F408502

General Info

Members Datasets Scaffolds Average Seq Length
326 139 652 428

Family's Representative Sequence

Representative Sequence 3300048910|Ga0496107_0047758|Ga0496107_0047758_1651_3033
Length 460
Sequence LNEPATVALSSAKELSKVFDVKNWILAGAACAAFLATPVPALAAAVAANPELPAPGASVGDQAVSNFYAARSGAPLWLRGGTNGNAASALIGVLQKAPLDGLPSGPAIALQAQSLMARASMGDTAAAEQADRILSNAWIAYVQALQRPPAGMTYADKWVAPRQDTPAQILTKAAAAPSLAAYVRSVSEVNPLYAEIRDTAWSNMQANGGALDPRVLTSLERVRDMPFQKRYIIVDAGGAKLYMIEDGRIADTMKVIVGKADPSTQTPMLASTIYYATLNPYWHVGPDLVRSLIARNVLDQGVGYLKRQGYEVMAADPNDDSLLDPTKVDWHAIAEGRAAVRVRQLPGPANSMGHLKFGFPNADDIYLHDTPVKTAFNSDDRSLSHGCIRLEDAERLGRWLMGRDPEPTSSEPEQHALLPSPVPIFVTYLTAQVQNGQLAFVDDAYGRDAQRLAQIASSSN

Samples

Sample ID Description Type Environment
1 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
55 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
109 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
110 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
111 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
112 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
113 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
114 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
115 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
116 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
117 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
118 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
119 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
120 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
121 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
122 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
123 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
124 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
125 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
126 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
127 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
128 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
129 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
130 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
131 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
132 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
133 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
134 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
135 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
136 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
137 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
138 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
139 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane

Type Distribution

Type Percentage (%)
Metagenomes 98.77
Metatranscriptomes 1.23
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.28
Rhizosphere 91.72
Stem 0
Stem Tuber 0
Unclassified 5.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496107_0047758 3300048910 Bacteria 3083
2 JGI24740J21852_10001875 3300001979 Bacteria 9620
3 Ga0070658_10002304 3300005327 Bacteria 16022
4 Ga0070658_10033502 3300005327 Bacteria 4133
5 Ga0070658_10037796 3300005327 Bacteria 3892
6 Ga0070658_10049902 3300005327 Bacteria 3391
7 Ga0070658_10086663 3300005327 Bacteria 2576
8 Ga0070658_10157708 3300005327 Bacteria 1903
9 Ga0070658_10187270 3300005327 Bacteria 1744
10 Ga0070676_10043040 3300005328 Bacteria 2624
11 Ga0070683_100004703 3300005329 Bacteria 11283
12 Ga0070683_100015584 3300005329 Bacteria 6681
13 Ga0070690_100046876 3300005330 Bacteria 2748
14 Ga0070670_100002510 3300005331 Bacteria 15135
15 Ga0070670_100037586 3300005331 Bacteria 4165
16 Ga0070670_100138366 3300005331 Bacteria 2105
17 Ga0070666_10026827 3300005335 Bacteria 3767
18 Ga0070666_10029857 3300005335 Bacteria 3587
19 Ga0070666_10114975 3300005335 Bacteria 1863
20 Ga0070680_100000845 3300005336 Bacteria 21681
21 Ga0070680_100005107 3300005336 Bacteria 9908
22 Ga0068868_100020420 3300005338 Bacteria 4977
23 Ga0068868_100083585 3300005338 Bacteria 2563
24 Ga0068868_100084202 3300005338 Bacteria 2554
25 Ga0070660_100000292 3300005339 Bacteria 33415
26 Ga0070660_100049801 3300005339 Bacteria 3222
27 Ga0070660_100093092 3300005339 Bacteria 2379
28 Ga0070691_10002168 3300005341 Bacteria 8687
29 Ga0070661_100006185 3300005344 Bacteria 8254
30 Ga0070661_100018274 3300005344 Bacteria 4983
31 Ga0070661_100026691 3300005344 Bacteria 4155
32 Ga0070661_100081843 3300005344 Bacteria 2384
33 Ga0070661_100110892 3300005344 Bacteria 2048
34 Ga0070692_10013695 3300005345 Bacteria 3787
35 Ga0070668_100067683 3300005347 Bacteria 2775
36 Ga0070675_100004628 3300005354 Bacteria 10506
37 Ga0070675_100007402 3300005354 Bacteria 8479
38 Ga0070671_100006556 3300005355 Bacteria 9305
39 Ga0070671_100014510 3300005355 Bacteria 6369
40 Ga0070671_100023911 3300005355 Bacteria 5000
41 Ga0070671_100125946 3300005355 Bacteria 2156
42 Ga0070671_100208238 3300005355 Bacteria 1658
43 Ga0070674_100056611 3300005356 Bacteria 2719
44 Ga0070673_100001667 3300005364 Bacteria 13154
45 Ga0070673_100233393 3300005364 Bacteria 1597
46 Ga0070667_100011561 3300005367 Bacteria 7297
47 Ga0070667_100041659 3300005367 Bacteria 3853
48 Ga0070714_100143610 3300005435 Unclassified 2145
49 Ga0070713_100143299 3300005436 Bacteria 2118
50 Ga0070663_100040446 3300005455 Bacteria 3264
51 Ga0070678_100000987 3300005456 Bacteria 14698
52 Ga0070678_100041601 3300005456 Bacteria 3259
53 Ga0070662_100090292 3300005457 Bacteria 2299
54 Ga0070662_100096857 3300005457 Bacteria 2226
55 Ga0070662_100116155 3300005457 Bacteria 2045
56 Ga0070662_100195602 3300005457 Unclassified 1601
57 Ga0068867_100009333 3300005459 Bacteria 6923
58 Ga0070685_10046639 3300005466 Bacteria 2488
59 Ga0070679_100094201 3300005530 Bacteria 2982
60 Ga0070684_100012821 3300005535 Bacteria 6732
61 Ga0070684_100014486 3300005535 Bacteria 6391
62 Ga0068853_100009560 3300005539 Bacteria 7811
63 Ga0070672_100024997 3300005543 Bacteria 4423
64 Ga0070665_100185308 3300005548 Bacteria 2082
65 Ga0068855_100039819 3300005563 Bacteria 5578
66 Ga0068855_100048748 3300005563 Bacteria 4998
67 Ga0070664_100008604 3300005564 Bacteria 8257
68 Ga0070664_100011231 3300005564 Bacteria 7266
69 Ga0070664_100033341 3300005564 Bacteria 4313
70 Ga0070664_100144448 3300005564 Unclassified 2097
71 Ga0068857_100012685 3300005577 Bacteria 7344
72 Ga0068857_100096294 3300005577 Bacteria 2652
73 Ga0068857_100179197 3300005577 Unclassified 1928
74 Ga0068854_100026494 3300005578 Bacteria 3985
75 Ga0068854_100070006 3300005578 Bacteria 2563
76 Ga0068854_100206753 3300005578 Bacteria 1546
