F408581

General Info

Members Datasets Scaffolds Average Seq Length
326 259 652 135

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2936046547|2936050625
Length 157
Sequence DLSCRSGFMSIFSIATSGLSAASLRVNVAASNIANIRTTGPLPASGGSSTSASAVSSSISPTFPAAYVPLRVDQVDQSSGSTPGGTFTTVSAVSPSFTAQSDPSAPFANQDGLVAAPNVDLASEFVQLATAKYSFIANAKVIQAYSETTESLLDITT

Samples

Sample ID Description Type Environment
1 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
2 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
6 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
13 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
18 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
19 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
20 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
21 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
23 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
24 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
25 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
26 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
27 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
28 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
29 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
30 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
33 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
34 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
35 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
36 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
37 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
40 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
41 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
42 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
43 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
44 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
47 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
49 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
50 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
51 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
77 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
78 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
79 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
80 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
81 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
82 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
83 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
84 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
85 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
86 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
87 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
88 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
89 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
90 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
91 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
92 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
93 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
94 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
95 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
96 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
97 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
98 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
99 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
100 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
101 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
102 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
103 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
104 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
105 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
106 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
107 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
108 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
109 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
110 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
111 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
112 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
113 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
114 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
115 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
116 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
117 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
118 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
119 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
120 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
121 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
122 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
123 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
124 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
125 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
126 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
127 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
128 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
129 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
130 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
131 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
132 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
133 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
134 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
135 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
136 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
137 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
138 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
139 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
140 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
141 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
142 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
143 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
144 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
145 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
146 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
147 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
148 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
149 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
150 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
151 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
152 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
153 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
154 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
155 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
156 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
157 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
158 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
159 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
160 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
161 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
162 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
163 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
164 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
165 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
166 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
167 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
168 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
169 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
170 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
171 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
172 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
173 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
174 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
175 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
176 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
177 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
178 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
179 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
180 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
181 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
182 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
183 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
184 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
185 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
186 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
187 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
188 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
189 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
190 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
