F408197

General Info

Members Datasets Scaffolds Average Seq Length
326 139 652 256

Family's Representative Sequence

Representative Sequence 3300005518|Ga0070699_100045400|Ga0070699_1000454002
Length 291
Sequence VTRNASVCQEAVSKDERRLTVDALWRAQQVAFGPGEHVEQESFVRASEILTLAERAGIGPGVSVLDLCCGVAGAGRFVTRELGCVYLGVDSSESAVAVAAERARGLPCRFEVGEVPPLPPGTFEVVLLLETMLAFRDKEALLEEIARALPAGGRFAFTLEEGVPLTESERARMPAADTVWLTPLDEMHTLLARAGLAVRWEENWSESHREVAAALTDAYAADSTAIASRIGRRALEELLAGHRLWTEWLAAGRVRKFGLVAERPAEGAAIPVVRAGARSPCESRTSGWEHA

Samples

Sample ID Description Type Environment
1 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
2 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
3 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
4 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
10 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
13 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
14 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
15 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
16 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
17 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
18 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
19 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
20 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
21 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
22 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
23 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
24 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
25 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
41 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
42 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
43 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
44 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
45 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
46 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
47 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
48 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
49 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
50 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
51 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
52 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
53 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
54 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
55 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
56 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
57 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
58 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
59 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
60 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
61 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
62 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
63 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
64 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
65 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
66 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
67 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
68 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
69 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
70 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
71 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
72 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
73 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
74 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
75 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
76 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
77 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
78 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
79 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
80 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
81 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
82 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
83 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
84 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
85 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
86 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
87 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
88 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
