F408168

General Info

Members Datasets Scaffolds Average Seq Length
326 220 326 113

Family's Representative Sequence

Representative Sequence 3300005347|Ga0070668_101636268|Ga0070668_1016362682
Length 128
Sequence MLTTNTLKLQTSNMPADKSDVLHGTLDLIILKTLDAMGPLHGYAVARRIEQISSDQLSINQGTLYPALLKLEQHGWISRKWGESATGRRVKFYTITPRGRRQLQTEEADWARATGIVAKFFGLAKATR

Samples

Sample ID Description Type Environment
1 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
54 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
55 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
56 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
125 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
128 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
129 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
130 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
131 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
132 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
133 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
134 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
135 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
136 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
137 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
138 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
139 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
140 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
141 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
142 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
143 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
144 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
145 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
146 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
147 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
148 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
149 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
150 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
151 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
152 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
153 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
154 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
155 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
156 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
157 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
158 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
159 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
160 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
161 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
162 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
163 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
164 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
165 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
166 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
167 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
168 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
169 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
170 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
171 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
172 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
173 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
186 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
187 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
188 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
189 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
190 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
191 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
192 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
193 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
194 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
195 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
196 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
197 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
199 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
200 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
201 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
202 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
203 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
204 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
205 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
206 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
207 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
208 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
209 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
210 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
211 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
212 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
213 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
214 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
215 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
216 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
217 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
218 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
219 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
220 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.44
Nodule 0
Rhizoplane 2.76
Rhizosphere 90.49
Stem 0
Stem Tuber 0
