F408755

General Info

Members Datasets Scaffolds Average Seq Length
327 209 654 61

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_13139526|Ga0111539_131395262
Length 73
Sequence MAAGESDTMLKVTQVKSQIGTKPKARGTLRALGLGRIGSSNTLPDRPEIRGMLHKVPHLVKVEAVGPTKDTES

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
43 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
44 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
48 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
106 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
107 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
108 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
109 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
110 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
111 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
112 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
113 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
114 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
115 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
116 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
117 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
118 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
119 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
120 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
121 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
122 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
123 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
124 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
125 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
126 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
127 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
128 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
129 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
130 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
131 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
132 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
133 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
134 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
135 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
136 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
137 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
138 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
139 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
140 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
141 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
142 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
143 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
144 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
145 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
146 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
147 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
148 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
149 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
150 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
151 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
152 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
153 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
154 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
155 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
156 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
157 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
158 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
159 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
160 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
161 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
162 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
163 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
164 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
165 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
166 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
167 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
168 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
169 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
170 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
171 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
172 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
173 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
174 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
175 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
176 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
177 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
178 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
179 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
180 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
181 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
182 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
183 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
184 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
185 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
186 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
193 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
194 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
195 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
196 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
198 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
199 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
200 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
201 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
202 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
203 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
204 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
205 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
206 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
207 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
208 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
209 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.98
Nodule 0
Rhizoplane 12.84
Rhizosphere 82.26
Stem 0
Stem Tuber 0
Unclassified 1.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_13139526 3300009094 Bacteria 533
2 Ga0070670_100211244 3300005331 Bacteria 1687
3 Ga0070677_10939987 3300005333 Bacteria 502
4 Ga0068868_102177582 3300005338 Bacteria 528
5 Ga0070689_100862942 3300005340 Bacteria 799
6 Ga0070687_100789671 3300005343 Bacteria 672
7 Ga0070661_100103545 3300005344 Bacteria 2120
8 Ga0070668_100741880 3300005347 Bacteria 869
9 Ga0070668_101407876 3300005347 Bacteria 636
10 Ga0070668_102233072 3300005347 Bacteria 506
11 Ga0070669_100180100 3300005353 Bacteria 1653
12 Ga0070669_101902323 3300005353 Bacteria 519
13 Ga0070675_101338777 3300005354 Bacteria 660
14 Ga0070671_100821676 3300005355 Bacteria 810
15 Ga0070671_101266823 3300005355 Bacteria 650
16 Ga0070671_101341590 3300005355 Bacteria 631
17 Ga0070671_101654206 3300005355 Bacteria 568
18 Ga0070674_100325380 3300005356 Bacteria 1234
19 Ga0070674_100900233 3300005356 Bacteria 771
20 Ga0070673_100515657 3300005364 Bacteria 1083
21 Ga0070659_102035054 3300005366 Bacteria 516
22 Ga0070709_10226319 3300005434 Bacteria 1336
23 Ga0070714_100040425 3300005435 Bacteria 3931
24 Ga0070714_100924309 3300005435 Bacteria 847
25 Ga0070714_102281126 3300005435 Unclassified 527
26 Ga0070713_100052533 3300005436 Bacteria 3374
27 Ga0070713_101207496 3300005436 Bacteria 732
28 Ga0070713_102455473 3300005436 Bacteria 504
29 Ga0070710_10093163 3300005437 Bacteria 1781
30 Ga0070711_100065730 3300005439 Bacteria 2538
31 Ga0070708_101830613 3300005445 Bacteria 563
32 Ga0070678_100252766 3300005456 Bacteria 1478