89 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
90 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
91 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
92 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
93 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
94 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
95 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
96 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
97 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
98 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
99 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
100 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
101 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
102 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
103 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
104 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
105 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
106 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
107 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
108 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
109 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
110 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
111 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
112 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
113 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
114 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
115 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
116 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
117 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
118 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
119 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
120 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
121 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
122 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
123 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
124 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
125 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
126 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
127 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
128 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
129 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
130 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
131 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
132 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
133 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
134 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
135 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
136 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
137 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
138 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
139 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 23.93
Rhizosphere 76.07
Stem 0
Stem Tuber 0
Unclassified 13.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070699_100045400 3300005518 Bacteria 3802
2 Ga0070680_100075965 3300005336 Unclassified 2766
3 Ga0070674_100031525 3300005356 Bacteria 3513
4 Ga0070709_10096213 3300005434 Bacteria 1963
5 Ga0070709_10120358 3300005434 Viruses 1778
6 Ga0070714_100013280 3300005435 Bacteria 6597
7 Ga0070714_100024658 3300005435 Bacteria 4956
8 Ga0070714_100373993 3300005435 Bacteria 1342
9 Ga0070713_100071357 3300005436 Bacteria 2934
10 Ga0070713_100402713 3300005436 Bacteria 1278
11 Ga0070710_10029656 3300005437 Bacteria 2936
12 Ga0070711_100020610 3300005439 Bacteria 4253
13 Ga0070711_100085518 3300005439 Bacteria 2259
14 Ga0070711_100270133 3300005439 Unclassified 1341
15 Ga0070663_100006133 3300005455 Bacteria 7196
16 Ga0070662_100225088 3300005457 Bacteria 1498
17 Ga0070681_10341768 3300005458 Unclassified 1407
18 Ga0070704_100248559 3300005549 Unclassified 1459
19 Ga0068856_100034166 3300005614 Bacteria 4981
20 Ga0070717_10069636 3300006028 Bacteria 2930
21 Ga0070715_10001810 3300006163 Bacteria 6376
22 Ga0070712_100017692 3300006175 Bacteria 4618
23 Ga0070712_100027841 3300006175 Bacteria 3777
24 Ga0070712_100053986 3300006175 Bacteria 2807
25 Ga0070712_100074035 3300006175 Bacteria 2445
26 Ga0070712_100155546 3300006175 Bacteria 1760