Unclassified 0.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10001729 3300002459 Unclassified 4484
2 JGI25406J46586_10142390 3300003203 Bacteria 701
3 Ga0065715_10136752 3300005293 Bacteria 1917
4 Ga0065707_10149969 3300005295 Bacteria 1666
5 Ga0065707_10605438 3300005295 Unclassified 687
6 Ga0070690_100086369 3300005330 Bacteria 2059
7 Ga0070690_100493152 3300005330 Unclassified 915
8 Ga0070670_100034923 3300005331 Bacteria 4327
9 Ga0070670_100513271 3300005331 Bacteria 1067
10 Ga0068869_100035915 3300005334 Bacteria 3516
11 Ga0070666_10067657 3300005335 Bacteria 2425
12 Ga0068868_100695596 3300005338 Bacteria 909
13 Ga0070691_10523902 3300005341 Bacteria 688
14 Ga0070687_100086207 3300005343 Bacteria 1725
15 Ga0070687_101182321 3300005343 Unclassified 563
16 Ga0070668_100146250 3300005347 Unclassified 1908
17 Ga0070668_101636268 3300005347 Unclassified 590
18 Ga0070669_100014313 3300005353 Bacteria 5646
19 Ga0070669_100870357 3300005353 Bacteria 768
20 Ga0070671_100110755 3300005355 Bacteria 2306
21 Ga0070674_100071604 3300005356 Bacteria 2452
22 Ga0070673_100004918 3300005364 Bacteria 8509
23 Ga0070673_100045811 3300005364 Unclassified 3394
24 Ga0070703_10049496 3300005406 Unclassified 1338
25 Ga0070709_10013407 3300005434 Bacteria 4608
26 Ga0070709_11102363 3300005434 Unclassified 635
27 Ga0070713_100014097 3300005436 Bacteria 5921
28 Ga0070710_10503228 3300005437 Bacteria 830
29 Ga0070701_10223228 3300005438 Bacteria 1125
30 Ga0070711_100048259 3300005439 Bacteria 2910
31 Ga0070711_101041766 3300005439 Unclassified 703
32 Ga0070705_100010889 3300005440 Unclassified 4568
33 Ga0070705_100103852 3300005440 Bacteria 1801
34 Ga0070700_100264876 3300005441 Bacteria 1239
35 Ga0070694_100254588 3300005444 Unclassified 1329
36 Ga0070708_100000495 3300005445 Bacteria 29676
37 Ga0070708_100773451 3300005445 Bacteria 903
38 Ga0070708_100976517 3300005445 Bacteria 794
39 Ga0070681_10203560 3300005458 Unclassified 1897
40 Ga0070681_10283779 3300005458 Bacteria 1566
41 Ga0068867_101842861 3300005459 Unclassified 569
42 Ga0070685_11041555 3300005466 Bacteria 616
43 Ga0070706_100007944 3300005467 Bacteria 9905
44 Ga0070706_100615246 3300005467 Bacteria 1009
45 Ga0070706_100964781 3300005467 Unclassified 787
46 Ga0070707_100671765 3300005468 Unclassified 999
47 Ga0070707_101421924 3300005468 Bacteria 660
48 Ga0070699_100009693 3300005518 Bacteria 8339
49 Ga0070699_100135336 3300005518 Unclassified 2174
50 Ga0070699_101901588 3300005518 Unclassified 544
51 Ga0070679_100006710 3300005530 Bacteria 10735
52 Ga0070697_100000335 3300005536 Bacteria 37062
53 Ga0070672_100217760 3300005543 Bacteria 1601
54 Ga0070686_100060759 3300005544 Bacteria 2439
55 Ga0070686_100174563 3300005544 Bacteria 1522
56 Ga0070695_100006165 3300005545 Bacteria 7087
57 Ga0070696_100056788 3300005546 Unclassified 2731
58 Ga0070693_100000363 3300005547 Bacteria 20578
59 Ga0070693_100055217 3300005547 Bacteria 2287
60 Ga0070704_100002936 3300005549 Bacteria 9687
61 Ga0070704_100028320 3300005549 Bacteria 3726
62 Ga0068857_100137759 3300005577 Unclassified 2205
63 Ga0068854_100295966 3300005578 Bacteria 1308
64 Ga0070702_100108309 3300005615 Bacteria 1717
65 Ga0068859_100024106 3300005617 Bacteria 6106
66 Ga0068859_100031459 3300005617 Bacteria 5330
67 Ga0068859_101319950 3300005617 Bacteria 795
68 Ga0068859_101343589 3300005617 Unclassified 788
69 Ga0068864_100007217 3300005618 Bacteria 9133
70 Ga0068863_100062334 3300005841 Bacteria 3526
71 Ga0068863_101989358 3300005841 Unclassified 591
72 Ga0068858_100210337 3300005842 Bacteria 1841
73 Ga0068860_100989750 3300005843 Bacteria 859
74 Ga0068860_101524209 3300005843 Bacteria 690
75 Ga0068862_100002274 3300005844 Bacteria 17192
76 Ga0068862_100390546 3300005844 Bacteria 1300
77 Ga0081455_10036252 3300005937 Bacteria 4394
78 Ga0081539_10151298 3300005985 Bacteria 1116
79 Ga0070717_10485839 3300006028 Unclassified 1115
80 Ga0075368_10004374 3300006042 Bacteria 4782
81 Ga0075364_10005180 3300006051 Bacteria 7563
82 Ga0075364_10011219 3300006051 Bacteria 5440
83 Ga0075362_10001303 3300006177 Bacteria 7905
84 Ga0075367_10003035 3300006178 Bacteria 7863
85 Ga0075367_10818991 3300006178 Bacteria 593
86 Ga0075366_10060914 3300006195 Bacteria 2242
87 Ga0097621_100000656 3300006237 Bacteria 24387
88 Ga0068871_100000723 3300006358 Bacteria 22375
89 Ga0075428_100057955 3300006844 Bacteria 4241
90 Ga0075428_100641491 3300006844 Bacteria 1133
91 Ga0075431_100020174 3300006847 Bacteria 6807
92 Ga0075433_10019555 3300006852 Bacteria 5646
93 Ga0075433_10269993 3300006852 Bacteria 1507
94 Ga0075433_10647605 3300006852 Bacteria 926
95 Ga0075434_100114546 3300006871 Bacteria 2709
96 Ga0075434_100293140 3300006871 Bacteria 1647
97 Ga0075429_100523659 3300006880 Bacteria 1039
98 Ga0068865_100127481 3300006881 Bacteria 1902
99 Ga0075436_100695605 3300006914 Bacteria 753
100 Ga0097620_100024107 3300006931 Bacteria 6106
101 Ga0097620_100031459 3300006931 Bacteria 5330
102 Ga0097620_101319704 3300006931 Bacteria 795
103 Ga0097620_101343227 3300006931 Unclassified 788
104 Ga0075435_100034264 3300007076 Bacteria 4022
105 Ga0075435_100213805 3300007076 Unclassified 1636
106 Ga0075435_100535144 3300007076 Bacteria 1014
107 Ga0075435_100698298 3300007076 Unclassified 882
108 Ga0075435_100807986 3300007076 Bacteria 817
109 Ga0099794_10053467 3300007265 Bacteria 1948
110 Ga0099794_10164934 3300007265 Bacteria 1128