77 Ga0068856_100006584 3300005614 Bacteria 11385
78 Ga0068856_100023360 3300005614 Bacteria 6011
79 Ga0068856_100024493 3300005614 Bacteria 5877
80 Ga0068856_100025985 3300005614 Bacteria 5710
81 Ga0068856_100102292 3300005614 Bacteria 2858
82 Ga0068852_100059983 3300005616 Bacteria 3301
83 Ga0068852_100173943 3300005616 Bacteria 2020
84 Ga0068864_100025368 3300005618 Bacteria 4991
85 Ga0068866_10004106 3300005718 Bacteria 5973
86 Ga0068851_10009341 3300005834 Bacteria 4555
87 Ga0068851_10027708 3300005834 Bacteria 2793
88 Ga0068851_10056070 3300005834 Bacteria 2009
89 Ga0068863_100002157 3300005841 Bacteria 19512
90 Ga0068863_100023477 3300005841 Bacteria 5889
91 Ga0068863_100094646 3300005841 Bacteria 2835
92 Ga0068858_100014265 3300005842 Bacteria 7491
93 Ga0068860_100083891 3300005843 Bacteria 3031
94 Ga0070716_100015876 3300006173 Bacteria 3880
95 Ga0097621_100054953 3300006237 Bacteria 3250
96 Ga0068871_100040442 3300006358 Bacteria 3734
97 Ga0068871_100079062 3300006358 Bacteria 2720
98 Ga0068865_100043548 3300006881 Bacteria 3068
99 Ga0105240_10023904 3300009093 Bacteria 8071
100 Ga0105241_10176134 3300009174 Unclassified 1770
101 Ga0105248_10011320 3300009177 Bacteria 9833
102 Ga0105248_10013082 3300009177 Bacteria 9138
103 Ga0105248_10062780 3300009177 Unclassified 4171
104 Ga0105248_10248824 3300009177 Bacteria 2001
105 Ga0105237_10016756 3300009545 Bacteria 7608
106 Ga0105238_10007178 3300009551 Bacteria 11143
107 Ga0157373_10007336 3300013100 Bacteria 8212
108 Ga0157371_10028780 3300013102 Bacteria 4021
109 Ga0157371_10069903 3300013102 Bacteria 2486
110 Ga0157370_10001517 3300013104 Bacteria 28707
111 Ga0157370_10149046 3300013104 Bacteria 2177
112 Ga0157369_10027713 3300013105 Bacteria 6277
113 Ga0157369_10074764 3300013105 Bacteria 3634
114 Ga0157369_10092264 3300013105 Bacteria 3232
115 Ga0157369_10136020 3300013105 Unclassified 2602
116 Ga0157369_10409895 3300013105 Unclassified 1406
117 Ga0157374_10027685 3300013296 Bacteria 5117
118 Ga0157374_10131573 3300013296 Bacteria 2422
119 Ga0157374_10161391 3300013296 Bacteria 2183
120 Ga0157374_10309103 3300013296 Unclassified 1565
121 Ga0157378_10211663 3300013297 Bacteria 1838
122 Ga0163162_10008683 3300013306 Bacteria 9888
123 Ga0163162_10009005 3300013306 Bacteria 9704
124 Ga0157372_10057693 3300013307 Bacteria 4340
125 Ga0157375_10000628 3300013308 Bacteria 31364
126 Ga0157375_10116219 3300013308 Bacteria 2779
127 Ga0163163_10034277 3300014325 Bacteria 4914
128 Ga0157376_10079923 3300014969 Bacteria 2804
129 Ga0197907_11213749 3300020069 Bacteria 2824
130 Ga0206354_10215528 3300020081 Bacteria 2269
131 Ga0206353_10057996 3300020082 Bacteria 2755
132 Ga0224712_10012684 3300022467 Bacteria 2660
133 Ga0207697_10025863 3300025315 Bacteria 2399
134 Ga0207656_10041783 3300025321 Bacteria 1949
135 Ga0207680_10019252 3300025903 Bacteria 3647
136 Ga0207647_10000910 3300025904 Bacteria 22876
137 Ga0207647_10011650 3300025904 Bacteria 6157
138 Ga0207647_10028198 3300025904 Bacteria 3650
139 Ga0207705_10000853 3300025909 Bacteria 24997
140 Ga0207705_10005390 3300025909 Bacteria 9567
141 Ga0207705_10010078 3300025909 Bacteria 6879
142 Ga0207705_10036885 3300025909 Bacteria 3498
143 Ga0207705_10044089 3300025909 Bacteria 3205
144 Ga0207705_10141462 3300025909 Bacteria 1797
145 Ga0207654_10033488 3300025911 Bacteria 2848
146 Ga0207707_10221351 3300025912 Unclassified 1647
147 Ga0207695_10008918 3300025913 Bacteria 12486
148 Ga0207671_10014919 3300025914 Bacteria 6110
149 Ga0207660_10005166 3300025917 Bacteria 8484
150 Ga0207660_10008617 3300025917 Bacteria 6596
151 Ga0207657_10000962 3300025919 Bacteria 30503
152 Ga0207657_10008076 3300025919 Bacteria 10731
153 Ga0207657_10008417 3300025919 Bacteria 10471
154 Ga0207657_10011178 3300025919 Bacteria 8925
155 Ga0207657_10023815 3300025919 Bacteria 5691
156 Ga0207657_10026586 3300025919 Bacteria 5314
157 Ga0207657_10131243 3300025919 Bacteria 2053