27 Ga0070712_100226021 3300006175 Bacteria 1484
28 Ga0075434_100008485 3300006871 Bacteria 9559
29 Ga0075436_100300184 3300006914 Bacteria 1151
30 Ga0105241_10064396 3300009174 Unclassified 2830
31 Ga0105239_10054321 3300010375 Bacteria 4393
32 Ga0157369_10186968 3300013105 Bacteria 2178
33 Ga0157374_10040693 3300013296 Bacteria 4281
34 Ga0182008_10046300 3300014497 Bacteria 2162
35 Ga0157377_10049276 3300014745 Bacteria 2367
36 Ga0157377_10140201 3300014745 Bacteria 1485
37 Ga0207699_10052547 3300025906 Unclassified 2412
38 Ga0207699_10089889 3300025906 Bacteria 1926
39 Ga0207699_10189480 3300025906 Bacteria 1387
40 Ga0207684_10051815 3300025910 Bacteria 3482
41 Ga0207693_10000848 3300025915 Bacteria 27279
42 Ga0207693_10018899 3300025915 Bacteria 5486
43 Ga0207693_10026772 3300025915 Bacteria 4562
44 Ga0207693_10036548 3300025915 Bacteria 3871
45 Ga0207693_10044826 3300025915 Bacteria 3475
46 Ga0207693_10237027 3300025915 Bacteria 1432
47 Ga0207663_10023298 3300025916 Bacteria 3551
48 Ga0207663_10027154 3300025916 Unclassified 3332
49 Ga0207652_10268277 3300025921 Bacteria 1539
50 Ga0207646_10004482 3300025922 Bacteria 15143
51 Ga0207646_10113897 3300025922 Bacteria 2428
52 Ga0207687_10016652 3300025927 Bacteria 4830
53 Ga0207700_10198079 3300025928 Bacteria 1691
54 Ga0207700_10206952 3300025928 Bacteria 1656
55 Ga0207700_10351269 3300025928 Bacteria 1284
56 Ga0207700_10515035 3300025928 Unclassified 1059
57 Ga0207664_10006369 3300025929 Bacteria 8115
58 Ga0207664_10051366 3300025929 Bacteria 3255
59 Ga0207664_10054905 3300025929 Bacteria 3159
60 Ga0207664_10070552 3300025929 Bacteria 2812
61 Ga0207664_10412677 3300025929 Bacteria 1202
62 Ga0207704_10455590 3300025938 Bacteria 1022
63 Ga0207665_10000195 3300025939 Bacteria 40705
64 Ga0207665_10005322 3300025939 Bacteria 8601
65 Ga0207691_10326870 3300025940 Bacteria 1314
66 Ga0207677_10318933 3300026023 Bacteria 1291
67 Ga0207702_10034088 3300026078 Bacteria 4254
68 Ga0207702_10492218 3300026078 Viruses 1194
69 Ga0207683_10000833 3300026121 Bacteria 28215
70 Ga0373930_0010838 3300034816 Unclassified 1637
71 Ga0373958_0021159 3300034819 Unclassified 1205
72 Ga0373929_0021938 3300035085 Viruses 1300
73 Ga0373940_0042606 3300035088 Unclassified 1252
74 Ga0373951_0008905 3300035091 Unclassified 2263
75 Ga0373932_0051514 3300035112 Unclassified 1223
76 Ga0373941_0022961 3300035115 Unclassified 1776
77 Ga0373945_0099471 3300035116 Unclassified 1136
78 Ga0373956_0037359 3300035119 Bacteria 2147
79 Ga0373957_0059110 3300035120 Bacteria 1482
80 Ga0373943_0002628 3300035170 Bacteria 8170
81 Ga0373943_0159748 3300035170 Bacteria 1226
82 Ga0373931_0038559 3300035691 Bacteria 2500
83 Ga0373931_0106555 3300035691 Unclassified 1584
84 Ga0373935_0042808 3300035692 Bacteria 2848
85 Ga0373935_0065432 3300035692 Bacteria 2333
86 Ga0373927_0058126 3300035695 Bacteria 2501
87 Ga0373947_0005944 3300035725 Bacteria 7111
88 Ga0373937_0000989 3300036401 Bacteria 24140
89 Ga0373937_0138143 3300036401 Bacteria 2279
90 Ga0373925_0008902 3300037068 Bacteria 7313
91 Ga0395901_0139110 3300038443 Bacteria 2552
92 Ga0466963_0010601 3300044694 Bacteria 5586
93 Ga0466963_0074700 3300044694 Bacteria 2287
94 Ga0466963_0323505 3300044694 Bacteria 1085
95 Ga0466964_0022812 3300044706 Bacteria 2431
96 Ga0466971_0000459 3300044719 Bacteria 15887
97 Ga0466968_0041352 3300044735 Unclassified 1945
98 Ga0466970_0073412 3300044765 Unclassified 1841
99 Ga0466957_0013984 3300044842 Bacteria 4667
100 Ga0466959_0003018 3300045049 Bacteria 10872
101 Ga0466959_0191059 3300045049 Unclassified 1429
102 Ga0466959_0300924 3300045049 Bacteria 1098
103 Ga0451576_0156320 3300045051 Bacteria 2379
104 Ga0466958_0022479 3300045836 Bacteria 3694
105 Ga0466967_0041293 3300045976 Bacteria 3976
106 Ga0466967_0046107 3300045976 Bacteria 3793
107 Ga0466967_0061013 3300045976 Bacteria 3344
108 Ga0466967_0085165 3300045976 Bacteria 2861
109 Ga0466967_0203709 3300045976 Bacteria 1875
110 Ga0495592_0000368 3300046454 Bacteria 35552
111 Ga0495592_0014731 3300046454 Bacteria 5937
112 Ga0495592_0039800 3300046454 Bacteria 3530
113 Ga0495592_0041525 3300046454 Bacteria 3447
114 Ga0495592_0150931 3300046454 Bacteria 1607
115 Ga0495592_0170890 3300046454 Bacteria 1489
116 Ga0495603_0087659 3300046455 Bacteria 1821
117 Ga0495629_0003104 3300046459 Bacteria 12595