191 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
192 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
193 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
194 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
195 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
196 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
197 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
198 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
199 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
200 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
201 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
202 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
203 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
204 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
205 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
206 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
207 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
208 2922368715
209 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
210 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
211 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
212 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
213 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
214 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
215 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
216 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
217 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
218 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
219 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
220 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
221 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
222 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
223 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
224 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
225 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
226 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
227 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
228 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
229 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
230 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
231 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
232 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
233 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
234 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
235 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
236 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
237 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
238 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
239 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
240 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
241 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
242 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
243 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
244 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
245 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
246 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
247 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
248 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
249 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
250 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
251 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
252 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
253 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
254 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
255 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
256 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
257 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
258 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
259 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 75.08
Metatranscriptomes 0
Isolates 24.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.42
Nodule 20.25
Rhizoplane 6.13
Rhizosphere 43.25
Stem 0
Stem Tuber 0
Unclassified 1.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10046410 3300001989 Bacteria 1422
2 JGI25165J46597_1039685 3300003214 Bacteria 604
3 rootH2_10045223 3300003320 Bacteria 3943
4 JGI25160J50197_1000826 3300003354 Bacteria 16549
5 Ga0055539_1007482 3300003752 Bacteria 1381
6 Ga0055543_1009602 3300004625 Bacteria 2071
7 Ga0065165_1000953 3300005262 Bacteria 36442
8 Ga0070668_100265607 3300005347 Bacteria 1428
9 Ga0070667_100246364 3300005367 Bacteria 1597
10 Ga0070713_100703867 3300005436 Bacteria 964
11 Ga0070663_100719561 3300005455 Bacteria 850
12 Ga0070662_100289921 3300005457 Bacteria 1327
13 Ga0068853_100167214 3300005539 Bacteria 1988
14 Ga0070665_100035744 3300005548 Bacteria 4997
15 Ga0070665_100491268 3300005548 Bacteria 1238
16 Ga0068854_100015559 3300005578 Bacteria 5043
17 Ga0068856_100000140 3300005614 Bacteria 73194
18 Ga0068856_100167744 3300005614 Bacteria 2207
19 Ga0068856_100750601 3300005614 Bacteria 996
20 Ga0068863_100282016 3300005841 Bacteria 1610
21 Ga0068863_100893603 3300005841 Bacteria 888
22 Ga0068863_100927042 3300005841 Bacteria 872
23 Ga0068858_100570802 3300005842 Bacteria 1096
24 Ga0068858_100900807 3300005842 Bacteria 865
25 Ga0068860_101427839 3300005843 Bacteria 713
26 Ga0068862_100479902 3300005844 Bacteria 1177
27 Ga0081455_10175502 3300005937 Bacteria 1627
28 Ga0081540_1325273 3300005983 Bacteria 527
29 Ga0070717_10031720 3300006028 Bacteria 4254
30 Ga0070717_10195626 3300006028 Bacteria 1768
31 Ga0075365_10066548 3300006038 Bacteria 2418
32 Ga0070715_10064846 3300006163 Bacteria 1615
33 Ga0070716_100600712 3300006173 Bacteria 827
34 Ga0075362_10062220 3300006177 Bacteria 1690
35 Ga0075367_10421959 3300006178 Bacteria 844
36 Ga0075367_10583954 3300006178 Unclassified 710
37 Ga0075369_10048036 3300006186 Bacteria 1841
38 Ga0075369_10232982 3300006186 Bacteria 853
39 Ga0075366_10029098 3300006195 Bacteria 3244
40 Ga0105240_12539849 3300009093 Unclassified 530
41 Ga0105245_10130892 3300009098 Bacteria 2353
42 Ga0105247_10024405 3300009101 Bacteria 3643
43 Ga0105243_10155114 3300009148 Bacteria 1968
44 Ga0105243_10622013 3300009148 Bacteria 1042
45 Ga0105241_10260767 3300009174 Bacteria 1473
46 Ga0105241_10412178 3300009174 Bacteria 1187
47 Ga0105237_10063081 3300009545 Bacteria 3704
48 Ga0105237_10242388 3300009545 Bacteria 1804
49 Ga0105237_10749015 3300009545 Bacteria 983
50 Ga0105238_10111882 3300009551 Bacteria 2710
51 Ga0105238_12475755 3300009551 Bacteria 555
52 Ga0105239_10033656 3300010375 Bacteria 5627
53 Ga0105239_10044650 3300010375 Bacteria 4858
54 Ga0105239_10098601 3300010375 Bacteria 3230
55 Ga0105239_10816426 3300010375 Bacteria 1069
56 Ga0105239_10946495 3300010375 Bacteria 989
57 Ga0105239_11360907 3300010375 Bacteria 819
58 Ga0105239_13185426 3300010375 Bacteria 534
59 Ga0105246_10033496 3300011119 Bacteria 3416
60 Ga0157374_10271308 3300013296 Bacteria 1673
61 Ga0163162_10768581 3300013306 Bacteria 1082
62 Ga0163163_10210272 3300014325 Bacteria 1994
63 Ga0157376_10113792 3300014969 Bacteria 2386
64 Ga0209677_101250 3300025253 Bacteria 11450
65 Ga0209148_1000926 3300025254 Bacteria 19432
66 Ga0209233_1001020 3300025261 Bacteria 11938
67 Ga0209233_1006216 3300025261 Bacteria 3870
68 Ga0209233_1013602 3300025261 Bacteria 2320
69 Ga0209233_1021999 3300025261 Bacteria 1639
70 Ga0209455_1001120 3300025272 Bacteria 13049
71 Ga0209455_1016295 3300025272 Bacteria 1601
72 Ga0209564_1008066 3300025295 Bacteria 5275
73 Ga0209256_1010850 3300025299 Bacteria 3745
74 Ga0207426_1000402 3300025302 Bacteria 72738
75 Ga0207426_1025216 3300025302 Bacteria 2006
76 Ga0207710_10079977 3300025900 Bacteria 1515
77 Ga0207688_10153413 3300025901 Bacteria 1362
78 Ga0207647_10005399 3300025904 Bacteria 9383
79 Ga0207647_10392656 3300025904 Bacteria 782
80 Ga0207654_10157187 3300025911 Bacteria 1465
81 Ga0207695_11610273 3300025913 Unclassified 530
82 Ga0207671_10427533 3300025914 Bacteria 1054
83 Ga0207663_10719334 3300025916 Bacteria 791
84 Ga0207657_10567834 3300025919 Bacteria 886
85 Ga0207694_10146545 3300025924 Bacteria 1900
86 Ga0207687_10175260 3300025927 Bacteria 1657
87 Ga0207700_10120913 3300025928 Bacteria 2123
88 Ga0207664_10156205 3300025929 Bacteria 1942
89 Ga0207644_10239031 3300025931 Bacteria 1445
90 Ga0207709_10129403 3300025935 Bacteria 1718
91 Ga0207709_10144804 3300025935 Bacteria 1638
92 Ga0207665_10014306 3300025939 Bacteria 5225
93 Ga0207668_10118642 3300025972 Bacteria 1999
94 Ga0207640_10061083 3300025981 Bacteria 2494
95 Ga0207658_10372775 3300025986 Bacteria 1248
96 Ga0207703_10995330 3300026035 Bacteria 804
97 Ga0207678_10304303 3300026067 Bacteria 1370