33 Ga0070678_102204286 3300005456 Bacteria 522
34 Ga0070681_11534735 3300005458 Bacteria 591
35 Ga0070698_100429551 3300005471 Bacteria 1256
36 Ga0070699_101390884 3300005518 Bacteria 644
37 Ga0070684_100261947 3300005535 Bacteria 1582
38 Ga0070684_100621691 3300005535 Bacteria 1005
39 Ga0070684_101480640 3300005535 Bacteria 640
40 Ga0070684_101966624 3300005535 Bacteria 552
41 Ga0070672_101407724 3300005543 Bacteria 624
42 Ga0070695_101760804 3300005545 Bacteria 519
43 Ga0070665_100119492 3300005548 Bacteria 2638
44 Ga0070665_101922629 3300005548 Bacteria 597
45 Ga0070664_101012802 3300005564 Bacteria 781
46 Ga0068856_101754356 3300005614 Bacteria 633
47 Ga0068852_102515522 3300005616 Unclassified 535
48 Ga0068859_100345629 3300005617 Bacteria 1582
49 Ga0068859_102628545 3300005617 Bacteria 554
50 Ga0068864_100267340 3300005618 Bacteria 1592
51 Ga0068864_101016163 3300005618 Bacteria 823
52 Ga0068866_11020407 3300005718 Bacteria 589
53 Ga0068863_100117658 3300005841 Bacteria 2532
54 Ga0068863_100258186 3300005841 Bacteria 1684
55 Ga0068858_100071381 3300005842 Bacteria 3221
56 Ga0068858_102281287 3300005842 Bacteria 535
57 Ga0068860_100672248 3300005843 Bacteria 1044
58 Ga0068860_101409132 3300005843 Bacteria 718
59 Ga0068862_100333043 3300005844 Bacteria 1404
60 Ga0068862_101144701 3300005844 Bacteria 775
61 Ga0081540_1007820 3300005983 Bacteria 7562
62 Ga0081539_10370301 3300005985 Bacteria 599
63 Ga0070717_10021498 3300006028 Bacteria 5085
64 Ga0075365_10521230 3300006038 Bacteria 840
65 Ga0075363_100380311 3300006048 Bacteria 828
66 Ga0075364_10017387 3300006051 Bacteria 4492
67 Ga0070716_100526543 3300006173 Bacteria 877
68 Ga0070712_100025686 3300006175 Bacteria 3918
69 Ga0070712_101074380 3300006175 Bacteria 698
70 Ga0070712_101522142 3300006175 Bacteria 585
71 Ga0075362_10024023 3300006177 Bacteria 2583
72 Ga0075369_10246622 3300006186 Bacteria 829
73 Ga0075428_101566374 3300006844 Bacteria 689
74 Ga0075428_102517401 3300006844 Bacteria 527
75 Ga0075430_100113394 3300006846 Bacteria 2260
76 Ga0075430_101732170 3300006846 Bacteria 513
77 Ga0075431_101124326 3300006847 Bacteria 750
78 Ga0075433_11813264 3300006852 Bacteria 524
79 Ga0075429_100884695 3300006880 Bacteria 782
80 Ga0068865_101217512 3300006881 Bacteria 667
81 Ga0068865_102154367 3300006881 Bacteria 507
82 Ga0075436_100236393 3300006914 Bacteria 1298
83 Ga0097620_100345594 3300006931 Bacteria 1582
84 Ga0097620_102628468 3300006931 Bacteria 554
85 Ga0075435_101883187 3300007076 Bacteria 525
86 Ga0105251_10092859 3300009011 Bacteria 1385
87 Ga0105240_11056049 3300009093 Bacteria 866
88 Ga0111539_11099126 3300009094 Bacteria 924
89 Ga0111539_11154483 3300009094 Bacteria 900
90 Ga0105245_10424165 3300009098 Bacteria 1334
91 Ga0105245_10558041 3300009098 Bacteria 1168
92 Ga0105245_10741826 3300009098 Bacteria 1017
93 Ga0105245_12755528 3300009098 Bacteria 544
94 Ga0105247_10086273 3300009101 Bacteria 1986
95 Ga0114129_11490680 3300009147 Bacteria 832
96 Ga0105243_10042361 3300009148 Bacteria 3564
97 Ga0105243_12665203 3300009148 Bacteria 540
98 Ga0105241_10281168 3300009174 Bacteria 1421
99 Ga0105242_10373337 3300009176 Bacteria 1323
100 Ga0105242_10704425 3300009176 Bacteria 988
101 Ga0105242_12822831 3300009176 Bacteria 536
102 Ga0105248_11626435 3300009177 Bacteria 732
103 Ga0105248_12719086 3300009177 Bacteria 564
104 Ga0105248_13334671 3300009177 Bacteria 510
105 Ga0105239_11075373 3300010375 Bacteria 926
106 Ga0105246_10161700 3300011119 Bacteria 1706
107 Ga0105246_12282501 3300011119 Bacteria 528
108 Ga0157373_11077755 3300013100 Bacteria 602
109 Ga0157371_11352471 3300013102 Bacteria 552
110 Ga0157374_10998617 3300013296 Bacteria 856
111 Ga0157374_11131738 3300013296 Bacteria 803
112 Ga0157378_10081782 3300013297 Bacteria 2920
113 Ga0157378_10853101 3300013297 Bacteria 939
114 Ga0157378_12504366 3300013297 Bacteria 568
115 Ga0157378_12671422 3300013297 Bacteria 552