158 Ga0207657_10163344 3300025919 Bacteria 1808
159 Ga0207649_10001843 3300025920 Bacteria 12115
160 Ga0207649_10013365 3300025920 Bacteria 4582
161 Ga0207649_10016979 3300025920 Bacteria 4118
162 Ga0207652_10001100 3300025921 Bacteria 24430
163 Ga0207652_10024222 3300025921 Bacteria 5034
164 Ga0207652_10068224 3300025921 Bacteria 3085
165 Ga0207694_10005672 3300025924 Bacteria 9577
166 Ga0207650_10064947 3300025925 Bacteria 2733
167 Ga0207650_10068439 3300025925 Bacteria 2666
168 Ga0207650_10149879 3300025925 Bacteria 1840
169 Ga0207659_10002145 3300025926 Bacteria 11711
170 Ga0207659_10019314 3300025926 Bacteria 4483
171 Ga0207687_10130629 3300025927 Bacteria 1893
172 Ga0207700_10077854 3300025928 Bacteria 2577
173 Ga0207664_10114391 3300025929 Bacteria 2248
174 Ga0207644_10000855 3300025931 Bacteria 19268
175 Ga0207644_10001600 3300025931 Bacteria 14621
176 Ga0207644_10002701 3300025931 Bacteria 11429
177 Ga0207644_10022674 3300025931 Bacteria 4291
178 Ga0207644_10027870 3300025931 Bacteria 3904
179 Ga0207644_10035225 3300025931 Bacteria 3505
180 Ga0207690_10009048 3300025932 Bacteria 5911
181 Ga0207706_10002689 3300025933 Bacteria 17328
182 Ga0207706_10007263 3300025933 Bacteria 10243
183 Ga0207706_10021130 3300025933 Bacteria 5848
184 Ga0207706_10035222 3300025933 Bacteria 4452
185 Ga0207706_10067143 3300025933 Bacteria 3156
186 Ga0207706_10119799 3300025933 Bacteria 2314
187 Ga0207691_10002012 3300025940 Bacteria 19906
188 Ga0207691_10053296 3300025940 Bacteria 3693
189 Ga0207691_10139450 3300025940 Bacteria 2137
190 Ga0207711_10007239 3300025941 Bacteria 9300
191 Ga0207711_10035460 3300025941 Bacteria 4228
192 Ga0207711_10036119 3300025941 Bacteria 4192
193 Ga0207711_10083628 3300025941 Bacteria 2792
194 Ga0207711_10246091 3300025941 Bacteria 1641
195 Ga0207661_10010193 3300025944 Bacteria 6757
196 Ga0207667_10007822 3300025949 Bacteria 12775
197 Ga0207667_10020852 3300025949 Bacteria 7277
198 Ga0207667_10038631 3300025949 Bacteria 5095
199 Ga0207667_10235892 3300025949 Bacteria 1872
200 Ga0207640_10002781 3300025981 Bacteria 9378
201 Ga0207640_10031862 3300025981 Bacteria 3263
202 Ga0207658_10018554 3300025986 Bacteria 4806
203 Ga0207658_10055552 3300025986 Bacteria 2935
204 Ga0207677_10159366 3300026023 Unclassified 1751
205 Ga0207639_10110370 3300026041 Bacteria 2240
206 Ga0207678_10002194 3300026067 Bacteria 17632
207 Ga0207678_10002497 3300026067 Bacteria 16733
208 Ga0207678_10003065 3300026067 Bacteria 15105
209 Ga0207678_10030788 3300026067 Bacteria 4685
210 Ga0207678_10030970 3300026067 Bacteria 4669
211 Ga0207678_10040692 3300026067 Bacteria 4029
212 Ga0207678_10040809 3300026067 Bacteria 4023
213 Ga0207678_10068838 3300026067 Bacteria 3036
214 Ga0207702_10045792 3300026078 Bacteria 3680
215 Ga0207641_10013972 3300026088 Bacteria 6583
216 Ga0207641_10021792 3300026088 Bacteria 5267
217 Ga0207641_10132539 3300026088 Bacteria 2239
218 Ga0207648_10013485 3300026089 Bacteria 7601
219 Ga0207648_10025715 3300026089 Bacteria 5240
220 Ga0207676_10035078 3300026095 Unclassified 3803
221 Ga0207674_10010668 3300026116 Bacteria 10390
222 Ga0207674_10016662 3300026116 Bacteria 8032
223 Ga0207674_10058176 3300026116 Bacteria 3917
224 Ga0207674_10093911 3300026116 Unclassified 2987
225 Ga0207674_10144123 3300026116 Bacteria 2341
226 Ga0207683_10000320 3300026121 Bacteria 43863
227 Ga0207683_10002607 3300026121 Bacteria 15741
228 Ga0207698_10004072 3300026142 Bacteria 8873
229 Ga0207698_10016095 3300026142 Bacteria 5031
230 Ga0207698_10045863 3300026142 Bacteria 3296
231 Ga0207698_10065816 3300026142 Bacteria 2849
232 Ga0207698_10093650 3300026142 Bacteria 2467
233 Ga0268264_10073680 3300028381 Bacteria 2899
234 Ga0307410_10002435 3300031852 Bacteria 8992
235 Ga0307406_10118352 3300031901 Bacteria 1837
236 Ga0307407_10071931 3300031903 Bacteria 2060
237 Ga0307409_100045964 3300031995 Bacteria 3301
