
326 3300044901 Ga0466960_0092898 Ga0466960_0092898_432_1031 199
327 3300050494 nmdc:mga06z11_7915_c1 nmdc:mga06z11_7915_c1_2707_3330 199
328 3300050495 nmdc:mga04h51_22605_c1 nmdc:mga04h51_22605_c1_1073_1696 199

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11706

zf-CGNR

CGNR zinc finger

154

197

0.98

PF07336

ABATE

Putative stress-induced transcription regulator

12

149

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7vkb-assembly1.cif.gz_A crystal structure of the a bacterial kinase complex 0.5542 96 120
5tge-assembly1.cif.gz_A thermus phage p74-26 large terminase nuclease domain 0.5425 108 138
3h0n-assembly1.cif.gz_A-2 crystal structure of a duf1470 family protein (jann_2411) from jannaschia sp. ccs1 at 1.45 a resolution 0.5402 10 192
3h0n-assembly1.cif.gz_A-2 crystal structure of a duf1470 family protein (jann_2411) from jannaschia sp. ccs1 at 1.45 a resolution 0.5234 10 192
5dmu-assembly1.cif.gz_A structure of the nhej polymerase from methanocella paludicola 0.505 106 138
ID Description Score Start End Superfamily
af_C6SX56_4_111_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.6468 104 127 2.30.30.30
2m2aA02 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.6271 104 127 2.40.10.330
af_P08956_636_860_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.5882 103 127 3.40.50.300
2ex3K05 Few Secondary Structures;Irregular;Rhinovirus 14, subunit 4;DNA polymerase; domain 5 0.5537 106 127 4.10.80.20
3h0nA00 Mainly Alpha;Orthogonal Bundle;Jann2411-like fold;Jann2411-like domain 0.5486 10 192 1.10.3300.10
ID Description Score Start End GO Terms
AF-A0A0F4J702-F1-model_v4 Uncharacterized protein 0.9091 14 165
AF-A0A0F4J702-F1-model_v4 Uncharacterized protein 0.892 14 165
AF-V4J128-F1-model_v4 deleted 0.887 12 195
AF-A0A385DAZ8-F1-model_v4 Zf-CGNR multi-domain protein 0.8865 12 195
AF-H2JNN3-F1-model_v4 deleted 0.8863 20 199

Feature Viewer

pLDDT pTM Quality
81.21 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map