116 Ga0163162_11429355 3300013306 Bacteria 787
117 Ga0157375_10247308 3300013308 Bacteria 1944
118 Ga0157375_11070237 3300013308 Bacteria 943
119 Ga0157375_11149918 3300013308 Bacteria 909
120 Ga0157375_13332162 3300013308 Bacteria 535
121 Ga0163163_10078303 3300014325 Bacteria 3302
122 Ga0163163_10656378 3300014325 Bacteria 1112
123 Ga0157380_10772831 3300014326 Bacteria 974
124 Ga0157380_12861137 3300014326 Bacteria 549
125 Ga0182008_10382625 3300014497 Bacteria 752
126 Ga0157379_10072453 3300014968 Bacteria 3082
127 Ga0157379_11975441 3300014968 Bacteria 576
128 Ga0157376_10394264 3300014969 Bacteria 1337
129 Ga0157376_10536127 3300014969 Bacteria 1156
130 Ga0157376_12643938 3300014969 Bacteria 542
131 Ga0207710_10145807 3300025900 Bacteria 1146
132 Ga0207693_10220358 3300025915 Bacteria 1491
133 Ga0207693_10643497 3300025915 Bacteria 824
134 Ga0207663_10048561 3300025916 Bacteria 2628
135 Ga0207663_10273516 3300025916 Bacteria 1252
136 Ga0207662_10513288 3300025918 Bacteria 826
137 Ga0207662_10955711 3300025918 Bacteria 608
138 Ga0207657_10899360 3300025919 Bacteria 682
139 Ga0207687_10603584 3300025927 Bacteria 925
140 Ga0207687_11872845 3300025927 Bacteria 513
141 Ga0207700_10479635 3300025928 Bacteria 1099
142 Ga0207700_10904714 3300025928 Bacteria 790
143 Ga0207664_10798991 3300025929 Bacteria 849
144 Ga0207664_11380463 3300025929 Bacteria 625
145 Ga0207690_11359742 3300025932 Bacteria 594
146 Ga0207669_11410194 3300025937 Bacteria 593
147 Ga0207679_11087877 3300025945 Bacteria 733
148 Ga0207712_10030603 3300025961 Bacteria 3620
149 Ga0207668_10333786 3300025972 Bacteria 1262
150 Ga0207668_10831832 3300025972 Bacteria 819
151 Ga0207677_11835745 3300026023 Bacteria 563
152 Ga0207703_10077710 3300026035 Bacteria 2756
153 Ga0207703_12277023 3300026035 Bacteria 518
154 Ga0207641_10099449 3300026088 Bacteria 2559
155 Ga0207648_10578739 3300026089 Bacteria 1033
156 Ga0207676_11130365 3300026095 Bacteria 775
157 Ga0207674_10645670 3300026116 Bacteria 1022
158 Ga0207675_100662504 3300026118 Bacteria 1050
159 Ga0207683_11400752 3300026121 Bacteria 646
160 Ga0207698_11248867 3300026142 Bacteria 757
161 Ga0268266_10847890 3300028379 Bacteria 883
162 Ga0268265_10769952 3300028380 Bacteria 936
163 Ga0268265_11317130 3300028380 Bacteria 723
164 Ga0268264_10932821 3300028381 Bacteria 872
165 Ga0265318_10224878 3300028577 Bacteria 685
166 Ga0316578_10563741 3300031728 Bacteria 668
167 Ga0307413_10860912 3300031824 Bacteria 767
168 Ga0373930_0000469 3300034816 Bacteria 5443
169 Ga0373928_0002792 3300035084 Bacteria 3370
170 Ga0373932_0000629 3300035112 Bacteria 10701
171 Ga0373953_0204281 3300035117 Bacteria 855
172 Ga0316574_0070670 3300035398 Bacteria 2204
173 Ga0373931_0000003 3300035691 Bacteria 560286
174 Ga0373937_0328235 3300036401 Bacteria 1448
175 Ga0373937_0497801 3300036401 Bacteria 1158
176 Ga0395899_0004680 3300037312 Bacteria 10679
177 Ga0395900_0003432 3300037418 Bacteria 17137
178 Ga0395900_0433723 3300037418 Bacteria 1273
179 Ga0395898_0004731 3300037466 Bacteria 14815
180 Ga0395898_0608690 3300037466 Bacteria 1035
181 Ga0395905_0003848 3300037471 Bacteria 15828
182 Ga0395905_0533886 3300037471 Bacteria 1074
183 Ga0395901_0006624 3300038443 Bacteria 11701
184 Ga0395901_0426002 3300038443 Bacteria 1360
185 Ga0400485_08169 3300038735 Bacteria 55719
186 Ga0400486_03564 3300038742 Bacteria 38786
187 Ga0436365_0217987 3300039437 Bacteria 919
188 Ga0439436_0117633 3300041404 Unclassified 743
189 Ga0439439_0003792 3300041406 Bacteria 3357
190 Ga0439465_0060625 3300041413 Bacteria 1253
191 Ga0451791_0239537 3300041451 Unclassified 576
192 Ga0451802_0458473 3300041460 Bacteria 1006
193 Ga0439431_0011116 3300041997 Bacteria 2052
194 Ga0439433_0004657 3300041999 Bacteria 2948
195 Ga0439442_009559 3300042002 Bacteria 1961
196 Ga0439445_0229520 3300042004 Unclassified 552
197 Ga0439449_0086162 3300042007 Bacteria 1159