238 Ga0307411_10018725 3300032005 Bacteria 3981
239 Ga0307415_100007613 3300032126 Bacteria 5937
240 Ga0373943_0009058 3300035170 Bacteria 4463
241 Ga0373935_0046256 3300035692 Bacteria 2748
242 Ga0373927_0148270 3300035695 Bacteria 1536
243 Ga0373947_0027336 3300035725 Bacteria 3339
244 Ga0395899_0000103 3300037312 Bacteria 147274
245 Ga0395899_0001165 3300037312 Bacteria 23226
246 Ga0395899_0002476 3300037312 Bacteria 14982
247 Ga0395899_0010948 3300037312 Bacteria 6949
248 Ga0395899_0021076 3300037312 Bacteria 4942
249 Ga0395899_0057347 3300037312 Bacteria 2876
250 Ga0395899_0074770 3300037312 Bacteria 2475
251 Ga0395899_0091609 3300037312 Bacteria 2202
252 Ga0395899_0129558 3300037312 Bacteria 1802
253 Ga0395899_0147915 3300037312 Bacteria 1666
254 Ga0395900_0002233 3300037418 Bacteria 21590
255 Ga0395900_0002862 3300037418 Bacteria 18816
256 Ga0395900_0003176 3300037418 Bacteria 17816
257 Ga0395900_0007164 3300037418 Bacteria 11556
258 Ga0395900_0046747 3300037418 Bacteria 4456
259 Ga0395900_0114750 3300037418 Bacteria 2764
260 Ga0395900_0219804 3300037418 Bacteria 1915
261 Ga0395898_0000053 3300037466 Bacteria 279600
262 Ga0395898_0002184 3300037466 Bacteria 23910
263 Ga0395898_0004873 3300037466 Bacteria 14574
264 Ga0395898_0038885 3300037466 Bacteria 4712
265 Ga0395898_0080573 3300037466 Bacteria 3139
266 Ga0395898_0150206 3300037466 Bacteria 2229
267 Ga0395898_0167530 3300037466 Bacteria 2100
268 Ga0395898_0170331 3300037466 Bacteria 2081
269 Ga0395905_0000031 3300037471 Bacteria 286757
270 Ga0395905_0000298 3300037471 Bacteria 72500
271 Ga0395905_0003014 3300037471 Bacteria 18246
272 Ga0395905_0011303 3300037471 Bacteria 8632
273 Ga0395905_0013236 3300037471 Bacteria 7915
274 Ga0395905_0016347 3300037471 Bacteria 7050
275 Ga0395905_0016570 3300037471 Bacteria 7005
276 Ga0395905_0029822 3300037471 Bacteria 5142
277 Ga0395905_0046084 3300037471 Bacteria 4088
278 Ga0395905_0057035 3300037471 Bacteria 3653
279 Ga0395905_0081289 3300037471 Bacteria 3037
280 Ga0395901_0001246 3300038443 Bacteria 27128
281 Ga0395901_0024024 3300038443 Bacteria 6252
282 Ga0395901_0029136 3300038443 Bacteria 5681
283 Ga0395901_0034237 3300038443 Bacteria 5245
284 Ga0395901_0038747 3300038443 Bacteria 4930
285 Ga0395901_0051194 3300038443 Bacteria 4292
286 Ga0395901_0106439 3300038443 Bacteria 2944
287 Ga0395901_0170798 3300038443 Bacteria 2281
288 Ga0466969_0004255 3300044656 Bacteria 7609
289 Ga0466966_0075393 3300044684 Unclassified 2107
290 Ga0466966_0103025 3300044684 Unclassified 1764
291 Ga0466963_0036020 3300044694 Unclassified 3225
292 Ga0466958_0019202 3300045836 Bacteria 3977
293 Ga0466958_0020762 3300045836 Unclassified 3833
294 Ga0466958_0045034 3300045836 Plasmid 2661
295 Ga0466967_0259994 3300045976 Bacteria 1661
296 Ga0495598_0001409 3300046537 Bacteria 4757
297 Ga0495669_0003171 3300046684 Bacteria 6772
298 Ga0495669_0004444 3300046684 Bacteria 5793
299 Ga0495669_0012800 3300046684 Bacteria 3572
300 Ga0495669_0013416 3300046684 Bacteria 3491
301 Ga0496101_0074848 3300048904 Bacteria 2491
302 Ga0496101_0120630 3300048904 Bacteria 1982
303 Ga0496106_0044915 3300048909 Bacteria 3318
304 Ga0496107_0009496 3300048910 Bacteria 6748
305 Ga0496107_0057193 3300048910 Bacteria 2819
306 Ga0496107_0061704 3300048910 Bacteria 2715
307 Ga0496108_0006578 3300048911 Bacteria 9429
308 Ga0496108_0007631 3300048911 Bacteria 8762
309 Ga0496108_0019537 3300048911 Bacteria 5564
310 Ga0496108_0027336 3300048911 Bacteria 4709
311 Ga0496109_0072149 3300048912 Bacteria 3171
312 Ga0496109_0121616 3300048912 Bacteria 2432
313 Ga0496110_0002807 3300048913 Bacteria 13144
314 Ga0496110_0055205 3300048913 Bacteria 3495
315 Ga0496110_0103716 3300048913 Bacteria 2551
316 Ga0496110_0320632 3300048913 Unclassified 1411
317 Ga0496111_0009104 3300048914 Bacteria 6609
318 Ga0496111_0240268 3300048914 Bacteria 1345
319 Ga0496112_0026151 3300048915 Bacteria 5612
320 Ga0496112_0113091 3300048915 Bacteria 2685