118 Ga0495629_0017975 3300046459 Bacteria 5068
119 Ga0495629_0143819 3300046459 Bacteria 1659
120 Ga0495641_0006434 3300046461 Bacteria 7610
121 Ga0495641_0010499 3300046461 Bacteria 5362
122 Ga0495641_0098284 3300046461 Bacteria 1306
123 Ga0495651_0010178 3300046462 Bacteria 7221
124 Ga0495651_0044408 3300046462 Bacteria 3444
125 Ga0495653_0008167 3300046463 Bacteria 8572
126 Ga0495653_0010191 3300046463 Bacteria 7691
127 Ga0495653_0027099 3300046463 Bacteria 4589
128 Ga0495580_0024110 3300046472 Bacteria 4459
129 Ga0495582_0010859 3300046473 Bacteria 5011
130 Ga0495582_0022594 3300046473 Bacteria 3443
131 Ga0495639_0000322 3300046475 Bacteria 23204
132 Ga0495639_0107921 3300046475 Bacteria 1319
133 Ga0495639_0210577 3300046475 Bacteria 954
134 Ga0495662_0006640 3300046476 Bacteria 5771
135 Ga0495662_0113176 3300046476 Bacteria 1330
136 Ga0495664_0004712 3300046477 Bacteria 7459
137 Ga0495664_0150396 3300046477 Bacteria 1412
138 Ga0495664_0265792 3300046477 Unclassified 1037
139 Ga0495608_0006797 3300046511 Bacteria 8109
140 Ga0495608_0010708 3300046511 Bacteria 6397
141 Ga0495608_0022751 3300046511 Bacteria 4299
142 Ga0495608_0153647 3300046511 Unclassified 1466
143 Ga0495618_0005255 3300046514 Bacteria 7914
144 Ga0495618_0007980 3300046514 Bacteria 6405
145 Ga0495618_0121090 3300046514 Bacteria 1676
146 Ga0495628_0000650 3300046516 Bacteria 31811
147 Ga0495628_0018963 3300046516 Bacteria 5692
148 Ga0495628_0068971 3300046516 Bacteria 2758
149 Ga0495628_0183263 3300046516 Bacteria 1583
150 Ga0495628_0206364 3300046516 Bacteria 1479
151 Ga0495630_0006629 3300046517 Bacteria 8251
152 Ga0495630_0054548 3300046517 Bacteria 2994
153 Ga0495630_0122385 3300046517 Bacteria 1974
154 Ga0495630_0315546 3300046517 Bacteria 1195
155 Ga0495666_0000381 3300046526 Bacteria 19428
156 Ga0495652_0011936 3300046529 Bacteria 7855
157 Ga0495652_0037896 3300046529 Bacteria 4180
158 Ga0495652_0113179 3300046529 Bacteria 2179
159 Ga0495652_0240456 3300046529 Unclassified 1347
160 Ga0495665_0001289 3300046531 Bacteria 13380
161 Ga0495665_0004560 3300046531 Bacteria 7478
162 Ga0495665_0100746 3300046531 Bacteria 1516
163 Ga0495640_0033525 3300046533 Bacteria 3646
164 Ga0495640_0058870 3300046533 Bacteria 2619
165 Ga0495640_0063783 3300046533 Bacteria 2494
166 Ga0495640_0120332 3300046533 Bacteria 1707
167 Ga0495587_0000469 3300046536 Bacteria 27940
168 Ga0495587_0026038 3300046536 Bacteria 3569
169 Ga0495645_0000456 3300046543 Bacteria 28144
170 Ga0495645_0168394 3300046543 Bacteria 1509
171 Ga0495667_0003772 3300046559 Bacteria 10181
172 Ga0495667_0033605 3300046559 Bacteria 3432
173 Ga0495667_0060058 3300046559 Unclassified 2494
174 Ga0495634_0011846 3300046642 Bacteria 6339
175 Ga0495634_0031844 3300046642 Bacteria 3630
176 Ga0495634_0162797 3300046642 Bacteria 1406
177 Ga0495635_0002868 3300046663 Bacteria 11845
178 Ga0495635_0023853 3300046663 Bacteria 4263
179 Ga0495635_0040049 3300046663 Bacteria 3239
180 Ga0495635_0136105 3300046663 Bacteria 1674
181 Ga0495657_0010935 3300046675 Bacteria 6806
182 Ga0495599_0013118 3300046678 Bacteria 5119
183 Ga0495599_0207947 3300046678 Bacteria 1201
184 Ga0495623_0000123 3300046679 Bacteria 47116
185 Ga0495646_0094559 3300046680 Bacteria 1721
186 Ga0495647_0000125 3300046681 Bacteria 19619
187 Ga0495658_0012256 3300046683 Bacteria 4336
188 Ga0495658_0020377 3300046683 Bacteria 3478
189 Ga0495658_0103276 3300046683 Bacteria 1704
190 Ga0495613_0020933 3300046689 Bacteria 4875
191 Ga0495613_0111428 3300046689 Bacteria 1971
192 Ga0495624_0003568 3300046690 Bacteria 11523
193 Ga0495624_0055516 3300046690 Bacteria 2494
194 Ga0495600_0014781 3300046809 Bacteria 4923
195 Ga0495600_0038546 3300046809 Bacteria 3110
196 Ga0495600_0076531 3300046809 Bacteria 2185
197 Ga0495581_0009398 3300047315 Bacteria 5656
198 Ga0495581_0208850 3300047315 Bacteria 1142
199 Ga0495604_0000085 3300047317 Bacteria 81234
200 Ga0495604_0018937 3300047317 Bacteria 5514
201 Ga0495674_0022180 3300047319 Bacteria 5858
202 Ga0495674_0144513 3300047319 Bacteria 1997
203 Ga0495674_0207047 3300047319 Bacteria 1626
204 Ga0495676_0004037 3300047321 Bacteria 13362
205 Ga0495676_0048638 3300047321 Bacteria 3417
206 Ga0495680_0000756 3300047322 Bacteria 36274
207 Ga0495680_0022568 3300047322 Bacteria 5242
208 Ga0495680_0034513 3300047322 Bacteria 4083
209 Ga0495680_0156849 3300047322 Bacteria 1655