198 Ga0439462_0008425 3300042015 Bacteria 2599
199 Ga0439446_0000101 3300042156 Bacteria 14531
200 Ga0439446_0026859 3300042156 Bacteria 1651
201 Ga0439434_0011729 3300042435 Bacteria 2592
202 Ga0439460_0202967 3300042461 Bacteria 676
203 Ga0466957_0869466 3300044842 Bacteria 643
204 Ga0466958_1155116 3300045836 Bacteria 506
205 Ga0495629_0222479 3300046459 Bacteria 1302
206 Ga0495629_0522801 3300046459 Bacteria 798
207 Ga0495629_0983750 3300046459 Bacteria 550
208 Ga0495641_0185447 3300046461 Bacteria 932
209 Ga0495653_0679119 3300046463 Bacteria 627
210 Ga0495582_0615673 3300046473 Bacteria 628
211 Ga0495582_0670402 3300046473 Bacteria 600
212 Ga0495639_0053959 3300046475 Bacteria 1832
213 Ga0495662_0064895 3300046476 Bacteria 1765
214 Ga0495608_0146986 3300046511 Bacteria 1503
215 Ga0495618_0256540 3300046514 Bacteria 1096
216 Ga0495628_1035986 3300046516 Bacteria 563
217 Ga0495630_0341751 3300046517 Bacteria 1145
218 Ga0495630_0671794 3300046517 Bacteria 793
219 Ga0495644_0100347 3300046523 Bacteria 1095
220 Ga0495666_0460797 3300046526 Bacteria 569
221 Ga0495652_0720445 3300046529 Bacteria 670
222 Ga0495652_0771523 3300046529 Bacteria 642
223 Ga0495640_0381294 3300046533 Bacteria 867
224 Ga0495586_0107809 3300046535 Bacteria 1549
225 Ga0495621_0023842 3300046539 Bacteria 2038
226 Ga0495634_0032222 3300046642 Bacteria 3605
227 Ga0495634_0371983 3300046642 Bacteria 853
228 Ga0495634_0444227 3300046642 Bacteria 766
229 Ga0495635_0446288 3300046663 Bacteria 856
230 Ga0495635_0701358 3300046663 Bacteria 656
231 Ga0495588_0742427 3300046674 Bacteria 513
232 Ga0495646_0304758 3300046680 Bacteria 842
233 Ga0495647_0047335 3300046681 Bacteria 1659
234 Ga0495658_0097961 3300046683 Bacteria 1746
235 Ga0495658_0308361 3300046683 Bacteria 1002
236 Ga0495658_0440392 3300046683 Bacteria 832
237 Ga0495658_0735964 3300046683 Bacteria 632
238 Ga0495613_0010649 3300046689 Bacteria 6821
239 Ga0495613_0106612 3300046689 Bacteria 2022
240 Ga0495613_0365544 3300046689 Bacteria 989
241 Ga0495613_0400701 3300046689 Bacteria 936
242 Ga0495624_0699509 3300046690 Bacteria 602
243 Ga0495581_0520805 3300047315 Bacteria 691
244 Ga0495674_0321685 3300047319 Bacteria 1260
245 Ga0495674_1012019 3300047319 Bacteria 636
246 Ga0495676_0456641 3300047321 Bacteria 842
247 Ga0495680_0306553 3300047322 Bacteria 1114
248 Ga0495680_0570654 3300047322 Bacteria 760
249 Ga0495684_0595722 3300047471 Bacteria 746
250 Ga0495593_0613263 3300047673 Bacteria 546
251 Ga0495602_1109821 3300048088 Bacteria 518
252 Ga0496100_0819700 3300048903 Bacteria 729
253 Ga0496101_0002147 3300048904 Bacteria 12041
254 Ga0496102_0052615 3300048905 Bacteria 3711
255 Ga0496102_0125750 3300048905 Bacteria 2396
256 Ga0496102_0391393 3300048905 Bacteria 1307
257 Ga0496103_0041371 3300048906 Bacteria 2833
258 Ga0496103_0126889 3300048906 Bacteria 1627
259 Ga0496104_0026974 3300048907 Bacteria 5310
260 Ga0496104_0177884 3300048907 Bacteria 2037
261 Ga0496104_0267341 3300048907 Bacteria 1622
262 Ga0496105_0032509 3300048908 Bacteria 4281
263 Ga0496105_0105062 3300048908 Bacteria 2331
264 Ga0496105_1247105 3300048908 Bacteria 545
265 Ga0496106_0485032 3300048909 Bacteria 993
266 Ga0496107_0008739 3300048910 Bacteria 7018
267 Ga0496107_0552366 3300048910 Bacteria 853
268 Ga0496107_1071344 3300048910 Bacteria 583
269 Ga0496108_0025977 3300048911 Bacteria 4830
270 Ga0496108_0028937 3300048911 Bacteria 4584
271 Ga0496109_0004037 3300048912 Bacteria 12259
272 Ga0496109_0004660 3300048912 Bacteria 11447
273 Ga0496109_0064123 3300048912 Bacteria 3361
274 Ga0496110_0000526 3300048913 Bacteria 26000
275 Ga0496110_0004643 3300048913 Bacteria 10677
276 Ga0496110_0007876 3300048913 Bacteria 8533
277 Ga0496110_0093866 3300048913 Bacteria 2686
278 Ga0496111_0003639 3300048914 Bacteria 9563
279 Ga0496111_0031524 3300048914 Bacteria 3777
280 Ga0496111_0225643 3300048914 Bacteria 1391