321 Ga0496112_0133265 3300048915 Bacteria 2455
322 Ga0496112_0230086 3300048915 Bacteria 1808
323 Ga0496113_0084320 3300048916 Bacteria 2439
324 Ga0496114_0000092 3300048917 Bacteria 64974
325 Ga0496114_0024714 3300048917 Bacteria 4905
326 Ga0496115_0075181 3300048918 Bacteria 2744
327 Ga0496107_0047758
328 JGI24740J21852_10001875
329 Ga0070658_10002304
330 Ga0070658_10033502
331 Ga0070658_10037796
332 Ga0070658_10049902
333 Ga0070658_10086663
334 Ga0070658_10157708
335 Ga0070658_10187270
336 Ga0070676_10043040
337 Ga0070683_100004703
338 Ga0070683_100015584
339 Ga0070690_100046876
340 Ga0070670_100002510
341 Ga0070670_100037586
342 Ga0070670_100138366
343 Ga0070666_10026827
344 Ga0070666_10029857
345 Ga0070666_10114975
346 Ga0070680_100000845
347 Ga0070680_100005107
348 Ga0068868_100020420
349 Ga0068868_100083585
350 Ga0068868_100084202
351 Ga0070660_100000292
352 Ga0070660_100049801
353 Ga0070660_100093092
354 Ga0070691_10002168
355 Ga0070661_100006185
356 Ga0070661_100018274
357 Ga0070661_100026691
358 Ga0070661_100081843
359 Ga0070661_100110892
360 Ga0070692_10013695
361 Ga0070668_100067683
362 Ga0070675_100004628
363 Ga0070675_100007402
364 Ga0070671_100006556
365 Ga0070671_100014510
366 Ga0070671_100023911
367 Ga0070671_100125946
368 Ga0070671_100208238
369 Ga0070674_100056611
370 Ga0070673_100001667
371 Ga0070673_100233393
372 Ga0070667_100011561
373 Ga0070667_100041659
374 Ga0070714_100143610
375 Ga0070713_100143299
376 Ga0070663_100040446
377 Ga0070678_100000987
378 Ga0070678_100041601
379 Ga0070662_100090292
380 Ga0070662_100096857
381 Ga0070662_100116155
382 Ga0070662_100195602
383 Ga0068867_100009333
384 Ga0070685_10046639
385 Ga0070679_100094201
386 Ga0070684_100012821
387 Ga0070684_100014486
388 Ga0068853_100009560
389 Ga0070672_100024997
390 Ga0070665_100185308
391 Ga0068855_100039819
392 Ga0068855_100048748
393 Ga0070664_100008604
394 Ga0070664_100011231
395 Ga0070664_100033341
396 Ga0070664_100144448
397 Ga0068857_100012685
398 Ga0068857_100096294
399 Ga0068857_100179197
400 Ga0068854_100026494
401 Ga0068854_100070006
402 Ga0068854_100206753
403 Ga0068856_100006584
404 Ga0068856_100023360
405 Ga0068856_100024493
406 Ga0068856_100025985
407 Ga0068856_100102292
408 Ga0068852_100059983
409 Ga0068852_100173943
410 Ga0068864_100025368
411 Ga0068866_10004106
412 Ga0068851_10009341
413 Ga0068851_10027708
414 Ga0068851_10056070
415 Ga0068863_100002157
416 Ga0068863_100023477
417 Ga0068863_100094646
418 Ga0068858_100014265
419 Ga0068860_100083891
420 Ga0070716_100015876
421 Ga0097621_100054953
422 Ga0068871_100040442
423 Ga0068871_100079062
424 Ga0068865_100043548
425 Ga0105240_10023904
426 Ga0105241_10176134
427 Ga0105248_10011320
428 Ga0105248_10013082
429 Ga0105248_10062780
430 Ga0105248_10248824
431 Ga0105237_10016756
432 Ga0105238_10007178
433 Ga0157373_10007336
434 Ga0157371_10028780
435 Ga0157371_10069903
436 Ga0157370_10001517
437 Ga0157370_10149046
438 Ga0157369_10027713
439 Ga0157369_10074764
440 Ga0157369_10092264
441 Ga0157369_10136020
442 Ga0157369_10409895
443 Ga0157374_10027685
444 Ga0157374_10131573
445 Ga0157374_10161391
446 Ga0157374_10309103
447 Ga0157378_10211663
448 Ga0163162_10008683
449 Ga0163162_10009005
450 Ga0157372_10057693
451 Ga0157375_10000628
452 Ga0157375_10116219
453 Ga0163163_10034277
454 Ga0157376_10079923
455 Ga0197907_11213749
456 Ga0206354_10215528
457 Ga0206353_10057996
458 Ga0224712_10012684
459 Ga0207697_10025863
460 Ga0207656_10041783
461 Ga0207680_10019252
462 Ga0207647_10000910
463 Ga0207647_10011650
464 Ga0207647_10028198
465 Ga0207705_10000853
466 Ga0207705_10005390
467 Ga0207705_10010078
468 Ga0207705_10036885
469 Ga0207705_10044089
470 Ga0207705_10141462
471 Ga0207654_10033488
472 Ga0207707_10221351
473 Ga0207695_10008918
474 Ga0207671_10014919
475 Ga0207660_10005166
476 Ga0207660_10008617
477 Ga0207657_10000962
478 Ga0207657_10008076
479 Ga0207657_10008417