210 Ga0495675_0000627 3300047444 Bacteria 22487
211 Ga0495675_0044818 3300047444 Bacteria 2817
212 Ga0495684_0010648 3300047471 Bacteria 7108
213 Ga0495684_0022454 3300047471 Bacteria 4854
214 Ga0495684_0028429 3300047471 Bacteria 4293
215 Ga0495684_0041966 3300047471 Bacteria 3505
216 Ga0495593_0001712 3300047673 Bacteria 12980
217 Ga0495602_0004795 3300048088 Bacteria 14138
218 Ga0495602_0134809 3300048088 Bacteria 1964
219 Ga0495614_0002356 3300048089 Bacteria 8405
220 Ga0496100_0010956 3300048903 Bacteria 5144
221 Ga0496100_0014261 3300048903 Bacteria 4610
222 Ga0496100_0074845 3300048903 Unclassified 2269
223 Ga0496100_0424826 3300048903 Bacteria 1015
224 Ga0496101_0024563 3300048904 Bacteria 4171
225 Ga0496101_0027874 3300048904 Bacteria 3939
226 Ga0496101_0048654 3300048904 Bacteria 3047
227 Ga0496101_0091855 3300048904 Unclassified 2259
228 Ga0496101_0207189 3300048904 Unclassified 1518
229 Ga0496102_0008550 3300048905 Bacteria 8778
230 Ga0496102_0158124 3300048905 Bacteria 2131
231 Ga0496102_0443143 3300048905 Unclassified 1218
232 Ga0496103_0006778 3300048906 Bacteria 6834
233 Ga0496103_0067900 3300048906 Bacteria 2227
234 Ga0496104_0009376 3300048907 Bacteria 8705
235 Ga0496104_0009752 3300048907 Bacteria 8561
236 Ga0496104_0014454 3300048907 Bacteria 7131
237 Ga0496104_0102768 3300048907 Bacteria 2737
238 Ga0496104_0198219 3300048907 Bacteria 1919
239 Ga0496104_0406031 3300048907 Unclassified 1274
240 Ga0496104_0412602 3300048907 Unclassified 1263
241 Ga0496105_0008273 3300048908 Bacteria 8089
242 Ga0496105_0023390 3300048908 Bacteria 5010
243 Ga0496105_0033191 3300048908 Bacteria 4237
244 Ga0496105_0050227 3300048908 Bacteria 3445
245 Ga0496105_0144785 3300048908 Bacteria 1954
246 Ga0496105_0247050 3300048908 Bacteria 1446
247 Ga0496105_0336039 3300048908 Unclassified 1208
248 Ga0496105_0401979 3300048908 Unclassified 1087
249 Ga0496106_0001850 3300048909 Bacteria 15841
250 Ga0496106_0025173 3300048909 Bacteria 4427
251 Ga0496106_0141371 3300048909 Bacteria 1893
252 Ga0496106_0201446 3300048909 Bacteria 1584
253 Ga0496107_0006784 3300048910 Bacteria 7882
254 Ga0496107_0092386 3300048910 Bacteria 2212
255 Ga0496107_0120293 3300048910 Bacteria 1934
256 Ga0496107_0324012 3300048910 Unclassified 1146
257 Ga0496108_0002602 3300048911 Bacteria 14451
258 Ga0496108_0019395 3300048911 Bacteria 5584
259 Ga0496108_0024526 3300048911 Bacteria 4966
260 Ga0496108_0041575 3300048911 Bacteria 3838
261 Ga0496108_0571678 3300048911 Bacteria 985
262 Ga0496109_0001181 3300048912 Bacteria 21688
263 Ga0496109_0009998 3300048912 Bacteria 8099
264 Ga0496109_0020110 3300048912 Bacteria 5897
265 Ga0496109_0024464 3300048912 Bacteria 5369
266 Ga0496109_0139498 3300048912 Bacteria 2266
267 Ga0496109_0142155 3300048912 Unclassified 2244
268 Ga0496110_0002894 3300048913 Bacteria 12990
269 Ga0496110_0010049 3300048913 Bacteria 7681
270 Ga0496110_0033847 3300048913 Bacteria 4423
271 Ga0496110_0075733 3300048913 Bacteria 2990
272 Ga0496110_0258074 3300048913 Bacteria 1586
273 Ga0496110_0331191 3300048913 Unclassified 1387
274 Ga0496111_0014595 3300048914 Bacteria 5372
275 Ga0496111_0015239 3300048914 Bacteria 5271
276 Ga0496111_0048706 3300048914 Bacteria 3053
277 Ga0496111_0232427 3300048914 Bacteria 1369
278 Ga0496111_0258925 3300048914 Bacteria 1291
279 Ga0496112_0007917 3300048915 Bacteria 9468
280 Ga0496112_0066179 3300048915 Bacteria 3566
281 Ga0496112_0120744 3300048915 Bacteria 2590
282 Ga0496113_0001832 3300048916 Bacteria 12097
283 Ga0496113_0033875 3300048916 Bacteria 3723
284 Ga0496113_0061713 3300048916 Bacteria 2829
285 Ga0496113_0068606 3300048916 Bacteria 2691
286 Ga0496113_0078153 3300048916 Bacteria 2531
287 Ga0496114_0005949 3300048917 Bacteria 9589
288 Ga0496114_0010141 3300048917 Bacteria 7495
289 Ga0496114_0011248 3300048917 Bacteria 7145
290 Ga0496114_0025474 3300048917 Bacteria 4836
291 Ga0496114_0398856 3300048917 Unclassified 1218
292 Ga0496115_0013056 3300048918 Bacteria 6271
293 Ga0496115_0029442 3300048918 Unclassified 4312
294 Ga0496115_0058621 3300048918 Bacteria 3098
295 Ga0496115_0068918 3300048918 Bacteria 2864
296 Ga0496115_0069853 3300048918 Bacteria 2846
297 Ga0496115_0267072 3300048918 Bacteria 1406
298 Ga0501072_0029308 3300049588 Bacteria 4299
299 Ga0501077_0149823 3300049593 Unclassified 1480