111 Ga0099794_10193569 3300007265 Bacteria 1040
112 Ga0111539_10087501 3300009094 Bacteria 3660
113 Ga0111539_10250332 3300009094 Bacteria 2063
114 Ga0111539_10564692 3300009094 Bacteria 1325
115 Ga0105245_10965049 3300009098 Bacteria 896
116 Ga0105247_10367365 3300009101 Bacteria 1016
117 Ga0114129_10002050 3300009147 Bacteria 27658
118 Ga0114129_12365987 3300009147 Unclassified 637
119 Ga0105243_10780555 3300009148 Unclassified 940
120 Ga0105241_10356024 3300009174 Bacteria 1272
121 Ga0105242_10540265 3300009176 Bacteria 1115
122 Ga0105248_10060979 3300009177 Bacteria 4234
123 Ga0105248_11125066 3300009177 Unclassified 888
124 Ga0105249_10074276 3300009553 Unclassified 3147
125 Ga0105249_10457493 3300009553 Bacteria 1316
126 Ga0105249_10835654 3300009553 Bacteria 986
127 Ga0099796_10272933 3300010159 Bacteria 709
128 Ga0157373_10321660 3300013100 Bacteria 1100
129 Ga0163163_10032703 3300014325 Bacteria 5026
130 Ga0157380_10014470 3300014326 Bacteria 5772
131 Ga0157380_10668192 3300014326 Unclassified 1039
132 Ga0157380_10870151 3300014326 Unclassified 925
133 Ga0157380_13011813 3300014326 Unclassified 537
134 Ga0207697_10043177 3300025315 Bacteria 1854
135 Ga0207653_10006485 3300025885 Bacteria 3650
136 Ga0207653_10211810 3300025885 Bacteria 733
137 Ga0207692_10657325 3300025898 Unclassified 678
138 Ga0207688_10487293 3300025901 Bacteria 771
139 Ga0207680_10030619 3300025903 Bacteria 3038
140 Ga0207647_10191121 3300025904 Bacteria 1186
141 Ga0207645_10014116 3300025907 Bacteria 5352
142 Ga0207643_10248963 3300025908 Bacteria 1094
143 Ga0207684_10002645 3300025910 Bacteria 17926
144 Ga0207684_10627267 3300025910 Bacteria 917
145 Ga0207684_10665139 3300025910 Bacteria 887
146 Ga0207707_10043894 3300025912 Bacteria 3898
147 Ga0207707_10202826 3300025912 Unclassified 1729
148 Ga0207693_10030086 3300025915 Bacteria 4287
149 Ga0207663_11122532 3300025916 Unclassified 632
150 Ga0207660_10176581 3300025917 Unclassified 1656
151 Ga0207652_10057563 3300025921 Unclassified 3348
152 Ga0207652_10354595 3300025921 Bacteria 1324
153 Ga0207681_10101022 3300025923 Bacteria 2080
154 Ga0207681_10119804 3300025923 Bacteria 1928
155 Ga0207650_10022735 3300025925 Bacteria 4442
156 Ga0207659_11136354 3300025926 Bacteria 672
157 Ga0207687_10222731 3300025927 Bacteria 1486
158 Ga0207700_10015807 3300025928 Bacteria 4992
159 Ga0207690_10460272 3300025932 Bacteria 1023
160 Ga0207706_10539026 3300025933 Bacteria 1005
161 Ga0207686_10970881 3300025934 Unclassified 688
162 Ga0207709_10151480 3300025935 Unclassified 1607
163 Ga0207669_10055235 3300025937 Bacteria 2404
164 Ga0207691_10062009 3300025940 Bacteria 3395
165 Ga0207711_10095082 3300025941 Bacteria 2627
166 Ga0207689_10092578 3300025942 Bacteria 2483
167 Ga0207651_10002497 3300025960 Bacteria 8773
168 Ga0207651_11052224 3300025960 Bacteria 728
169 Ga0207668_10182597 3300025972 Unclassified 1656
170 Ga0207640_10934580 3300025981 Bacteria 759
171 Ga0207658_11229821 3300025986 Bacteria 685
172 Ga0207677_10677596 3300026023 Bacteria 913
173 Ga0207703_10162960 3300026035 Bacteria 1954
174 Ga0207708_10080392 3300026075 Bacteria 2504
175 Ga0207708_10380949 3300026075 Unclassified 1163
176 Ga0207641_10013283 3300026088 Bacteria 6756
177 Ga0207648_10016652 3300026089 Bacteria 6709
178 Ga0207676_10184592 3300026095 Bacteria 1829
179 Ga0207674_10236836 3300026116 Bacteria 1773
180 Ga0207675_100574350 3300026118 Bacteria 1128
181 Ga0207683_10049737 3300026121 Bacteria 3671
182 Ga0207683_10200270 3300026121 Unclassified 1815
183 Ga0209588_1032582 3300027671 Bacteria 1670
184 Ga0209813_10009325 3300027866 Unclassified 2507
185 Ga0207428_10276264 3300027907 Bacteria 1248
186 Ga0268265_10015644 3300028380 Bacteria 5194
187 Ga0373938_0181215 3300034957 Bacteria 575
188 Ga0373949_0129413 3300035090 Bacteria 715
189 Ga0373923_0593755 3300035111 Bacteria 545
190 Ga0373932_0450477 3300035112 Bacteria 505
191 Ga0373943_0261327 3300035170 Unclassified 975
192 Ga0373931_0647112 3300035691 Bacteria 694
193 Ga0373935_0578763 3300035692 Bacteria 820
194 Ga0436365_1526740 3300039437 Unclassified 512
195 Ga0439446_0112160 3300042156 Bacteria 871
196 Ga0466963_0188069 3300044694 Unclassified 1443
197 Ga0495592_0070985 3300046454 Unclassified 2536
198 Ga0495592_0206517 3300046454 Unclassified 1322
199 Ga0495603_0743896 3300046455 Unclassified 560
200 Ga0495629_0111175 3300046459 Bacteria 1910
201 Ga0495580_0039786 3300046472 Bacteria 3364
202 Ga0495580_0873329 3300046472 Bacteria 579
203 Ga0495582_0300009 3300046473 Bacteria 923
204 Ga0495664_0157070 3300046477 Unclassified 1380
205 Ga0495608_0007428 3300046511 Bacteria 7743
206 Ga0495628_0003036 3300046516 Bacteria 15050
207 Ga0495628_0046322 3300046516 Bacteria 3454
208 Ga0495630_0002332 3300046517 Bacteria 13208
209 Ga0495630_0651143 3300046517 Unclassified 807
210 Ga0495652_0280253 3300046529 Bacteria 1221
211 Ga0495665_0399888 3300046531 Bacteria 697
212 Ga0495640_0304737 3300046533 Bacteria 989
213 Ga0495586_0176130 3300046535 Bacteria 1209
214 Ga0495587_0001538 3300046536 Bacteria 15327
215 Ga0495587_0137343 3300046536 Bacteria 1396
216 Ga0495645_0004645 3300046543 Bacteria 9373
217 Ga0495645_0051538 3300046543 Bacteria 2994
218 Ga0495635_0160793 3300046663 Bacteria 1528
219 Ga0495635_0202502 3300046663 Bacteria 1346
220 Ga0495657_0059434 3300046675 Bacteria 2536
221 Ga0495623_0582880 3300046679 Bacteria 583