480 Ga0207657_10011178
481 Ga0207657_10023815
482 Ga0207657_10026586
483 Ga0207657_10131243
484 Ga0207657_10163344
485 Ga0207649_10001843
486 Ga0207649_10013365
487 Ga0207649_10016979
488 Ga0207652_10001100
489 Ga0207652_10024222
490 Ga0207652_10068224
491 Ga0207694_10005672
492 Ga0207650_10064947
493 Ga0207650_10068439
494 Ga0207650_10149879
495 Ga0207659_10002145
496 Ga0207659_10019314
497 Ga0207687_10130629
498 Ga0207700_10077854
499 Ga0207664_10114391
500 Ga0207644_10000855
501 Ga0207644_10001600
502 Ga0207644_10002701
503 Ga0207644_10022674
504 Ga0207644_10027870
505 Ga0207644_10035225
506 Ga0207690_10009048
507 Ga0207706_10002689
508 Ga0207706_10007263
509 Ga0207706_10021130
510 Ga0207706_10035222
511 Ga0207706_10067143
512 Ga0207706_10119799
513 Ga0207691_10002012
514 Ga0207691_10053296
515 Ga0207691_10139450
516 Ga0207711_10007239
517 Ga0207711_10035460
518 Ga0207711_10036119
519 Ga0207711_10083628
520 Ga0207711_10246091
521 Ga0207661_10010193
522 Ga0207667_10007822
523 Ga0207667_10020852
524 Ga0207667_10038631
525 Ga0207667_10235892
526 Ga0207640_10002781
527 Ga0207640_10031862
528 Ga0207658_10018554
529 Ga0207658_10055552
530 Ga0207677_10159366
531 Ga0207639_10110370
532 Ga0207678_10002194
533 Ga0207678_10002497
534 Ga0207678_10003065
535 Ga0207678_10030788
536 Ga0207678_10030970
537 Ga0207678_10040692
538 Ga0207678_10040809
539 Ga0207678_10068838
540 Ga0207702_10045792
541 Ga0207641_10013972
542 Ga0207641_10021792
543 Ga0207641_10132539
544 Ga0207648_10013485
545 Ga0207648_10025715
546 Ga0207676_10035078
547 Ga0207674_10010668
548 Ga0207674_10016662
549 Ga0207674_10058176
550 Ga0207674_10093911
551 Ga0207674_10144123
552 Ga0207683_10000320
553 Ga0207683_10002607
554 Ga0207698_10004072
555 Ga0207698_10016095
556 Ga0207698_10045863
557 Ga0207698_10065816
558 Ga0207698_10093650
559 Ga0268264_10073680
560 Ga0307410_10002435
561 Ga0307406_10118352
562 Ga0307407_10071931
563 Ga0307409_100045964
564 Ga0307411_10018725
565 Ga0307415_100007613
566 Ga0373943_0009058
567 Ga0373935_0046256
568 Ga0373927_0148270
569 Ga0373947_0027336
570 Ga0395899_0000103
571 Ga0395899_0001165
572 Ga0395899_0002476
573 Ga0395899_0010948
574 Ga0395899_0021076
575 Ga0395899_0057347
576 Ga0395899_0074770
577 Ga0395899_0091609
578 Ga0395899_0129558
579 Ga0395899_0147915
580 Ga0395900_0002233
581 Ga0395900_0002862
582 Ga0395900_0003176
583 Ga0395900_0007164
584 Ga0395900_0046747
585 Ga0395900_0114750
586 Ga0395900_0219804
587 Ga0395898_0000053
588 Ga0395898_0002184
589 Ga0395898_0004873
590 Ga0395898_0038885
591 Ga0395898_0080573
592 Ga0395898_0150206
593 Ga0395898_0167530
594 Ga0395898_0170331
595 Ga0395905_0000031
596 Ga0395905_0000298
597 Ga0395905_0003014
598 Ga0395905_0011303
599 Ga0395905_0013236
600 Ga0395905_0016347
601 Ga0395905_0016570
602 Ga0395905_0029822
603 Ga0395905_0046084
604 Ga0395905_0057035
605 Ga0395905_0081289
606 Ga0395901_0001246
607 Ga0395901_0024024
608 Ga0395901_0029136
609 Ga0395901_0034237
610 Ga0395901_0038747
611 Ga0395901_0051194
612 Ga0395901_0106439
613 Ga0395901_0170798
614 Ga0466969_0004255
615 Ga0466966_0075393
616 Ga0466966_0103025
617 Ga0466963_0036020
618 Ga0466958_0019202
619 Ga0466958_0020762
620 Ga0466958_0045034
621 Ga0466967_0259994
622 Ga0495598_0001409
623 Ga0495669_0003171
624 Ga0495669_0004444
625 Ga0495669_0012800
626 Ga0495669_0013416
627 Ga0496101_0074848
628 Ga0496101_0120630
629 Ga0496106_0044915
630 Ga0496107_0009496
631 Ga0496107_0057193
632 Ga0496107_0061704
633 Ga0496108_0006578
634 Ga0496108_0007631
635 Ga0496108_0019537
636 Ga0496108_0027336
637 Ga0496109_0072149
638 Ga0496109_0121616
639 Ga0496110_0002807
640 Ga0496110_0055205
641 Ga0496110_0103716
642 Ga0496110_0320632
643 Ga0496111_0009104
644 Ga0496111_0240268
645 Ga0496112_0026151
646 Ga0496112_0113091
647 Ga0496112_0133265
648 Ga0496112_0230086
649 Ga0496113_0084320
650 Ga0496114_0000092
651 Ga0496114_0024714
652 Ga0496115_0075181