300 Ga0501079_0295869 3300049741 Unclassified 1266
301 Ga0501083_0379168 3300049744 Unclassified 920
302 nmdc:mga0n895_57261_c1 3300050512 Bacteria 3841
303 nmdc:mga0n895_58235_c1 3300050512 Unclassified 3808
304 nmdc:mga0rr50_113631_c1 3300050513 Unclassified 2146
305 nmdc:mga08x19_276556_c1 3300050514 Bacteria 1163
306 nmdc:mga0a205_140304_c1 3300050515 Bacteria 2317
307 nmdc:mga0a205_558167_c1 3300050515 Bacteria 1000
308 Ga0495601_0000269 3300053077 Bacteria 28152
309 Ga0495601_0005606 3300053077 Bacteria 7319
310 Ga0495601_0051008 3300053077 Bacteria 2611
311 Ga0495601_0108007 3300053077 Bacteria 1800
312 Ga0495601_0295045 3300053077 Bacteria 1056
313 Ga0495612_0001055 3300053078 Bacteria 11274
314 Ga0495612_0001908 3300053078 Bacteria 8579
315 Ga0495612_0042610 3300053078 Bacteria 1853
316 Ga0495595_0011698 3300053084 Bacteria 3673
317 Ga0495595_0017294 3300053084 Bacteria 3101
318 Ga0495595_0065636 3300053084 Bacteria 1707
319 Ga0495595_0066621 3300053084 Bacteria 1696
320 Ga0495619_0001964 3300053085 Bacteria 13716
321 Ga0495619_0010954 3300053085 Bacteria 5705
322 Ga0495619_0054663 3300053085 Bacteria 2643
323 Ga0495619_0071838 3300053085 Bacteria 2316
324 Ga0495619_0100579 3300053085 Unclassified 1967
325 Ga0495619_0278813 3300053085 Unclassified 1158
326 Ga0501084_0049003 3300054114 Unclassified 3536
327 Ga0070699_100045400
328 Ga0070680_100075965
329 Ga0070674_100031525
330 Ga0070709_10096213
331 Ga0070709_10120358
332 Ga0070714_100013280
333 Ga0070714_100024658
334 Ga0070714_100373993
335 Ga0070713_100071357
336 Ga0070713_100402713
337 Ga0070710_10029656
338 Ga0070711_100020610
339 Ga0070711_100085518
340 Ga0070711_100270133
341 Ga0070663_100006133
342 Ga0070662_100225088
343 Ga0070681_10341768
344 Ga0070704_100248559
345 Ga0068856_100034166
346 Ga0070717_10069636
347 Ga0070715_10001810
348 Ga0070712_100017692
349 Ga0070712_100027841
350 Ga0070712_100053986
351 Ga0070712_100074035
352 Ga0070712_100155546
353 Ga0070712_100226021
354 Ga0075434_100008485
355 Ga0075436_100300184
356 Ga0105241_10064396
357 Ga0105239_10054321
358 Ga0157369_10186968
359 Ga0157374_10040693
360 Ga0182008_10046300
361 Ga0157377_10049276
362 Ga0157377_10140201
363 Ga0207699_10052547
364 Ga0207699_10089889
365 Ga0207699_10189480
366 Ga0207684_10051815
367 Ga0207693_10000848
368 Ga0207693_10018899
369 Ga0207693_10026772
370 Ga0207693_10036548
371 Ga0207693_10044826
372 Ga0207693_10237027
373 Ga0207663_10023298
374 Ga0207663_10027154
375 Ga0207652_10268277
376 Ga0207646_10004482
377 Ga0207646_10113897
378 Ga0207687_10016652
379 Ga0207700_10198079
380 Ga0207700_10206952
381 Ga0207700_10351269
382 Ga0207700_10515035
383 Ga0207664_10006369
384 Ga0207664_10051366
385 Ga0207664_10054905
386 Ga0207664_10070552
387 Ga0207664_10412677
388 Ga0207704_10455590
389 Ga0207665_10000195
390 Ga0207665_10005322
391 Ga0207691_10326870
392 Ga0207677_10318933
393 Ga0207702_10034088
394 Ga0207702_10492218
395 Ga0207683_10000833
396 Ga0373930_0010838
397 Ga0373958_0021159
398 Ga0373929_0021938
399 Ga0373940_0042606
400 Ga0373951_0008905
401 Ga0373932_0051514
402 Ga0373941_0022961
403 Ga0373945_0099471
404 Ga0373956_0037359
405 Ga0373957_0059110
406 Ga0373943_0002628
407 Ga0373943_0159748
408 Ga0373931_0038559
409 Ga0373931_0106555
410 Ga0373935_0042808
411 Ga0373935_0065432
412 Ga0373927_0058126
413 Ga0373947_0005944
414 Ga0373937_0000989
415 Ga0373937_0138143
416 Ga0373925_0008902
417 Ga0395901_0139110
418 Ga0466963_0010601
419 Ga0466963_0074700
420 Ga0466963_0323505
421 Ga0466964_0022812
422 Ga0466971_0000459
423 Ga0466968_0041352
424 Ga0466970_0073412
425 Ga0466957_0013984
426 Ga0466959_0003018
427 Ga0466959_0191059
428 Ga0466959_0300924
429 Ga0451576_0156320
430 Ga0466958_0022479
431 Ga0466967_0041293
432 Ga0466967_0046107
433 Ga0466967_0061013
434 Ga0466967_0085165
435 Ga0466967_0203709
436 Ga0495592_0000368
437 Ga0495592_0014731
438 Ga0495592_0039800
439 Ga0495592_0041525
440 Ga0495592_0150931
441 Ga0495592_0170890
442 Ga0495603_0087659
443 Ga0495629_0003104
444 Ga0495629_0017975
445 Ga0495629_0143819
446 Ga0495641_0006434
447 Ga0495641_0010499
448 Ga0495641_0098284
449 Ga0495651_0010178
450 Ga0495651_0044408
451 Ga0495653_0008167
452 Ga0495653_0010191
453 Ga0495653_0027099
454 Ga0495580_0024110
455 Ga0495582_0010859
456 Ga0495582_0022594
457 Ga0495639_0000322