98 Ga0207678_10373522 3300026067 Bacteria 1232
99 Ga0207702_10001307 3300026078 Bacteria 24962
100 Ga0207702_10432793 3300026078 Bacteria 1274
101 Ga0207676_10179752 3300026095 Bacteria 1851
102 Ga0207674_10374277 3300026116 Bacteria 1377
103 Ga0268266_10030476 3300028379 Bacteria 4583
104 Ga0268266_10075409 3300028379 Bacteria 2930
105 Ga0268265_10876304 3300028380 Bacteria 880
106 Ga0265326_10028820 3300028558 Bacteria 1581
107 Ga0265334_10003042 3300028573 Bacteria 7661
108 Ga0265318_10036770 3300028577 Bacteria 1877
109 Ga0265323_10000803 3300028653 Bacteria 16860
110 Ga0307517_10139628 3300028786 Bacteria 1707
111 Ga0265338_10000076 3300028800 Bacteria 180204
112 Ga0265324_10002044 3300029957 Bacteria 10728
113 Ga0265330_10108712 3300031235 Bacteria 1185
114 Ga0265332_10000829 3300031238 Bacteria 18750
115 Ga0265328_10095937 3300031239 Bacteria 1096
116 Ga0265320_10409244 3300031240 Unclassified 599
117 Ga0265329_10021709 3300031242 Bacteria 2154
118 Ga0265329_10254748 3300031242 Bacteria 586
119 Ga0265340_10002136 3300031247 Bacteria 11335
120 Ga0265340_10003251 3300031247 Bacteria 9214
121 Ga0265339_10001400 3300031249 Bacteria 17941
122 Ga0265331_10048949 3300031250 Bacteria 2031
123 Ga0265316_10301104 3300031344 Bacteria 1168
124 Ga0265314_10007950 3300031711 Bacteria 9148
125 Ga0265314_10043085 3300031711 Bacteria 3212
126 Ga0265342_10000035 3300031712 Bacteria 142886
127 Ga0265342_10070451 3300031712 Bacteria 2040
128 Ga0307510_10028089 3300033180 Bacteria 6430
129 Ga0436365_0037330 3300039437 Bacteria 1958
130 Ga0436363_0942757 3300039450 Bacteria 673
131 Ga0466957_0016448 3300044842 Bacteria 4328
132 Ga0466957_0153020 3300044842 Bacteria 1493
133 Ga0466960_0464988 3300044901 Bacteria 737
134 Ga0495617_275366 3300046452 Bacteria 516
135 Ga0495641_0521586 3300046461 Bacteria 542
136 Ga0495651_0024115 3300046462 Bacteria 4733
137 Ga0495650_0041304 3300046471 Bacteria 1974
138 Ga0495605_0147426 3300046474 Bacteria 1052
139 Ga0495662_0492580 3300046476 Bacteria 601
140 Ga0495664_0007739 3300046477 Bacteria 5980
141 Ga0495606_0124731 3300046507 Bacteria 1537
142 Ga0495608_0013512 3300046511 Bacteria 5663
143 Ga0495630_0236053 3300046517 Bacteria 1397
144 Ga0495632_0132210 3300046519 Bacteria 1161
145 Ga0495643_0032084 3300046522 Bacteria 2918
146 Ga0495648_0338620 3300046524 Bacteria 691
147 Ga0495652_0116483 3300046529 Bacteria 2139
148 Ga0495640_0054616 3300046533 Bacteria 2735
149 Ga0495645_0013167 3300046543 Bacteria 5847
150 Ga0495622_0050151 3300046557 Bacteria 1937
151 Ga0495668_0087880 3300046616 Bacteria 1704
152 Ga0495668_0829494 3300046616 Bacteria 512
153 Ga0495657_0013584 3300046675 Bacteria 6003
154 Ga0495599_0014558 3300046678 Bacteria 4871
155 Ga0495623_0351026 3300046679 Bacteria 803
156 Ga0495646_0070140 3300046680 Bacteria 2065
157 Ga0495671_0185539 3300046692 Bacteria 1010
158 Ga0495600_0029415 3300046809 Bacteria 3557
159 Ga0495674_0203848 3300047319 Bacteria 1640
160 Ga0495672_0023168 3300047320 Bacteria 4025
161 Ga0495672_0207671 3300047320 Bacteria 975
162 Ga0495680_0010168 3300047322 Bacteria 8408
163 Ga0495687_019525 3300047443 Bacteria 3323
164 Ga0495687_116348 3300047443 Bacteria 973
165 Ga0495675_0042550 3300047444 Bacteria 2894
166 Ga0495686_0034696 3300047472 Bacteria 3248
167 Ga0495602_0008620 3300048088 Bacteria 10648
168 Ga0495626_0239518 3300048091 Bacteria 731
169 Ga0496101_0487556 3300048904 Bacteria 973
170 Ga0496101_0568492 3300048904 Bacteria 896
171 Ga0496102_0465839 3300048905 Bacteria 1184
172 Ga0496103_0118563 3300048906 Bacteria 1685
173 Ga0496105_0151733 3300048908 Bacteria 1904
174 Ga0496105_0460408 3300048908 Bacteria 1003
175 Ga0496106_0125982 3300048909 Bacteria 2005
176 Ga0496107_0027117 3300048910 Bacteria 4067
177 Ga0496107_0740881 3300048910 Bacteria 721
178 Ga0496108_0092360 3300048911 Bacteria 2573
179 Ga0496108_0670363 3300048911 Bacteria 901
180 Ga0496108_0801030 3300048911 Bacteria 813
181 Ga0496109_0133499 3300048912 Bacteria 2318
182 Ga0496109_0950692 3300048912 Bacteria 797
183 Ga0496110_0369109 3300048913 Bacteria 1308
184 Ga0496111_0203018 3300048914 Bacteria 1473
185 Ga0496112_0173203 3300048915 Bacteria 2123
186 Ga0496112_0556829 3300048915 Bacteria 1080
187 Ga0496113_0068037 3300048916 Bacteria 2702
188 Ga0496115_0858736 3300048918 Bacteria 702
189 Ga0496116_0047438 3300048919 Bacteria 2891