222 Ga0495658_1074216 3300046683 Unclassified 513
223 Ga0495669_0017360 3300046684 Bacteria 3088
224 Ga0495613_0003284 3300046689 Bacteria 12096
225 Ga0495600_0034458 3300046809 Bacteria 3287
226 Ga0495581_0720285 3300047315 Bacteria 575
227 Ga0495604_0046402 3300047317 Bacteria 3387
228 Ga0495604_0646154 3300047317 Unclassified 675
229 Ga0495674_0704207 3300047319 Unclassified 792
230 Ga0495674_0826704 3300047319 Unclassified 719
231 Ga0495676_0593154 3300047321 Bacteria 722
232 Ga0495684_0001466 3300047471 Bacteria 18891
233 Ga0495602_0770524 3300048088 Bacteria 648
234 Ga0496100_1445336 3300048903 Bacteria 543
235 Ga0496102_1533976 3300048905 Bacteria 585
236 Ga0496103_0191583 3300048906 Bacteria 1315
237 Ga0496103_0981218 3300048906 Bacteria 527
238 Ga0496104_0078281 3300048907 Unclassified 3151
239 Ga0496108_0672875 3300048911 Bacteria 899
240 Ga0496110_0907547 3300048913 Bacteria 787
241 Ga0496114_0014668 3300048917 Bacteria 6296
242 Ga0496115_0451256 3300048918 Bacteria 1038
243 Ga0501031_0008055 3300049568 Bacteria 6862
244 Ga0501033_0001377 3300049570 Bacteria 21662
245 Ga0501037_0006531 3300049573 Bacteria 8534
246 Ga0501038_0019041 3300049574 Bacteria 6194
247 Ga0501038_0035227 3300049574 Bacteria 4395
248 Ga0501039_0009454 3300049575 Bacteria 7432
249 Ga0501039_0019713 3300049575 Bacteria 5171
250 Ga0501039_0917945 3300049575 Unclassified 681
251 Ga0501040_0004908 3300049576 Bacteria 8657
252 Ga0501040_0313159 3300049576 Bacteria 1122
253 Ga0501041_0004776 3300049577 Bacteria 7866
254 Ga0501042_0021665 3300049578 Bacteria 4482
255 Ga0501042_0067956 3300049578 Bacteria 2548
256 Ga0501043_0158245 3300049579 Bacteria 1771
257 Ga0501046_0002287 3300049580 Bacteria 18066
258 Ga0501047_0020019 3300049581 Bacteria 6425
259 Ga0501048_0000550 3300049582 Bacteria 26481
260 Ga0501067_0065776 3300049583 Bacteria 2007
261 Ga0501067_0631782 3300049583 Bacteria 601
262 Ga0501068_0006614 3300049584 Bacteria 6397
263 Ga0501068_0052817 3300049584 Bacteria 2459
264 Ga0501071_0017965 3300049587 Bacteria 4890
265 Ga0501072_0052741 3300049588 Bacteria 3202
266 Ga0501072_0235468 3300049588 Unclassified 1458
267 Ga0501072_1291984 3300049588 Bacteria 566
268 Ga0501073_0013116 3300049589 Bacteria 6043
269 Ga0501075_0015061 3300049591 Bacteria 5547
270 Ga0501075_0374173 3300049591 Unclassified 1086
271 Ga0501075_0777699 3300049591 Unclassified 729
272 Ga0501075_1127547 3300049591 Bacteria 595
273 Ga0501076_0046299 3300049592 Bacteria 3436
274 Ga0501076_0141170 3300049592 Bacteria 1957
275 Ga0501077_0415042 3300049593 Bacteria 861
276 Ga0501079_0005508 3300049741 Bacteria 9435
277 Ga0501079_0293663 3300049741 Unclassified 1271
278 Ga0501079_0640905 3300049741 Unclassified 837
279 Ga0501080_0005166 3300049742 Bacteria 11628
280 Ga0501080_0011555 3300049742 Bacteria 8086
281 Ga0501081_0000137 3300049743 Bacteria 32579
282 Ga0501083_0015766 3300049744 Bacteria 5289
283 Ga0501083_0479979 3300049744 Unclassified 809
284 Ga0501035_0129777 3300049822 Bacteria 2198
285 Ga0501045_0003017 3300049824 Bacteria 11527
286 Ga0501045_0023635 3300049824 Bacteria 4408
287 nmdc:mga03683_440258_c1 3300050489 Unclassified 626
288 nmdc:mga03683_78259_c1 3300050489 Bacteria 1424
289 nmdc:mga03n38_312042_c1 3300050490 Unclassified 847
290 nmdc:mga00v17_27618_c1 3300050491 Unclassified 3316
291 nmdc:mga00v17_89201_c1 3300050491 Unclassified 1935
292 nmdc:mga0yw44_161470_c1 3300050492 Unclassified 1467
293 nmdc:mga0k408_40437_c2 3300050493 Bacteria 1284
294 nmdc:mga06z11_124716_c1 3300050494 Bacteria 1440
295 nmdc:mga06z11_51634_c1 3300050494 Unclassified 2106
296 nmdc:mga06z11_727785_c1 3300050494 Bacteria 604
297 nmdc:mga04h51_4585_c1 3300050495 Bacteria 3454
298 nmdc:mga04h51_9643_c1 3300050495 Bacteria 2626
299 nmdc:mga07m45_45172_c1 3300050496 Bacteria 2473
300 nmdc:mga05p37_20495_c1 3300050507 Bacteria 7998
301 nmdc:mga05p37_39939_c1 3300050507 Bacteria 5762
302 nmdc:mga05p37_457044_c1 3300050507 Unclassified 1476
303 nmdc:mga0qj67_1313797_c1 3300050509 Unclassified 560
304 nmdc:mga0qj67_378938_c1 3300050509 Bacteria 1142
305 nmdc:mga06r32_82130_c1 3300050510 Bacteria 3139
306 nmdc:mga08y16_156284_c1 3300050511 Bacteria 2370
307 nmdc:mga0n895_110245_c1 3300050512 Bacteria 2768
308 nmdc:mga0n895_192543_c1 3300050512 Bacteria 2070
309 nmdc:mga0rr50_114379_c1 3300050513 Bacteria 2140
310 nmdc:mga0rr50_230708_c1 3300050513 Unclassified 1531
311 nmdc:mga0rr50_756875_c1 3300050513 Unclassified 829
312 nmdc:mga0rr50_802092_c1 3300050513 Unclassified 803
313 nmdc:mga08x19_527661_c1 3300050514 Bacteria 835
314 nmdc:mga0a205_1002897_c1 3300050515 Bacteria 682
315 nmdc:mga0a205_21037_c1 3300050515 Bacteria 6167
316 Ga0495601_0007078 3300053077 Bacteria 6572
317 Ga0495601_0013185 3300053077 Bacteria 4970
318 Ga0495612_0031671 3300053078 Bacteria 2133
319 Ga0495619_0001983 3300053085 Bacteria 13623
320 Ga0501084_0001835 3300054114 Bacteria 16932
321 Ga0501084_0229150 3300054114 Unclassified 1568
322 Ga0501084_0745959 3300054114 Unclassified 825
323 Ga0501082_0005375 3300060353 Bacteria 11113
324 Ga0501082_0502648 3300060353 Bacteria 1059
325 Ga0501082_1277659 3300060353 Unclassified 641
326 Ga0530510_0002830 3300061734 Bacteria 11934

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003203 JGI25406J46586_10142390 JGI25406J46586_101423901 97
2 3300005468 Ga0070707_100671765 Ga0070707_1006717651 97
3 3300007076 Ga0075435_100535144 Ga0075435_1005351442 97