458 Ga0495639_0107921
459 Ga0495639_0210577
460 Ga0495662_0006640
461 Ga0495662_0113176
462 Ga0495664_0004712
463 Ga0495664_0150396
464 Ga0495664_0265792
465 Ga0495608_0006797
466 Ga0495608_0010708
467 Ga0495608_0022751
468 Ga0495608_0153647
469 Ga0495618_0005255
470 Ga0495618_0007980
471 Ga0495618_0121090
472 Ga0495628_0000650
473 Ga0495628_0018963
474 Ga0495628_0068971
475 Ga0495628_0183263
476 Ga0495628_0206364
477 Ga0495630_0006629
478 Ga0495630_0054548
479 Ga0495630_0122385
480 Ga0495630_0315546
481 Ga0495666_0000381
482 Ga0495652_0011936
483 Ga0495652_0037896
484 Ga0495652_0113179
485 Ga0495652_0240456
486 Ga0495665_0001289
487 Ga0495665_0004560
488 Ga0495665_0100746
489 Ga0495640_0033525
490 Ga0495640_0058870
491 Ga0495640_0063783
492 Ga0495640_0120332
493 Ga0495587_0000469
494 Ga0495587_0026038
495 Ga0495645_0000456
496 Ga0495645_0168394
497 Ga0495667_0003772
498 Ga0495667_0033605
499 Ga0495667_0060058
500 Ga0495634_0011846
501 Ga0495634_0031844
502 Ga0495634_0162797
503 Ga0495635_0002868
504 Ga0495635_0023853
505 Ga0495635_0040049
506 Ga0495635_0136105
507 Ga0495657_0010935
508 Ga0495599_0013118
509 Ga0495599_0207947
510 Ga0495623_0000123
511 Ga0495646_0094559
512 Ga0495647_0000125
513 Ga0495658_0012256
514 Ga0495658_0020377
515 Ga0495658_0103276
516 Ga0495613_0020933
517 Ga0495613_0111428
518 Ga0495624_0003568
519 Ga0495624_0055516
520 Ga0495600_0014781
521 Ga0495600_0038546
522 Ga0495600_0076531
523 Ga0495581_0009398
524 Ga0495581_0208850
525 Ga0495604_0000085
526 Ga0495604_0018937
527 Ga0495674_0022180
528 Ga0495674_0144513
529 Ga0495674_0207047
530 Ga0495676_0004037
531 Ga0495676_0048638
532 Ga0495680_0000756
533 Ga0495680_0022568
534 Ga0495680_0034513
535 Ga0495680_0156849
536 Ga0495675_0000627
537 Ga0495675_0044818
538 Ga0495684_0010648
539 Ga0495684_0022454
540 Ga0495684_0028429
541 Ga0495684_0041966
542 Ga0495593_0001712
543 Ga0495602_0004795
544 Ga0495602_0134809
545 Ga0495614_0002356
546 Ga0496100_0010956
547 Ga0496100_0014261
548 Ga0496100_0074845
549 Ga0496100_0424826
550 Ga0496101_0024563
551 Ga0496101_0027874
552 Ga0496101_0048654
553 Ga0496101_0091855
554 Ga0496101_0207189
555 Ga0496102_0008550
556 Ga0496102_0158124
557 Ga0496102_0443143
558 Ga0496103_0006778
559 Ga0496103_0067900
560 Ga0496104_0009376
561 Ga0496104_0009752
562 Ga0496104_0014454
563 Ga0496104_0102768
564 Ga0496104_0198219
565 Ga0496104_0406031
566 Ga0496104_0412602
567 Ga0496105_0008273
568 Ga0496105_0023390
569 Ga0496105_0033191
570 Ga0496105_0050227
571 Ga0496105_0144785
572 Ga0496105_0247050
573 Ga0496105_0336039
574 Ga0496105_0401979
575 Ga0496106_0001850
576 Ga0496106_0025173
577 Ga0496106_0141371
578 Ga0496106_0201446
579 Ga0496107_0006784
580 Ga0496107_0092386
581 Ga0496107_0120293
582 Ga0496107_0324012
583 Ga0496108_0002602
584 Ga0496108_0019395
585 Ga0496108_0024526
586 Ga0496108_0041575
587 Ga0496108_0571678
588 Ga0496109_0001181
589 Ga0496109_0009998
590 Ga0496109_0020110
591 Ga0496109_0024464
592 Ga0496109_0139498
593 Ga0496109_0142155
594 Ga0496110_0002894
595 Ga0496110_0010049
596 Ga0496110_0033847
597 Ga0496110_0075733
598 Ga0496110_0258074
599 Ga0496110_0331191
600 Ga0496111_0014595
601 Ga0496111_0015239
602 Ga0496111_0048706
603 Ga0496111_0232427
604 Ga0496111_0258925
605 Ga0496112_0007917
606 Ga0496112_0066179
607 Ga0496112_0120744
608 Ga0496113_0001832
609 Ga0496113_0033875
610 Ga0496113_0061713
611 Ga0496113_0068606
612 Ga0496113_0078153
613 Ga0496114_0005949
614 Ga0496114_0010141
615 Ga0496114_0011248
616 Ga0496114_0025474
617 Ga0496114_0398856
618 Ga0496115_0013056
619 Ga0496115_0029442
620 Ga0496115_0058621
621 Ga0496115_0068918
622 Ga0496115_0069853
623 Ga0496115_0267072
624 Ga0501072_0029308
625 Ga0501077_0149823
626 Ga0501079_0295869
627 Ga0501083_0379168
628 nmdc:mga0n895_57261_c1
629 nmdc:mga0n895_58235_c1
630 nmdc:mga0rr50_113631_c1
631 nmdc:mga08x19_276556_c1
632 nmdc:mga0a205_140304_c1
633 nmdc:mga0a205_558167_c1
634 Ga0495601_0000269
635 Ga0495601_0005606
636 Ga0495601_0051008
637 Ga0495601_0108007
638 Ga0495601_0295045
639 Ga0495612_0001055
640 Ga0495612_0001908
641 Ga0495612_0042610
642 Ga0495595_0011698
643 Ga0495595_0017294
644 Ga0495595_0065636
645 Ga0495595_0066621
646 Ga0495619_0001964
647 Ga0495619_0010954
648 Ga0495619_0054663
649 Ga0495619_0071838
650 Ga0495619_0100579
651 Ga0495619_0278813
652 Ga0501084_0049003