281 Ga0496111_0342001 3300048914 Bacteria 1107
282 Ga0496111_0655514 3300048914 Bacteria 766
283 Ga0496112_0044296 3300048915 Bacteria 4360
284 Ga0496112_0475176 3300048915 Bacteria 1187
285 Ga0496113_0032400 3300048916 Bacteria 3799
286 Ga0496113_0098953 3300048916 Bacteria 2258
287 Ga0496114_0001523 3300048917 Bacteria 17560
288 Ga0496114_0004194 3300048917 Bacteria 11164
289 Ga0496114_0335870 3300048917 Bacteria 1336
290 Ga0496115_0336992 3300048918 Bacteria 1231
291 Ga0496115_0862362 3300048918 Bacteria 701
292 Ga0501031_0727475 3300049568 Bacteria 637
293 Ga0501032_0467103 3300049569 Bacteria 808
294 Ga0501036_1435293 3300049572 Bacteria 559
295 Ga0501040_0485510 3300049576 Bacteria 890
296 Ga0501042_0730937 3300049578 Unclassified 720
297 Ga0501048_0748395 3300049582 Bacteria 702
298 Ga0501048_1012375 3300049582 Bacteria 598
299 Ga0501075_0921858 3300049591 Bacteria 664
300 Ga0501075_0971438 3300049591 Bacteria 645
301 Ga0501075_1378966 3300049591 Bacteria 534
302 Ga0501076_0359609 3300049592 Bacteria 1196
303 Ga0501076_1071241 3300049592 Bacteria 664
304 Ga0501076_1187943 3300049592 Bacteria 628
305 Ga0501077_0288356 3300049593 Bacteria 1045
306 Ga0501077_0458910 3300049593 Bacteria 816
307 Ga0501081_0070498 3300049743 Bacteria 2436
308 Ga0501081_0428247 3300049743 Bacteria 982
309 Ga0501044_0222900 3300049823 Bacteria 1836
310 Ga0501045_0230550 3300049824 Bacteria 1379
311 Ga0501045_1405637 3300049824 Bacteria 507
312 nmdc:mga03683_227442_c1 3300050489 Bacteria 862
313 nmdc:mga00v17_16891_c1 3300050491 Bacteria 4120
314 nmdc:mga0yw44_101312_c1 3300050492 Bacteria 1835
315 nmdc:mga0yw44_275631_c1 3300050492 Bacteria 1123
316 nmdc:mga0yw44_280369_c1 3300050492 Bacteria 1114
317 nmdc:mga0qj67_276018_c1 3300050509 Bacteria 1362
318 nmdc:mga0sz30_251717_c1 3300050516 Bacteria 786
319 Ga0495601_0988126 3300053077 Bacteria 530
320 Ga0495612_0424645 3300053078 Bacteria 606
321 Ga0495619_0626098 3300053085 Bacteria 735
322 Ga0500566_0133530 3300053094 Bacteria 1325
323 Ga0500616_0001847 3300053153 Bacteria 19181
324 Ga0501084_0589782 3300054114 Bacteria 939
325 Ga0501084_0732290 3300054114 Bacteria 833
326 Ga0530510_0557723 3300061734 Bacteria 870
327 Ga0530510_1271580 3300061734 Bacteria 564
328 Ga0111539_13139526
329 Ga0070670_100211244
330 Ga0070677_10939987
331 Ga0068868_102177582
332 Ga0070689_100862942
333 Ga0070687_100789671
334 Ga0070661_100103545
335 Ga0070668_100741880
336 Ga0070668_101407876
337 Ga0070668_102233072
338 Ga0070669_100180100
339 Ga0070669_101902323
340 Ga0070675_101338777
341 Ga0070671_100821676
342 Ga0070671_101266823
343 Ga0070671_101341590
344 Ga0070671_101654206
345 Ga0070674_100325380
346 Ga0070674_100900233
347 Ga0070673_100515657
348 Ga0070659_102035054
349 Ga0070709_10226319
350 Ga0070714_100040425
351 Ga0070714_100924309
352 Ga0070714_102281126
353 Ga0070713_100052533
354 Ga0070713_101207496
355 Ga0070713_102455473
356 Ga0070710_10093163
357 Ga0070711_100065730
358 Ga0070708_101830613
359 Ga0070678_100252766
360 Ga0070678_102204286
361 Ga0070681_11534735
362 Ga0070698_100429551
363 Ga0070699_101390884
364 Ga0070684_100261947
365 Ga0070684_100621691
366 Ga0070684_101480640
367 Ga0070684_101966624
368 Ga0070672_101407724
369 Ga0070695_101760804
370 Ga0070665_100119492
371 Ga0070665_101922629
372 Ga0070664_101012802
373 Ga0068856_101754356
374 Ga0068852_102515522
375 Ga0068859_100345629
376 Ga0068859_102628545
377 Ga0068864_100267340
378 Ga0068864_101016163
379 Ga0068866_11020407
380 Ga0068863_100117658
381 Ga0068863_100258186
382 Ga0068858_100071381
383 Ga0068858_102281287
384 Ga0068860_100672248
385 Ga0068860_101409132
386 Ga0068862_100333043
387 Ga0068862_101144701
388 Ga0081540_1007820
389 Ga0081539_10370301
390 Ga0070717_10021498
391 Ga0075365_10521230
392 Ga0075363_100380311
393 Ga0075364_10017387
394 Ga0070716_100526543
395 Ga0070712_100025686
396 Ga0070712_101074380