4 3300009553 Ga0105249_10457493 Ga0105249_104574932 97
5 3300014326 Ga0157380_10870151 Ga0157380_108701511 97
6 3300048906 Ga0496103_0191583 Ga0496103_0191583_871_1164 97
7 3300048913 Ga0496110_0907547 Ga0496110_0907547_440_733 97
8 3300049588 Ga0501072_0235468 Ga0501072_0235468_12_305 97
9 3300050509 nmdc:mga0qj67_378938_c1 nmdc:mga0qj67_378938_c1_750_1043 97
10 3300060353 Ga0501082_1277659 Ga0501082_1277659_77_370 97
11 3300009094 Ga0111539_10564692 Ga0111539_105646922 105
12 3300009177 Ga0105248_11125066 Ga0105248_111250661 105
13 3300014326 Ga0157380_10014470 Ga0157380_100144704 105
14 3300050511 nmdc:mga08y16_156284_c1 nmdc:mga08y16_156284_c1_1881_2198 105
15 3300050513 nmdc:mga0rr50_756875_c1 nmdc:mga0rr50_756875_c1_83_400 105
16 3300005406 Ga0070703_10049496 Ga0070703_100494962 109
17 3300005439 Ga0070711_101041766 Ga0070711_1010417662 109
18 3300005440 Ga0070705_100010889 Ga0070705_1000108891 109
19 3300005444 Ga0070694_100254588 Ga0070694_1002545882 109
20 3300005445 Ga0070708_100000495 Ga0070708_10000049521 109
21 3300005458 Ga0070681_10203560 Ga0070681_102035603 109
22 3300005467 Ga0070706_100007944 Ga0070706_1000079445 109
23 3300005518 Ga0070699_100009693 Ga0070699_1000096933 109
24 3300005530 Ga0070679_100006710 Ga0070679_1000067109 109
25 3300005536 Ga0070697_100000335 Ga0070697_10000033516 109
26 3300005545 Ga0070695_100006165 Ga0070695_1000061656 109
27 3300005546 Ga0070696_100056788 Ga0070696_1000567882 109
28 3300005547 Ga0070693_100000363 Ga0070693_1000003631 109
29 3300005549 Ga0070704_100002936 Ga0070704_1000029367 109
30 3300007265 Ga0099794_10053467 Ga0099794_100534672 109
31 3300007265 Ga0099794_10164934 Ga0099794_101649341 109
32 3300025885 Ga0207653_10006485 Ga0207653_100064852 109
33 3300025910 Ga0207684_10002645 Ga0207684_100026455 109
34 3300025912 Ga0207707_10202826 Ga0207707_102028263 109
35 3300025917 Ga0207660_10176581 Ga0207660_101765812 109
36 3300025921 Ga0207652_10057563 Ga0207652_100575633 109
37 3300026023 Ga0207677_10677596 Ga0207677_106775961 109
38 3300027671 Ga0209588_1032582 Ga0209588_10325823 109
39 3300046517 Ga0495630_0651143 Ga0495630_0651143_195_524 109
40 3300046536 Ga0495587_0001538 Ga0495587_0001538_6925_7254 109
41 3300047317 Ga0495604_0646154 Ga0495604_0646154_90_419 109
42 3300049591 Ga0501075_0777699 Ga0501075_0777699_49_399 109
43 3300049593 Ga0501077_0415042 Ga0501077_0415042_83_433 109
44 3300005295 Ga0065707_10605438 Ga0065707_106054382 110
45 3300005330 Ga0070690_100086369 Ga0070690_1000863691 110
46 3300005334 Ga0068869_100035915 Ga0068869_1000359154 110
47 3300005335 Ga0070666_10067657 Ga0070666_100676572 110
48 3300005338 Ga0068868_100695596 Ga0068868_1006955962 110
49 3300005341 Ga0070691_10523902 Ga0070691_105239022 110
50 3300005343 Ga0070687_100086207 Ga0070687_1000862072 110
51 3300005353 Ga0070669_100870357 Ga0070669_1008703571 110
52 3300005355 Ga0070671_100110755 Ga0070671_1001107551 110
53 3300005356 Ga0070674_100071604 Ga0070674_1000716042 110
54 3300005364 Ga0070673_100004918 Ga0070673_1000049186 110
55 3300005434 Ga0070709_10013407 Ga0070709_100134071 110
56 3300005434 Ga0070709_11102363 Ga0070709_111023631 110
57 3300005436 Ga0070713_100014097 Ga0070713_1000140974 110
58 3300005438 Ga0070701_10223228 Ga0070701_102232282 110
59 3300005439 Ga0070711_100048259 Ga0070711_1000482592 110
60 3300005440 Ga0070705_100103852 Ga0070705_1001038522 110
61 3300005466 Ga0070685_11041555 Ga0070685_110415551 110
62 3300005543 Ga0070672_100217760 Ga0070672_1002177603 110
63 3300005544 Ga0070686_100060759 Ga0070686_1000607593 110
64 3300005544 Ga0070686_100174563 Ga0070686_1001745632 110
65 3300005547 Ga0070693_100055217 Ga0070693_1000552172 110
66 3300005549 Ga0070704_100028320 Ga0070704_1000283203 110
67 3300005578 Ga0068854_100295966 Ga0068854_1002959661 110
68 3300005615 Ga0070702_100108309 Ga0070702_1001083092 110
69 3300005617 Ga0068859_100024106 Ga0068859_1000241067 110
70 3300005841 Ga0068863_100062334 Ga0068863_1000623342 110
71 3300005841 Ga0068863_101989358 Ga0068863_1019893582 110
72 3300005842 Ga0068858_100210337 Ga0068858_1002103373 110
73 3300005843 Ga0068860_100989750 Ga0068860_1009897502 110
74 3300005844 Ga0068862_100390546 Ga0068862_1003905462 110
75 3300006881 Ga0068865_100127481 Ga0068865_1001274811 110
76 3300006914 Ga0075436_100695605 Ga0075436_1006956051 110
77 3300006931 Ga0097620_100024107 Ga0097620_1000241072 110
78 3300007076 Ga0075435_100034264 Ga0075435_1000342642 110
79 3300007076 Ga0075435_100213805 Ga0075435_1002138052 110
80 3300009098 Ga0105245_10965049 Ga0105245_109650492 110
81 3300009101 Ga0105247_10367365 Ga0105247_103673652 110
82 3300009148 Ga0105243_10780555 Ga0105243_107805552 110
83 3300009174 Ga0105241_10356024 Ga0105241_103560242 110
84 3300009176 Ga0105242_10540265 Ga0105242_105402652 110
85 3300009177 Ga0105248_10060979 Ga0105248_100609792 110
86 3300010159 Ga0099796_10272933 Ga0099796_102729332 110
87 3300013100 Ga0157373_10321660 Ga0157373_103216602 110
88 3300025315 Ga0207697_10043177 Ga0207697_100431772 110
89 3300025885 Ga0207653_10211810 Ga0207653_102118102 110
90 3300025898 Ga0207692_10657325 Ga0207692_106573251 110
91 3300025903 Ga0207680_10030619 Ga0207680_100306193 110
92 3300025904 Ga0207647_10191121 Ga0207647_101911212 110
93 3300025907 Ga0207645_10014116 Ga0207645_100141164 110
94 3300025916 Ga0207663_11122532 Ga0207663_111225321 110