190 Ga0496116_0141835 3300048919 Bacteria 1350
191 Ga0496117_0021779 3300048920 Bacteria 5172
192 Ga0496117_0091208 3300048920 Bacteria 1961
193 Ga0496117_0141185 3300048920 Bacteria 1442
194 Ga0496118_0013455 3300048921 Bacteria 7736
195 Ga0496118_0026513 3300048921 Bacteria 4934
196 Ga0496118_0119668 3300048921 Bacteria 1721
197 Ga0496118_0434436 3300048921 Unclassified 671
198 Ga0496118_0445204 3300048921 Bacteria 659
199 Ga0496119_0025217 3300048922 Bacteria 4158
200 Ga0496119_0058167 3300048922 Bacteria 2331
201 Ga0496119_0117264 3300048922 Bacteria 1468
202 Ga0496120_0036260 3300048923 Bacteria 2937
203 Ga0496121_0023562 3300048924 Bacteria 5922
204 Ga0496121_0039053 3300048924 Bacteria 4191
205 Ga0496121_0216566 3300048924 Bacteria 1352
206 Ga0496121_0369889 3300048924 Bacteria 949
207 Ga0496122_0071801 3300048925 Bacteria 2465
208 Ga0496122_0301040 3300048925 Bacteria 865
209 Ga0496122_0561873 3300048925 Bacteria 541
210 Ga0496123_0383652 3300048926 Bacteria 644
211 Ga0496124_0122757 3300048927 Bacteria 2073
212 Ga0496124_0395436 3300048927 Bacteria 961
213 Ga0496125_0037145 3300048928 Bacteria 4238
214 Ga0496125_0056432 3300048928 Bacteria 3189
215 Ga0496125_0154815 3300048928 Bacteria 1567
216 Ga0496126_0210258 3300048929 Bacteria 1638
217 Ga0496126_0255576 3300048929 Bacteria 1459
218 Ga0496126_0312537 3300048929 Bacteria 1293
219 Ga0496126_0529342 3300048929 Bacteria 938
220 Ga0496126_1420140 3300048929 Bacteria 500
221 Ga0495682_0064374 3300049460 Bacteria 1322
222 nmdc:mga0yw44_216600_c1 3300050492 Bacteria 1268
223 nmdc:mga0k408_42642_c1 3300050493 Bacteria 2613
224 nmdc:mga0sz30_212550_c1 3300050516 Bacteria 860
225 Ga0500635_0042585 3300053080 Bacteria 1523
226 Ga0500578_0572547 3300053086 Bacteria 625
227 Ga0500644_0312849 3300053088 Bacteria 674
228 Ga0500566_0159712 3300053094 Bacteria 1176
229 Ga0500648_382461 3300053097 Bacteria 548
230 Ga0500569_029011 3300053109 Bacteria 1538
231 Ga0500572_002450 3300053111 Bacteria 4464
232 Ga0500607_035736 3300053121 Bacteria 2716
233 Ga0500614_031688 3300053123 Bacteria 1296
234 Ga0500626_035069 3300053128 Bacteria 2267
235 Ga0500642_0000136 3300053130 Bacteria 32674
236 Ga0500658_0106640 3300053134 Bacteria 1229
237 Ga0500590_071995 3300053148 Bacteria 1716
238 Ga0500636_0176101 3300053177 Bacteria 1153
239 Ga0500636_0273357 3300053177 Bacteria 848
240 Ga0500576_108034 3300053725 Bacteria 1121
241 Ga0500625_000999 3300053729 Bacteria 9001
242 Ga0500645_078530 3300053730 Bacteria 943
243 Ga0500609_007715 3300053731 Bacteria 1453
244 Ga0500601_000183 3300053737 Bacteria 12959
245 2936050625 2936046547 Bacteria 8903709
246 2508692443 2508501042 Bacteria 8719808
247 2511399394 2511231028 Bacteria 8046582
248 2513877529 2513237139 Bacteria 8737671
249 2513894498 2513237141 Bacteria 8496279
250 2514009673 2513237161 Bacteria 8871253
251 2617346560 2617270735 Bacteria 9163226
252 2793060873 2791355196 Bacteria 7323613
253 2805918460 2802429603 Bacteria 8777136
254 2818236321 2816332527 Bacteria 8933356
255 2824658239 2824653114 Bacteria 8493680
256 2824665353 2824661429 Bacteria 9877870
257 2824678054 2824671348 Bacteria 8369588
258 2824694468 2824687955 Bacteria 8360029
259 2824699691 2824696289 Bacteria 8335049
260 2824777306 2824773399 Bacteria 8360218
261 2838122903 2838122688 Bacteria 8803140
262 2841944813 2841941048 Bacteria 8688029
263 2841950834 2841949485 Bacteria 8680857
264 2841959953 2841957949 Bacteria 8652217
265 2841973714 2841966195 Bacteria 8673214
266 2841978604 2841974524 Bacteria 8931498
267 2841988970 2841983080 Bacteria 8395090
268 2847947496 2847939898 Bacteria 8606328
269 2857513014 2857509624 Bacteria 7472071
270 2874622323 2874620515 Bacteria 8290088
271 2874635250 2874628541 Bacteria 8630250
272 2881364695 2881364244 Bacteria 7710352
273 2885409782 2885409591 Bacteria 9235467
274 2888393023 2888388044 Bacteria 7304136
275 2922372677
276 2929620490 2929615660 Bacteria 9193770
277 2929626383 2929624759 Bacteria 9339455
278 2932784745 2932784394 Bacteria 9704911
279 2932795379 2932794094 Bacteria 7915132
280 2932809725 2932809354 Bacteria 9135765
281 2932818531 2932818245 Bacteria 9955613
282 2932828528 2932828146 Bacteria 9745859
283 2933582408 2933577622 Bacteria 9116884
284 2935617486 2935616580 Bacteria 9032984
285 2935639032 2935638405 Bacteria 10015038
286 2935652246 2935648319 Bacteria 8801166