397 Ga0070712_101522142
398 Ga0075362_10024023
399 Ga0075369_10246622
400 Ga0075428_101566374
401 Ga0075428_102517401
402 Ga0075430_100113394
403 Ga0075430_101732170
404 Ga0075431_101124326
405 Ga0075433_11813264
406 Ga0075429_100884695
407 Ga0068865_101217512
408 Ga0068865_102154367
409 Ga0075436_100236393
410 Ga0097620_100345594
411 Ga0097620_102628468
412 Ga0075435_101883187
413 Ga0105251_10092859
414 Ga0105240_11056049
415 Ga0111539_11099126
416 Ga0111539_11154483
417 Ga0105245_10424165
418 Ga0105245_10558041
419 Ga0105245_10741826
420 Ga0105245_12755528
421 Ga0105247_10086273
422 Ga0114129_11490680
423 Ga0105243_10042361
424 Ga0105243_12665203
425 Ga0105241_10281168
426 Ga0105242_10373337
427 Ga0105242_10704425
428 Ga0105242_12822831
429 Ga0105248_11626435
430 Ga0105248_12719086
431 Ga0105248_13334671
432 Ga0105239_11075373
433 Ga0105246_10161700
434 Ga0105246_12282501
435 Ga0157373_11077755
436 Ga0157371_11352471
437 Ga0157374_10998617
438 Ga0157374_11131738
439 Ga0157378_10081782
440 Ga0157378_10853101
441 Ga0157378_12504366
442 Ga0157378_12671422
443 Ga0163162_11429355
444 Ga0157375_10247308
445 Ga0157375_11070237
446 Ga0157375_11149918
447 Ga0157375_13332162
448 Ga0163163_10078303
449 Ga0163163_10656378
450 Ga0157380_10772831
451 Ga0157380_12861137
452 Ga0182008_10382625
453 Ga0157379_10072453
454 Ga0157379_11975441
455 Ga0157376_10394264
456 Ga0157376_10536127
457 Ga0157376_12643938
458 Ga0207710_10145807
459 Ga0207693_10220358
460 Ga0207693_10643497
461 Ga0207663_10048561
462 Ga0207663_10273516
463 Ga0207662_10513288
464 Ga0207662_10955711
465 Ga0207657_10899360
466 Ga0207687_10603584
467 Ga0207687_11872845
468 Ga0207700_10479635
469 Ga0207700_10904714
470 Ga0207664_10798991
471 Ga0207664_11380463
472 Ga0207690_11359742
473 Ga0207669_11410194
474 Ga0207679_11087877
475 Ga0207712_10030603
476 Ga0207668_10333786
477 Ga0207668_10831832
478 Ga0207677_11835745
479 Ga0207703_10077710
480 Ga0207703_12277023
481 Ga0207641_10099449
482 Ga0207648_10578739
483 Ga0207676_11130365
484 Ga0207674_10645670
485 Ga0207675_100662504
486 Ga0207683_11400752
487 Ga0207698_11248867
488 Ga0268266_10847890
489 Ga0268265_10769952
490 Ga0268265_11317130
491 Ga0268264_10932821
492 Ga0265318_10224878
493 Ga0316578_10563741
494 Ga0307413_10860912
495 Ga0373930_0000469
496 Ga0373928_0002792
497 Ga0373932_0000629
498 Ga0373953_0204281
499 Ga0316574_0070670
500 Ga0373931_0000003
501 Ga0373937_0328235
502 Ga0373937_0497801
503 Ga0395899_0004680
504 Ga0395900_0003432
505 Ga0395900_0433723
506 Ga0395898_0004731
507 Ga0395898_0608690
508 Ga0395905_0003848
509 Ga0395905_0533886
510 Ga0395901_0006624
511 Ga0395901_0426002
512 Ga0400485_08169
513 Ga0400486_03564
514 Ga0436365_0217987
515 Ga0439436_0117633
516 Ga0439439_0003792
517 Ga0439465_0060625
518 Ga0451791_0239537
519 Ga0451802_0458473
520 Ga0439431_0011116
521 Ga0439433_0004657
522 Ga0439442_009559
523 Ga0439445_0229520
524 Ga0439449_0086162
525 Ga0439462_0008425
526 Ga0439446_0000101
527 Ga0439446_0026859
528 Ga0439434_0011729
529 Ga0439460_0202967
530 Ga0466957_0869466
531 Ga0466958_1155116
532 Ga0495629_0222479
533 Ga0495629_0522801
534 Ga0495629_0983750
535 Ga0495641_0185447
536 Ga0495653_0679119
537 Ga0495582_0615673
538 Ga0495582_0670402
539 Ga0495639_0053959
540 Ga0495662_0064895
541 Ga0495608_0146986
542 Ga0495618_0256540
543 Ga0495628_1035986
544 Ga0495630_0341751
545 Ga0495630_0671794
546 Ga0495644_0100347
547 Ga0495666_0460797
548 Ga0495652_0720445
549 Ga0495652_0771523
550 Ga0495640_0381294
551 Ga0495586_0107809
552 Ga0495621_0023842
553 Ga0495634_0032222
554 Ga0495634_0371983
555 Ga0495634_0444227
556 Ga0495635_0446288
557 Ga0495635_0701358
558 Ga0495588_0742427
559 Ga0495646_0304758
560 Ga0495647_0047335
561 Ga0495658_0097961
562 Ga0495658_0308361
563 Ga0495658_0440392
564 Ga0495658_0735964
565 Ga0495613_0010649
566 Ga0495613_0106612
567 Ga0495613_0365544
568 Ga0495613_0400701