95 3300025923 Ga0207681_10101022 Ga0207681_101010223 110
96 3300025927 Ga0207687_10222731 Ga0207687_102227312 110
97 3300025928 Ga0207700_10015807 Ga0207700_100158073 110
98 3300025932 Ga0207690_10460272 Ga0207690_104602722 110
99 3300025933 Ga0207706_10539026 Ga0207706_105390261 110
100 3300025935 Ga0207709_10151480 Ga0207709_101514802 110
101 3300025937 Ga0207669_10055235 Ga0207669_100552352 110
102 3300025940 Ga0207691_10062009 Ga0207691_100620093 110
103 3300025941 Ga0207711_10095082 Ga0207711_100950822 110
104 3300025942 Ga0207689_10092578 Ga0207689_100925782 110
105 3300025960 Ga0207651_10002497 Ga0207651_100024976 110
106 3300025981 Ga0207640_10934580 Ga0207640_109345802 110
107 3300025986 Ga0207658_11229821 Ga0207658_112298212 110
108 3300026035 Ga0207703_10162960 Ga0207703_101629602 110
109 3300026075 Ga0207708_10080392 Ga0207708_100803922 110
110 3300026088 Ga0207641_10013283 Ga0207641_100132835 110
111 3300026089 Ga0207648_10016652 Ga0207648_100166525 110
112 3300026118 Ga0207675_100574350 Ga0207675_1005743502 110
113 3300026121 Ga0207683_10049737 Ga0207683_100497372 110
114 3300035090 Ga0373949_0129413 Ga0373949_0129413_251_586 110
115 3300035170 Ga0373943_0261327 Ga0373943_0261327_352_750 110
116 3300039437 Ga0436365_1526740 Ga0436365_1526740_46_381 110
117 3300044694 Ga0466963_0188069 Ga0466963_0188069_231_566 110
118 3300046454 Ga0495592_0206517 Ga0495592_0206517_900_1235 110
119 3300046455 Ga0495603_0743896 Ga0495603_0743896_30_380 110
120 3300046459 Ga0495629_0111175 Ga0495629_0111175_34_384 110
121 3300046477 Ga0495664_0157070 Ga0495664_0157070_1024_1359 110
122 3300046516 Ga0495628_0003036 Ga0495628_0003036_13198_13533 110
123 3300046543 Ga0495645_0004645 Ga0495645_0004645_584_919 110
124 3300046663 Ga0495635_0202502 Ga0495635_0202502_972_1322 110
125 3300047319 Ga0495674_0704207 Ga0495674_0704207_281_616 110
126 3300047319 Ga0495674_0826704 Ga0495674_0826704_348_698 110
127 3300048903 Ga0496100_1445336 Ga0496100_1445336_141_476 110
128 3300048905 Ga0496102_1533976 Ga0496102_1533976_41_376 110
129 3300048906 Ga0496103_0981218 Ga0496103_0981218_169_504 110
130 3300048907 Ga0496104_0078281 Ga0496104_0078281_100_435 110
131 3300048917 Ga0496114_0014668 Ga0496114_0014668_575_925 110
132 3300048918 Ga0496115_0451256 Ga0496115_0451256_440_775 110
133 3300050512 nmdc:mga0n895_192543_c1 nmdc:mga0n895_192543_c1_1672_2007 110
134 3300050513 nmdc:mga0rr50_114379_c1 nmdc:mga0rr50_114379_c1_1535_1870 110
135 3300050513 nmdc:mga0rr50_230708_c1 nmdc:mga0rr50_230708_c1_509_844 110
136 3300050514 nmdc:mga08x19_527661_c1 nmdc:mga08x19_527661_c1_427_762 110
137 3300053077 Ga0495601_0007078 Ga0495601_0007078_2540_2875 110
138 3300053078 Ga0495612_0031671 Ga0495612_0031671_878_1213 110
139 3300005293 Ga0065715_10136752 Ga0065715_101367522 111
140 3300005331 Ga0070670_100513271 Ga0070670_1005132711 111
141 3300005343 Ga0070687_101182321 Ga0070687_1011823211 111
142 3300005617 Ga0068859_101319950 Ga0068859_1013199502 111
143 3300005985 Ga0081539_10151298 Ga0081539_101512982 111
144 3300006844 Ga0075428_100641491 Ga0075428_1006414912 111
145 3300006852 Ga0075433_10269993 Ga0075433_102699932 111
146 3300006871 Ga0075434_100293140 Ga0075434_1002931401 111
147 3300006931 Ga0097620_101319704 Ga0097620_1013197042 111
148 3300007076 Ga0075435_100807986 Ga0075435_1008079862 111
149 3300009094 Ga0111539_10250332 Ga0111539_102503322 111
150 3300025901 Ga0207688_10487293 Ga0207688_104872932 111
151 3300025908 Ga0207643_10248963 Ga0207643_102489632 111
152 3300025926 Ga0207659_11136354 Ga0207659_111363542 111
153 3300025934 Ga0207686_10970881 Ga0207686_109708811 111
154 3300026121 Ga0207683_10200270 Ga0207683_102002702 111
155 3300042156 Ga0439446_0112160 Ga0439446_0112160_29_391 111
156 3300048911 Ga0496108_0672875 Ga0496108_0672875_253_603 111
157 3300049575 Ga0501039_0917945 Ga0501039_0917945_296_646 111
158 3300049588 Ga0501072_1291984 Ga0501072_1291984_196_546 111
159 3300049591 Ga0501075_0374173 Ga0501075_0374173_213_563 111
160 3300049591 Ga0501075_1127547 Ga0501075_1127547_15_371 111
161 3300049741 Ga0501079_0293663 Ga0501079_0293663_348_698 111
162 3300054114 Ga0501084_0229150 Ga0501084_0229150_718_1068 111
163 3300005445 Ga0070708_100976517 Ga0070708_1009765172 112
164 3300006028 Ga0070717_10485839 Ga0070717_104858392 112
165 3300006178 Ga0075367_10818991 Ga0075367_108189912 112
166 3300049583 Ga0501067_0065776 Ga0501067_0065776_847_1185 112
167 3300049741 Ga0501079_0640905 Ga0501079_0640905_129_470 112
168 3300050494 nmdc:mga06z11_727785_c1 nmdc:mga06z11_727785_c1_149_490 112
169 3300054114 Ga0501084_0745959 Ga0501084_0745959_303_644 112
170 3300002459 JGI24751J29686_10001729 JGI24751J29686_100017293 113
171 3300005295 Ga0065707_10149969 Ga0065707_101499692 113
172 3300005330 Ga0070690_100493152 Ga0070690_1004931522 113
173 3300005331 Ga0070670_100034923 Ga0070670_1000349233 113
174 3300005347 Ga0070668_100146250 Ga0070668_1001462502 113
175 3300005347 Ga0070668_101636268 Ga0070668_1016362682 113
176 3300005353 Ga0070669_100014313 Ga0070669_1000143135 113
177 3300005364 Ga0070673_100045811 Ga0070673_1000458112 113
178 3300005437 Ga0070710_10503228 Ga0070710_105032282 113
179 3300005441 Ga0070700_100264876 Ga0070700_1002648762 113
180 3300005445 Ga0070708_100773451 Ga0070708_1007734511 113
181 3300005458 Ga0070681_10283779 Ga0070681_102837792 113
182 3300005459 Ga0068867_101842861 Ga0068867_1018428611 113