287 2935660828 2935656913 Bacteria 8965014
288 2935666116 2935665750 Bacteria 9571747
289 2935675764 2935675223 Bacteria 9928132
290 2935685226 2935684952 Bacteria 9590419
291 2935694916 2935694250 Bacteria 9291695
292 2935704039 2935703347 Bacteria 10242284
293 2935713779 2935713505 Bacteria 9608509
294 2935724398 2935722832 Bacteria 9608746
295 2935733244 2935732158 Bacteria 9706831
296 2935742623 2935741537 Bacteria 9707219
297 2935751191 2935750917 Bacteria 9590372
298 2935760285 2935760218 Bacteria 9817913
299 2935802122 2935801545 Bacteria 9301974
300 2935810945 2935810662 Bacteria 9401221
301 2935828527 2935827899 Bacteria 10038562
302 2935839903 2935837841 Bacteria 9454360
303 2935856111 2935855204 Bacteria 9035059
304 2935865945 2935864058 Bacteria 9784707
305 2935877730 2935873716 Bacteria 9632195
306 2935986713 2935984226 Bacteria 8302647
307 2935992675 2935992306 Bacteria 9802711
308 2936002547 2936002035 Bacteria 9362176
309 2936014884 2936011229 Bacteria 8801034
310 2936022135 2936019824 Bacteria 8804134
311 2936032823 2936028420 Bacteria 8965941
312 2936037636 2936037263 Bacteria 9446081
313 2936059599 2936055302 Bacteria 8785755
314 2940558007 2940556831 Bacteria 9590747
315 2941540757 2941538514 Bacteria 9402094
316 3005600007 3005594810 Bacteria 8716512
317 3005715596 3005710791 Bacteria 7622528
318 8016520978 8016511872 Bacteria 9921665
319 8016639425 8016630954 Bacteria 9217207
320 8017064622 8017057580 Bacteria 10023680
321 8019583988 8019576017 Bacteria 10049540
322 8019591795 8019586578 Bacteria 10212056
323 8019599543 8019597564 Bacteria 10041141
324 8019619003 8019608314 Bacteria 10042931
325 8055745352 8055742211 Bacteria 9226248
326 8056968796 8056967851 Bacteria 9038162
327 JGI24739J22299_10046410
328 JGI25165J46597_1039685
329 rootH2_10045223
330 JGI25160J50197_1000826
331 Ga0055539_1007482
332 Ga0055543_1009602
333 Ga0065165_1000953
334 Ga0070668_100265607
335 Ga0070667_100246364
336 Ga0070713_100703867
337 Ga0070663_100719561
338 Ga0070662_100289921
339 Ga0068853_100167214
340 Ga0070665_100035744
341 Ga0070665_100491268
342 Ga0068854_100015559
343 Ga0068856_100000140
344 Ga0068856_100167744
345 Ga0068856_100750601
346 Ga0068863_100282016
347 Ga0068863_100893603
348 Ga0068863_100927042
349 Ga0068858_100570802
350 Ga0068858_100900807
351 Ga0068860_101427839
352 Ga0068862_100479902
353 Ga0081455_10175502
354 Ga0081540_1325273
355 Ga0070717_10031720
356 Ga0070717_10195626
357 Ga0075365_10066548
358 Ga0070715_10064846
359 Ga0070716_100600712
360 Ga0075362_10062220
361 Ga0075367_10421959
362 Ga0075367_10583954
363 Ga0075369_10048036
364 Ga0075369_10232982
365 Ga0075366_10029098
366 Ga0105240_12539849
367 Ga0105245_10130892
368 Ga0105247_10024405
369 Ga0105243_10155114
370 Ga0105243_10622013
371 Ga0105241_10260767
372 Ga0105241_10412178
373 Ga0105237_10063081
374 Ga0105237_10242388
375 Ga0105237_10749015
376 Ga0105238_10111882
377 Ga0105238_12475755
378 Ga0105239_10033656
379 Ga0105239_10044650
380 Ga0105239_10098601
381 Ga0105239_10816426
382 Ga0105239_10946495
383 Ga0105239_11360907
384 Ga0105239_13185426
385 Ga0105246_10033496
386 Ga0157374_10271308
387 Ga0163162_10768581
388 Ga0163163_10210272
389 Ga0157376_10113792
390 Ga0209677_101250
391 Ga0209148_1000926
392 Ga0209233_1001020
393 Ga0209233_1006216
394 Ga0209233_1013602
395 Ga0209233_1021999
396 Ga0209455_1001120
397 Ga0209455_1016295
398 Ga0209564_1008066
399 Ga0209256_1010850
400 Ga0207426_1000402
401 Ga0207426_1025216
402 Ga0207710_10079977
403 Ga0207688_10153413
404 Ga0207647_10005399
405 Ga0207647_10392656
406 Ga0207654_10157187
407 Ga0207695_11610273
408 Ga0207671_10427533
409 Ga0207663_10719334
410 Ga0207657_10567834
411 Ga0207694_10146545
412 Ga0207687_10175260
413 Ga0207700_10120913
414 Ga0207664_10156205
415 Ga0207644_10239031
416 Ga0207709_10129403
417 Ga0207709_10144804
418 Ga0207665_10014306
419 Ga0207668_10118642
420 Ga0207640_10061083
421 Ga0207658_10372775
422 Ga0207703_10995330
423 Ga0207678_10304303
424 Ga0207678_10373522
425 Ga0207702_10001307
426 Ga0207702_10432793
427 Ga0207676_10179752
428 Ga0207674_10374277
429 Ga0268266_10030476
430 Ga0268266_10075409
431 Ga0268265_10876304
432 Ga0265326_10028820
433 Ga0265334_10003042
434 Ga0265318_10036770
435 Ga0265323_10000803
436 Ga0307517_10139628
437 Ga0265338_10000076
438 Ga0265324_10002044
439 Ga0265330_10108712