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13649

Methyltransf_25

Methyltransferase domain

64

153

0.92

PF08242

Methyltransf_12

Methyltransferase domain

65

155

0.9

PF08241

Methyltransf_11

Methyltransferase domain

65

157

0.9

PF13847

Methyltransf_31

Methyltransferase domain

58

210

0.87

PF13489

Methyltransf_23

Methyltransferase domain

24

200

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
2o57-assembly2.cif.gz_C crystal structure of a putative sarcosine dimethylglycine methyltransferase from galdieria sulphuraria 0.8861 36 256
3ha7-assembly1.cif.gz_A crystal structure of hma (mmaa4) from mycobacterium tuberculosis complexed with s-adenosyl-n-decyl-aminoethyl (sadae) 0.8789 36 253
2o57-assembly2.cif.gz_D crystal structure of a putative sarcosine dimethylglycine methyltransferase from galdieria sulphuraria 0.8772 36 253
3bus-assembly1.cif.gz_A crystal structure of rebm 0.8593 37 253
3bus-assembly2.cif.gz_B crystal structure of rebm 0.8573 37 253
ID Description Score Start End Superfamily
af_Q4D3E1_216_398_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8914 36 85 3.40.50.150
af_Q553T0_166_421_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8807 38 184 3.40.50.150
3d2lA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8755 38 192 3.40.50.150
af_O69696_536_776_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8645 34 253 3.40.50.150
5gm2R01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8545 36 254 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A3D5CY44-F1-model_v4 sphingolipid C(9)-methyltransferase (EC 2.1.1.317) 0.9263 36 252 GO:0006665
GO:0008168
GO:0008610
GO:0016020
GO:0032259
AF-A0A2N9LLE3-F1-model_v4 Putative fatty acid methyltransferase (EC 2.1.1.-) 0.9179 74 252 GO:0008168
GO:0008610
GO:0032259
AF-A0A524JIS1-F1-model_v4 Class I SAM-dependent methyltransferase 0.9115 5 255 GO:0008168
GO:0032259
AF-A0A6H5KUA7-F1-model_v4 Methyltransferase type 11 domain-containing protein 0.9113 50 256 GO:0008757
AF-A0A645F685-F1-model_v4 Cyclopropane-fatty-acyl-phospholipid synthase (EC 2.1.1.79) 0.9096 41 252 GO:0008610
GO:0008825
GO:0032259

Map