183 3300005467 Ga0070706_100615246 Ga0070706_1006152462 113
184 3300005467 Ga0070706_100964781 Ga0070706_1009647812 113
185 3300005468 Ga0070707_101421924 Ga0070707_1014219241 113
186 3300005518 Ga0070699_100135336 Ga0070699_1001353362 113
187 3300005518 Ga0070699_101901588 Ga0070699_1019015881 113
188 3300005577 Ga0068857_100137759 Ga0068857_1001377593 113
189 3300005617 Ga0068859_100031459 Ga0068859_1000314595 113
190 3300005617 Ga0068859_101343589 Ga0068859_1013435892 113
191 3300005618 Ga0068864_100007217 Ga0068864_1000072171 113
192 3300005843 Ga0068860_101524209 Ga0068860_1015242092 113
193 3300005844 Ga0068862_100002274 Ga0068862_1000022745 113
194 3300005937 Ga0081455_10036252 Ga0081455_100362524 113
195 3300006042 Ga0075368_10004374 Ga0075368_100043744 113
196 3300006051 Ga0075364_10005180 Ga0075364_100051809 113
197 3300006051 Ga0075364_10011219 Ga0075364_100112193 113
198 3300006177 Ga0075362_10001303 Ga0075362_1000130311 113
199 3300006178 Ga0075367_10003035 Ga0075367_100030355 113
200 3300006195 Ga0075366_10060914 Ga0075366_100609142 113
201 3300006237 Ga0097621_100000656 Ga0097621_10000065615 113
202 3300006358 Ga0068871_100000723 Ga0068871_10000072315 113
203 3300006844 Ga0075428_100057955 Ga0075428_1000579552 113
204 3300006847 Ga0075431_100020174 Ga0075431_1000201746 113
205 3300006852 Ga0075433_10019555 Ga0075433_100195554 113
206 3300006852 Ga0075433_10647605 Ga0075433_106476052 113
207 3300006871 Ga0075434_100114546 Ga0075434_1001145463 113
208 3300006880 Ga0075429_100523659 Ga0075429_1005236592 113
209 3300006931 Ga0097620_100031459 Ga0097620_1000314595 113
210 3300006931 Ga0097620_101343227 Ga0097620_1013432272 113
211 3300007076 Ga0075435_100698298 Ga0075435_1006982982 113
212 3300007265 Ga0099794_10193569 Ga0099794_101935691 113
213 3300009094 Ga0111539_10087501 Ga0111539_100875011 113
214 3300009147 Ga0114129_10002050 Ga0114129_1000205011 113
215 3300009147 Ga0114129_12365987 Ga0114129_123659871 113
216 3300009553 Ga0105249_10074276 Ga0105249_100742761 113
217 3300009553 Ga0105249_10835654 Ga0105249_108356542 113
218 3300014325 Ga0163163_10032703 Ga0163163_100327034 113
219 3300014326 Ga0157380_10668192 Ga0157380_106681922 113
220 3300014326 Ga0157380_13011813 Ga0157380_130118132 113
221 3300025910 Ga0207684_10627267 Ga0207684_106272672 113
222 3300025910 Ga0207684_10665139 Ga0207684_106651392 113
223 3300025912 Ga0207707_10043894 Ga0207707_100438943 113
224 3300025915 Ga0207693_10030086 Ga0207693_100300861 113
225 3300025921 Ga0207652_10354595 Ga0207652_103545952 113
226 3300025923 Ga0207681_10119804 Ga0207681_101198041 113
227 3300025925 Ga0207650_10022735 Ga0207650_100227355 113
228 3300025960 Ga0207651_11052224 Ga0207651_110522242 113
229 3300025972 Ga0207668_10182597 Ga0207668_101825972 113
230 3300026075 Ga0207708_10380949 Ga0207708_103809491 113
231 3300026095 Ga0207676_10184592 Ga0207676_101845923 113
232 3300026116 Ga0207674_10236836 Ga0207674_102368362 113
233 3300027866 Ga0209813_10009325 Ga0209813_100093252 113
234 3300027907 Ga0207428_10276264 Ga0207428_102762642 113
235 3300028380 Ga0268265_10015644 Ga0268265_100156442 113
236 3300034957 Ga0373938_0181215 Ga0373938_0181215_206_550 113
237 3300035111 Ga0373923_0593755 Ga0373923_0593755_162_506 113
238 3300035112 Ga0373932_0450477 Ga0373932_0450477_131_475 113
239 3300035691 Ga0373931_0647112 Ga0373931_0647112_303_647 113
240 3300035692 Ga0373935_0578763 Ga0373935_0578763_134_478 113
241 3300046454 Ga0495592_0070985 Ga0495592_0070985_75_419 113
242 3300046472 Ga0495580_0039786 Ga0495580_0039786_2296_2640 113
243 3300046472 Ga0495580_0873329 Ga0495580_0873329_19_363 113
244 3300046473 Ga0495582_0300009 Ga0495582_0300009_511_855 113
245 3300046511 Ga0495608_0007428 Ga0495608_0007428_3858_4202 113
246 3300046516 Ga0495628_0046322 Ga0495628_0046322_2117_2461 113
247 3300046517 Ga0495630_0002332 Ga0495630_0002332_11959_12303 113
248 3300046529 Ga0495652_0280253 Ga0495652_0280253_103_447 113
249 3300046531 Ga0495665_0399888 Ga0495665_0399888_285_629 113
250 3300046533 Ga0495640_0304737 Ga0495640_0304737_24_368 113
251 3300046535 Ga0495586_0176130 Ga0495586_0176130_350_694 113
252 3300046536 Ga0495587_0137343 Ga0495587_0137343_494_838 113
253 3300046543 Ga0495645_0051538 Ga0495645_0051538_1975_2319 113
254 3300046663 Ga0495635_0160793 Ga0495635_0160793_1037_1381 113
255 3300046675 Ga0495657_0059434 Ga0495657_0059434_105_449 113
256 3300046679 Ga0495623_0582880 Ga0495623_0582880_33_377 113
257 3300046683 Ga0495658_1074216 Ga0495658_1074216_37_384 113
258 3300046684 Ga0495669_0017360 Ga0495669_0017360_2367_2711 113
259 3300046689 Ga0495613_0003284 Ga0495613_0003284_3363_3707 113
260 3300046809 Ga0495600_0034458 Ga0495600_0034458_2457_2801 113
261 3300047315 Ga0495581_0720285 Ga0495581_0720285_12_356 113
262 3300047317 Ga0495604_0046402 Ga0495604_0046402_2349_2693 113
263 3300047321 Ga0495676_0593154 Ga0495676_0593154_47_391 113
264 3300047471 Ga0495684_0001466 Ga0495684_0001466_5678_6022 113
265 3300048088 Ga0495602_0770524 Ga0495602_0770524_293_637 113
266 3300049568 Ga0501031_0008055 Ga0501031_0008055_3423_3767 113
267 3300049570 Ga0501033_0001377 Ga0501033_0001377_11865_12209 113
268 3300049573 Ga0501037_0006531 Ga0501037_0006531_6547_6891 113
269 3300049574 Ga0501038_0019041 Ga0501038_0019041_3951_4298 113
270 3300049574 Ga0501038_0035227 Ga0501038_0035227_2863_3207 113
271 3300049575 Ga0501039_0009454 Ga0501039_0009454_6655_7002 113