440 Ga0265332_10000829
441 Ga0265328_10095937
442 Ga0265320_10409244
443 Ga0265329_10021709
444 Ga0265329_10254748
445 Ga0265340_10002136
446 Ga0265340_10003251
447 Ga0265339_10001400
448 Ga0265331_10048949
449 Ga0265316_10301104
450 Ga0265314_10007950
451 Ga0265314_10043085
452 Ga0265342_10000035
453 Ga0265342_10070451
454 Ga0307510_10028089
455 Ga0436365_0037330
456 Ga0436363_0942757
457 Ga0466957_0016448
458 Ga0466957_0153020
459 Ga0466960_0464988
460 Ga0495617_275366
461 Ga0495641_0521586
462 Ga0495651_0024115
463 Ga0495650_0041304
464 Ga0495605_0147426
465 Ga0495662_0492580
466 Ga0495664_0007739
467 Ga0495606_0124731
468 Ga0495608_0013512
469 Ga0495630_0236053
470 Ga0495632_0132210
471 Ga0495643_0032084
472 Ga0495648_0338620
473 Ga0495652_0116483
474 Ga0495640_0054616
475 Ga0495645_0013167
476 Ga0495622_0050151
477 Ga0495668_0087880
478 Ga0495668_0829494
479 Ga0495657_0013584
480 Ga0495599_0014558
481 Ga0495623_0351026
482 Ga0495646_0070140
483 Ga0495671_0185539
484 Ga0495600_0029415
485 Ga0495674_0203848
486 Ga0495672_0023168
487 Ga0495672_0207671
488 Ga0495680_0010168
489 Ga0495687_019525
490 Ga0495687_116348
491 Ga0495675_0042550
492 Ga0495686_0034696
493 Ga0495602_0008620
494 Ga0495626_0239518
495 Ga0496101_0487556
496 Ga0496101_0568492
497 Ga0496102_0465839
498 Ga0496103_0118563
499 Ga0496105_0151733
500 Ga0496105_0460408
501 Ga0496106_0125982
502 Ga0496107_0027117
503 Ga0496107_0740881
504 Ga0496108_0092360
505 Ga0496108_0670363
506 Ga0496108_0801030
507 Ga0496109_0133499
508 Ga0496109_0950692
509 Ga0496110_0369109
510 Ga0496111_0203018
511 Ga0496112_0173203
512 Ga0496112_0556829
513 Ga0496113_0068037
514 Ga0496115_0858736
515 Ga0496116_0047438
516 Ga0496116_0141835
517 Ga0496117_0021779
518 Ga0496117_0091208
519 Ga0496117_0141185
520 Ga0496118_0013455
521 Ga0496118_0026513
522 Ga0496118_0119668
523 Ga0496118_0434436
524 Ga0496118_0445204
525 Ga0496119_0025217
526 Ga0496119_0058167
527 Ga0496119_0117264
528 Ga0496120_0036260
529 Ga0496121_0023562
530 Ga0496121_0039053
531 Ga0496121_0216566
532 Ga0496121_0369889
533 Ga0496122_0071801
534 Ga0496122_0301040
535 Ga0496122_0561873
536 Ga0496123_0383652
537 Ga0496124_0122757
538 Ga0496124_0395436
539 Ga0496125_0037145
540 Ga0496125_0056432
541 Ga0496125_0154815
542 Ga0496126_0210258
543 Ga0496126_0255576
544 Ga0496126_0312537
545 Ga0496126_0529342
546 Ga0496126_1420140
547 Ga0495682_0064374
548 nmdc:mga0yw44_216600_c1
549 nmdc:mga0k408_42642_c1
550 nmdc:mga0sz30_212550_c1
551 Ga0500635_0042585
552 Ga0500578_0572547
553 Ga0500644_0312849
554 Ga0500566_0159712
555 Ga0500648_382461
556 Ga0500569_029011
557 Ga0500572_002450
558 Ga0500607_035736
559 Ga0500614_031688
560 Ga0500626_035069
561 Ga0500642_0000136
562 Ga0500658_0106640
563 Ga0500590_071995
564 Ga0500636_0176101
565 Ga0500636_0273357
566 Ga0500576_108034
567 Ga0500625_000999
568 Ga0500645_078530
569 Ga0500609_007715
570 Ga0500601_000183
571 2936050625
572 2508692443
573 2511399394
574 2513877529
575 2513894498
576 2514009673
577 2617346560
578 2793060873
579 2805918460
580 2818236321
581 2824658239
582 2824665353
583 2824678054
584 2824694468
585 2824699691
586 2824777306
587 2838122903
588 2841944813
589 2841950834
590 2841959953
591 2841973714
592 2841978604
593 2841988970
594 2847947496
595 2857513014
596 2874622323
597 2874635250
598 2881364695
599 2885409782
600 2888393023
601 2922372677
602 2929620490
603 2929626383
604 2932784745
605 2932795379
606 2932809725
607 2932818531
608 2932828528
609 2933582408
610 2935617486
611 2935639032
612 2935652246
613 2935660828
614 2935666116
615 2935675764
616 2935685226
617 2935694916
618 2935704039
619 2935713779
620 2935724398
621 2935733244
622 2935742623
623 2935751191
624 2935760285
625 2935802122
626 2935810945
627 2935828527
628 2935839903
629 2935856111
630 2935865945
631 2935877730
632 2935986713
633 2935992675
634 2936002547
635 2936014884
636 2936022135
637 2936032823
638 2936037636
639 2936059599
640 2940558007
641 2941540757
642 3005600007
643 3005715596
644 8016520978
645 8016639425
646 8017064622
647 8019583988
648 8019591795
649 8019599543
650 8019619003
651 8055745352
652 8056968796

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00460

Flg_bb_rod

Flagella basal body rod protein

12

41

0.94

PF06429

Flg_bbr_C

Flagellar basal body rod FlgEFG protein C-terminal

110

155

0.93

Map