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20142

Scaffold

Scaffold domain

62

199

0.89

PF03734

YkuD

L,D-transpeptidase catalytic domain

229

424

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
6fj1-assembly2.cif.gz_B structure of the ldtfm-avibactam carbamoyl enzyme 0.7359 201 404
2hkl-assembly3.cif.gz_C crystal structure of enterococcus faecium l,d-transpeptidase c442s mutant 0.6844 201 404
4xvo-assembly3.cif.gz_C l,d-transpeptidase from mycobacterium smegmatis 0.6537 209 405
4jmx-assembly1.cif.gz_A structure of ld transpeptidase ldtmt1 in complex with imipenem 0.6467 207 405
4lzh-assembly1.cif.gz_A l,d-transpeptidase from klebsiella pneumoniae 0.6329 204 410
ID Description Score Start End Superfamily
af_P22525_424_489_2.40.330.10 Mainly Beta;Beta Barrel;At1g16640 B3 domain;DNA-binding pseudobarrel domain 0.8635 261 326 2.40.330.10
af_P22525_424_489_2.40.330.10 Mainly Beta;Beta Barrel;At1g16640 B3 domain;DNA-binding pseudobarrel domain 0.8407 261 326 2.40.330.10
af_P75954_98_241_2.40.440.10 Mainly Beta;Beta Barrel;L,D-transpeptidase catalytic domain-like;L,D-transpeptidase catalytic domain-like 0.7026 209 404 2.40.440.10
af_F3YDE1_278_332_2.10.25.10 Mainly Beta;Ribbon;Laminin;Laminin 0.6793 208 233 2.10.25.10
af_P75954_98_241_2.40.440.10 Mainly Beta;Beta Barrel;L,D-transpeptidase catalytic domain-like;L,D-transpeptidase catalytic domain-like 0.6758 209 404 2.40.440.10
ID Description Score Start End GO Terms
AF-A0A6J4SQ09-F1-model_v4 L,D-TPase catalytic domain-containing protein 0.9278 193 432 GO:0004180
GO:0008360
GO:0009252
GO:0016740
GO:0071555
AF-A0A7Y3JQH3-F1-model_v4 L,D-transpeptidase family protein 0.8977 204 406 GO:0004180
GO:0008360
GO:0009252
GO:0016740
GO:0071555
AF-A0A485CVN3-F1-model_v4 Murein L,D-transpeptidase 0.8965 212 380 GO:0004180
GO:0008360
GO:0009252
GO:0016740
GO:0071555
AF-A0A0F9MP75-F1-model_v4 L,D-TPase catalytic domain-containing protein 0.8812 207 433 GO:0008360
GO:0009252
GO:0016740
GO:0071555
AF-A0A7C3K165-F1-model_v4 L,D-TPase catalytic domain-containing protein 0.8811 209 430 GO:0008360
GO:0009252
GO:0016740
GO:0071555

Map