272 3300049575 Ga0501039_0019713 Ga0501039_0019713_697_1041 113
273 3300049576 Ga0501040_0004908 Ga0501040_0004908_5859_6206 113
274 3300049576 Ga0501040_0313159 Ga0501040_0313159_264_608 113
275 3300049577 Ga0501041_0004776 Ga0501041_0004776_4944_5291 113
276 3300049578 Ga0501042_0021665 Ga0501042_0021665_2087_2434 113
277 3300049578 Ga0501042_0067956 Ga0501042_0067956_246_590 113
278 3300049579 Ga0501043_0158245 Ga0501043_0158245_102_449 113
279 3300049580 Ga0501046_0002287 Ga0501046_0002287_10244_10591 113
280 3300049581 Ga0501047_0020019 Ga0501047_0020019_2235_2579 113
281 3300049582 Ga0501048_0000550 Ga0501048_0000550_2064_2408 113
282 3300049583 Ga0501067_0631782 Ga0501067_0631782_123_470 113
283 3300049584 Ga0501068_0006614 Ga0501068_0006614_1934_2278 113
284 3300049584 Ga0501068_0052817 Ga0501068_0052817_1560_1907 113
285 3300049587 Ga0501071_0017965 Ga0501071_0017965_2476_2823 113
286 3300049588 Ga0501072_0052741 Ga0501072_0052741_1460_1807 113
287 3300049589 Ga0501073_0013116 Ga0501073_0013116_4663_5007 113
288 3300049591 Ga0501075_0015061 Ga0501075_0015061_62_409 113
289 3300049592 Ga0501076_0046299 Ga0501076_0046299_50_397 113
290 3300049592 Ga0501076_0141170 Ga0501076_0141170_708_1052 113
291 3300049741 Ga0501079_0005508 Ga0501079_0005508_92_439 113
292 3300049742 Ga0501080_0005166 Ga0501080_0005166_1644_1988 113
293 3300049742 Ga0501080_0011555 Ga0501080_0011555_5322_5669 113
294 3300049743 Ga0501081_0000137 Ga0501081_0000137_9722_10069 113
295 3300049744 Ga0501083_0015766 Ga0501083_0015766_2500_2844 113
296 3300049744 Ga0501083_0479979 Ga0501083_0479979_328_675 113
297 3300049822 Ga0501035_0129777 Ga0501035_0129777_1579_1926 113
298 3300049824 Ga0501045_0003017 Ga0501045_0003017_8290_8634 113
299 3300049824 Ga0501045_0023635 Ga0501045_0023635_54_401 113
300 3300050489 nmdc:mga03683_440258_c1 nmdc:mga03683_440258_c1_84_428 113
301 3300050489 nmdc:mga03683_78259_c1 nmdc:mga03683_78259_c1_32_376 113
302 3300050490 nmdc:mga03n38_312042_c1 nmdc:mga03n38_312042_c1_426_770 113
303 3300050491 nmdc:mga00v17_27618_c1 nmdc:mga00v17_27618_c1_1971_2315 113
304 3300050491 nmdc:mga00v17_89201_c1 nmdc:mga00v17_89201_c1_511_855 113
305 3300050492 nmdc:mga0yw44_161470_c1 nmdc:mga0yw44_161470_c1_621_965 113
306 3300050493 nmdc:mga0k408_40437_c2 nmdc:mga0k408_40437_c2_260_604 113
307 3300050494 nmdc:mga06z11_124716_c1 nmdc:mga06z11_124716_c1_68_412 113
308 3300050494 nmdc:mga06z11_51634_c1 nmdc:mga06z11_51634_c1_1252_1596 113
309 3300050495 nmdc:mga04h51_4585_c1 nmdc:mga04h51_4585_c1_1162_1506 113
310 3300050495 nmdc:mga04h51_9643_c1 nmdc:mga04h51_9643_c1_1465_1809 113
311 3300050496 nmdc:mga07m45_45172_c1 nmdc:mga07m45_45172_c1_2022_2366 113
312 3300050507 nmdc:mga05p37_20495_c1 nmdc:mga05p37_20495_c1_4106_4453 113
313 3300050507 nmdc:mga05p37_39939_c1 nmdc:mga05p37_39939_c1_4068_4415 113
314 3300050507 nmdc:mga05p37_457044_c1 nmdc:mga05p37_457044_c1_613_957 113
315 3300050509 nmdc:mga0qj67_1313797_c1 nmdc:mga0qj67_1313797_c1_165_509 113
316 3300050510 nmdc:mga06r32_82130_c1 nmdc:mga06r32_82130_c1_716_1060 113
317 3300050512 nmdc:mga0n895_110245_c1 nmdc:mga0n895_110245_c1_959_1306 113
318 3300050513 nmdc:mga0rr50_802092_c1 nmdc:mga0rr50_802092_c1_285_632 113
319 3300050515 nmdc:mga0a205_1002897_c1 nmdc:mga0a205_1002897_c1_100_447 113
320 3300050515 nmdc:mga0a205_21037_c1 nmdc:mga0a205_21037_c1_3731_4078 113
321 3300053077 Ga0495601_0013185 Ga0495601_0013185_2745_3089 113
322 3300053085 Ga0495619_0001983 Ga0495619_0001983_8388_8732 113
323 3300054114 Ga0501084_0001835 Ga0501084_0001835_9659_10006 113
324 3300060353 Ga0501082_0005375 Ga0501082_0005375_6813_7160 113
325 3300060353 Ga0501082_0502648 Ga0501082_0502648_103_447 113
326 3300061734 Ga0530510_0002830 Ga0530510_0002830_6594_6941 113

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

30

105

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xma-assembly1.cif.gz_B-2 structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9513 9 106
3hhh-assembly1.cif.gz_B crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.9466 10 108
1xma-assembly1.cif.gz_A structure of a transcriptional regulator from clostridium thermocellum cth-833 0.937 9 106
3hhh-assembly1.cif.gz_A crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.9173 8 109
5zqh-assembly1.cif.gz_A-2 crystal structure of streptococcus transcriptional regulator 0.9039 9 108
ID Description Score Start End Superfamily
1xmaA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.937 9 106 1.10.10.10
af_I6X7F9_1_101_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9117 9 109 1.10.10.10
5zqhA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9039 9 108 1.10.10.10
af_P32349_45_122_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9 10 81 1.10.10.10
af_Q9C106_1_81_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8987 12 82 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2V9QX45-F1-model_v4 PadR family transcriptional regulator 1.003 3 79
AF-A0A1E3Y7L6-F1-model_v4 PadR family transcriptional regulator 0.9977 4 111
AF-A0A2V8CZR8-F1-model_v4 PadR family transcriptional regulator 0.9951 15 108
AF-A0A2V9R0R6-F1-model_v4 PadR family transcriptional regulator 0.9929 15 107
AF-A0A2V9QNV6-F1-model_v4 PadR family transcriptional regulator 0.9919 9 83

Feature Viewer

pLDDT pTM Quality
91.06 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map