569 Ga0495624_0699509
570 Ga0495581_0520805
571 Ga0495674_0321685
572 Ga0495674_1012019
573 Ga0495676_0456641
574 Ga0495680_0306553
575 Ga0495680_0570654
576 Ga0495684_0595722
577 Ga0495593_0613263
578 Ga0495602_1109821
579 Ga0496100_0819700
580 Ga0496101_0002147
581 Ga0496102_0052615
582 Ga0496102_0125750
583 Ga0496102_0391393
584 Ga0496103_0041371
585 Ga0496103_0126889
586 Ga0496104_0026974
587 Ga0496104_0177884
588 Ga0496104_0267341
589 Ga0496105_0032509
590 Ga0496105_0105062
591 Ga0496105_1247105
592 Ga0496106_0485032
593 Ga0496107_0008739
594 Ga0496107_0552366
595 Ga0496107_1071344
596 Ga0496108_0025977
597 Ga0496108_0028937
598 Ga0496109_0004037
599 Ga0496109_0004660
600 Ga0496109_0064123
601 Ga0496110_0000526
602 Ga0496110_0004643
603 Ga0496110_0007876
604 Ga0496110_0093866
605 Ga0496111_0003639
606 Ga0496111_0031524
607 Ga0496111_0225643
608 Ga0496111_0342001
609 Ga0496111_0655514
610 Ga0496112_0044296
611 Ga0496112_0475176
612 Ga0496113_0032400
613 Ga0496113_0098953
614 Ga0496114_0001523
615 Ga0496114_0004194
616 Ga0496114_0335870
617 Ga0496115_0336992
618 Ga0496115_0862362
619 Ga0501031_0727475
620 Ga0501032_0467103
621 Ga0501036_1435293
622 Ga0501040_0485510
623 Ga0501042_0730937
624 Ga0501048_0748395
625 Ga0501048_1012375
626 Ga0501075_0921858
627 Ga0501075_0971438
628 Ga0501075_1378966
629 Ga0501076_0359609
630 Ga0501076_1071241
631 Ga0501076_1187943
632 Ga0501077_0288356
633 Ga0501077_0458910
634 Ga0501081_0070498
635 Ga0501081_0428247
636 Ga0501044_0222900
637 Ga0501045_0230550
638 Ga0501045_1405637
639 nmdc:mga03683_227442_c1
640 nmdc:mga00v17_16891_c1
641 nmdc:mga0yw44_101312_c1
642 nmdc:mga0yw44_275631_c1
643 nmdc:mga0yw44_280369_c1
644 nmdc:mga0qj67_276018_c1
645 nmdc:mga0sz30_251717_c1
646 Ga0495601_0988126
647 Ga0495612_0424645
648 Ga0495619_0626098
649 Ga0500566_0133530
650 Ga0500616_0001847
651 Ga0501084_0589782
652 Ga0501084_0732290
653 Ga0530510_0557723
654 Ga0530510_1271580

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00327

Ribosomal_L30

Ribosomal protein L30p/L7e

10

60

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
7msh-assembly1.cif.gz_Z mtb 70sic in complex with mtbetta at pre_r1 state 0.9594 3 57
8cvm-assembly1.cif.gz_y cutibacterium acnes 50s ribosomal subunit with p-site trna and sarecycline bound in the local refined map 0.9508 1 57
5xym-assembly1.cif.gz_Z large subunit of mycobacterium smegmatis 0.9464 3 59
4v6a-assembly1.cif.gz_B3 structure of ef-p bound to the 70s ribosome. 0.9402 3 57
6ywy-assembly1.cif.gz_U the structure of the mitoribosome from neurospora crassa with bound trna at the p-site 0.9396 3 59
ID Description Score Start End Superfamily
af_P9WHA3_1_65_3.30.1390.20 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7 0.9643 1 59 3.30.1390.20
af_P9WHA3_1_65_3.30.1390.20 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7 0.9487 1 59 3.30.1390.20
af_Q54GH8_53_110_3.30.1390.20 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7 0.9422 4 59 3.30.1390.20
3i8iX00 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7 0.9415 3 57 3.30.1390.20
af_B6SIL2_19_102_3.30.1390.20 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7 0.9368 3 57 3.30.1390.20
ID Description Score Start End GO Terms
AF-Q0BUN2-F1-model_v4 Large ribosomal subunit protein uL30 (50S ribosomal protein L30) 0.9676 1 59 GO:0003735
GO:0006412
GO:0022625
AF-B0RB56-F1-model_v4 Large ribosomal subunit protein uL30 (50S ribosomal protein L30) 0.9676 1 59 GO:0003735
GO:0006412
GO:0022625
AF-Q18CH8-F1-model_v4 Large ribosomal subunit protein uL30 (50S ribosomal protein L30) 0.9671 1 59 GO:0003735
GO:0006412
GO:0022625
AF-B1HMW2-F1-model_v4 Large ribosomal subunit protein uL30 (50S ribosomal protein L30) 0.9671 2 59 GO:0003735
GO:0006412
GO:0022625
AF-B3EP43-F1-model_v4 Large ribosomal subunit protein uL30 (50S ribosomal protein L30) 0.9666 2 59 GO:0003735
GO:0006412
GO:0022625

Map